CA2438628A1 - Artificial proteins with reduced immunogenicity - Google Patents
Artificial proteins with reduced immunogenicity Download PDFInfo
- Publication number
- CA2438628A1 CA2438628A1 CA002438628A CA2438628A CA2438628A1 CA 2438628 A1 CA2438628 A1 CA 2438628A1 CA 002438628 A CA002438628 A CA 002438628A CA 2438628 A CA2438628 A CA 2438628A CA 2438628 A1 CA2438628 A1 CA 2438628A1
- Authority
- CA
- Canada
- Prior art keywords
- amino acid
- fusion protein
- molecule
- modified
- peptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 185
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 178
- 230000002829 reductive effect Effects 0.000 title claims abstract description 69
- 230000005847 immunogenicity Effects 0.000 title claims abstract description 57
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 238
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 151
- 108020001507 fusion proteins Proteins 0.000 claims abstract description 150
- 102000037865 fusion proteins Human genes 0.000 claims abstract description 150
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 104
- 238000000034 method Methods 0.000 claims abstract description 93
- 108060003951 Immunoglobulin Proteins 0.000 claims abstract description 76
- 102000018358 immunoglobulin Human genes 0.000 claims abstract description 76
- 125000000539 amino acid group Chemical group 0.000 claims abstract description 64
- 229920001184 polypeptide Polymers 0.000 claims abstract description 60
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 51
- 239000012634 fragment Substances 0.000 claims abstract description 34
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 claims abstract description 20
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 claims abstract description 20
- 230000009149 molecular binding Effects 0.000 claims abstract description 11
- 230000004071 biological effect Effects 0.000 claims abstract description 9
- 230000027455 binding Effects 0.000 claims description 134
- 241000282414 Homo sapiens Species 0.000 claims description 89
- 150000001413 amino acids Chemical class 0.000 claims description 77
- 238000006467 substitution reaction Methods 0.000 claims description 63
- 102000043131 MHC class II family Human genes 0.000 claims description 52
- 108091054438 MHC class II family Proteins 0.000 claims description 52
- 230000002163 immunogen Effects 0.000 claims description 47
- 108010002350 Interleukin-2 Proteins 0.000 claims description 45
- 230000001225 therapeutic effect Effects 0.000 claims description 38
- 102000004127 Cytokines Human genes 0.000 claims description 35
- 108090000695 Cytokines Proteins 0.000 claims description 35
- 102000000588 Interleukin-2 Human genes 0.000 claims description 35
- 108010087819 Fc receptors Proteins 0.000 claims description 32
- 102000009109 Fc receptors Human genes 0.000 claims description 32
- 230000004927 fusion Effects 0.000 claims description 31
- 239000003446 ligand Substances 0.000 claims description 29
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 claims description 26
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 claims description 26
- 230000000694 effects Effects 0.000 claims description 21
- 239000000427 antigen Substances 0.000 claims description 20
- 108091007433 antigens Proteins 0.000 claims description 20
- 102000036639 antigens Human genes 0.000 claims description 20
- 102000005962 receptors Human genes 0.000 claims description 17
- 108020003175 receptors Proteins 0.000 claims description 17
- 241000894007 species Species 0.000 claims description 16
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 15
- 229940039781 leptin Drugs 0.000 claims description 15
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 13
- 230000002209 hydrophobic effect Effects 0.000 claims description 13
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 claims description 11
- 230000004075 alteration Effects 0.000 claims description 11
- -1 hGH Proteins 0.000 claims description 11
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 claims description 11
- 230000004048 modification Effects 0.000 claims description 11
- 238000012986 modification Methods 0.000 claims description 11
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 claims description 10
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 claims description 10
- 102000003886 Glycoproteins Human genes 0.000 claims description 10
- 108090000288 Glycoproteins Proteins 0.000 claims description 10
- 210000000987 immune system Anatomy 0.000 claims description 10
- 238000000338 in vitro Methods 0.000 claims description 10
- 102000016267 Leptin Human genes 0.000 claims description 9
- 108010092277 Leptin Proteins 0.000 claims description 9
- 239000013604 expression vector Substances 0.000 claims description 9
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 8
- 238000012360 testing method Methods 0.000 claims description 8
- 238000007792 addition Methods 0.000 claims description 7
- 230000008859 change Effects 0.000 claims description 7
- 238000012217 deletion Methods 0.000 claims description 7
- 230000037430 deletion Effects 0.000 claims description 7
- 230000013595 glycosylation Effects 0.000 claims description 7
- 238000006206 glycosylation reaction Methods 0.000 claims description 7
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 7
- 108010065805 Interleukin-12 Proteins 0.000 claims description 6
- 102000013462 Interleukin-12 Human genes 0.000 claims description 6
- 238000004166 bioassay Methods 0.000 claims description 6
- 210000004899 c-terminal region Anatomy 0.000 claims description 6
- 238000000126 in silico method Methods 0.000 claims description 6
- 239000003112 inhibitor Substances 0.000 claims description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 5
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 5
- 102000004877 Insulin Human genes 0.000 claims description 5
- 108090001061 Insulin Proteins 0.000 claims description 5
- 108020004511 Recombinant DNA Proteins 0.000 claims description 5
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 claims description 5
- 102000003675 cytokine receptors Human genes 0.000 claims description 5
- 108010057085 cytokine receptors Proteins 0.000 claims description 5
- 229940088597 hormone Drugs 0.000 claims description 5
- 239000005556 hormone Substances 0.000 claims description 5
- 229940125396 insulin Drugs 0.000 claims description 5
- 102000003298 tumor necrosis factor receptor Human genes 0.000 claims description 5
- 102000001301 EGF receptor Human genes 0.000 claims description 4
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 4
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 claims description 4
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 4
- 229940022353 herceptin Drugs 0.000 claims description 4
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 4
- 102400000068 Angiostatin Human genes 0.000 claims description 3
- 108010079709 Angiostatins Proteins 0.000 claims description 3
- 108010005939 Ciliary Neurotrophic Factor Proteins 0.000 claims description 3
- 102100031614 Ciliary neurotrophic factor Human genes 0.000 claims description 3
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 claims description 3
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 claims description 3
- 239000003085 diluting agent Substances 0.000 claims description 3
- 230000001747 exhibiting effect Effects 0.000 claims description 3
- JFINOWIINSTUNY-UHFFFAOYSA-N pyrrolidin-3-ylmethanesulfonamide Chemical compound NS(=O)(=O)CC1CCNC1 JFINOWIINSTUNY-UHFFFAOYSA-N 0.000 claims description 3
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 claims description 2
- IYMAXBFPHPZYIK-BQBZGAKWSA-N Arg-Gly-Asp Chemical class NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IYMAXBFPHPZYIK-BQBZGAKWSA-N 0.000 claims description 2
- 102100022641 Coagulation factor IX Human genes 0.000 claims description 2
- 108060006698 EGF receptor Proteins 0.000 claims description 2
- 102400001047 Endostatin Human genes 0.000 claims description 2
- 108010079505 Endostatins Proteins 0.000 claims description 2
- 108010076282 Factor IX Proteins 0.000 claims description 2
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 claims description 2
- 108090001007 Interleukin-8 Proteins 0.000 claims description 2
- 102100033237 Pro-epidermal growth factor Human genes 0.000 claims description 2
- 101710098940 Pro-epidermal growth factor Proteins 0.000 claims description 2
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 claims description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 claims description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 claims description 2
- 108091008605 VEGF receptors Proteins 0.000 claims description 2
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 claims description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 2
- 230000003092 anti-cytokine Effects 0.000 claims description 2
- 230000000603 anti-haemophilic effect Effects 0.000 claims description 2
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 claims description 2
- 239000000430 cytokine receptor antagonist Substances 0.000 claims description 2
- 229960004222 factor ix Drugs 0.000 claims description 2
- 239000003102 growth factor Substances 0.000 claims description 2
- 239000000122 growth hormone Substances 0.000 claims description 2
- 102000006495 integrins Human genes 0.000 claims description 2
- 108010044426 integrins Proteins 0.000 claims description 2
- 210000004897 n-terminal region Anatomy 0.000 claims description 2
- 229960000856 protein c Drugs 0.000 claims description 2
- 238000005070 sampling Methods 0.000 claims description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 claims 3
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 claims 2
- 101001093708 Autographa californica nuclear polyhedrosis virus Per os infectivity factor 6 Proteins 0.000 claims 1
- 108010092408 Eosinophil Peroxidase Proteins 0.000 claims 1
- 102100028471 Eosinophil peroxidase Human genes 0.000 claims 1
- 101150021185 FGF gene Proteins 0.000 claims 1
- 102100027188 Thyroid peroxidase Human genes 0.000 claims 1
- 101710113649 Thyroid peroxidase Proteins 0.000 claims 1
- 238000004364 calculation method Methods 0.000 abstract description 11
- 238000004519 manufacturing process Methods 0.000 abstract description 11
- 238000001727 in vivo Methods 0.000 abstract description 10
- 102000035118 modified proteins Human genes 0.000 abstract description 7
- 108091005573 modified proteins Proteins 0.000 abstract description 7
- 230000001900 immune effect Effects 0.000 abstract description 3
- 230000008105 immune reaction Effects 0.000 abstract description 3
- 230000000144 pharmacologic effect Effects 0.000 abstract description 3
- 235000018102 proteins Nutrition 0.000 description 162
- 235000001014 amino acid Nutrition 0.000 description 88
- 229940024606 amino acid Drugs 0.000 description 80
- 210000004027 cell Anatomy 0.000 description 50
- 241001529936 Murinae Species 0.000 description 44
- 125000004429 atom Chemical group 0.000 description 40
- 230000006870 function Effects 0.000 description 35
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 34
- 108020004414 DNA Proteins 0.000 description 33
- 229910052739 hydrogen Inorganic materials 0.000 description 29
- 239000001257 hydrogen Substances 0.000 description 29
- 239000011575 calcium Substances 0.000 description 21
- 230000003993 interaction Effects 0.000 description 21
- 229940127121 immunoconjugate Drugs 0.000 description 17
- 230000035772 mutation Effects 0.000 description 16
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 15
- 235000004279 alanine Nutrition 0.000 description 14
- 201000010099 disease Diseases 0.000 description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 14
- 230000008569 process Effects 0.000 description 14
- 238000011282 treatment Methods 0.000 description 14
- 108700028369 Alleles Proteins 0.000 description 13
- 102000053602 DNA Human genes 0.000 description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 13
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 13
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 13
- 206010028980 Neoplasm Diseases 0.000 description 13
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 12
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 12
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 12
- 210000003719 b-lymphocyte Anatomy 0.000 description 12
- 230000028993 immune response Effects 0.000 description 12
- 239000000203 mixture Substances 0.000 description 12
- 239000013598 vector Substances 0.000 description 12
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 11
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 11
- 101001076407 Homo sapiens Interleukin-1 receptor antagonist protein Proteins 0.000 description 11
- 241000282412 Homo Species 0.000 description 10
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 10
- 150000001875 compounds Chemical class 0.000 description 10
- 230000001186 cumulative effect Effects 0.000 description 10
- 210000004602 germ cell Anatomy 0.000 description 10
- 238000002360 preparation method Methods 0.000 description 10
- 108010017544 Glucosylceramidase Proteins 0.000 description 9
- 102100033342 Lysosomal acid glucosylceramidase Human genes 0.000 description 9
- 150000001408 amides Chemical class 0.000 description 9
- 239000011230 binding agent Substances 0.000 description 9
- 238000000205 computational method Methods 0.000 description 9
- 230000014509 gene expression Effects 0.000 description 9
- 230000001976 improved effect Effects 0.000 description 9
- 235000014705 isoleucine Nutrition 0.000 description 9
- 229960000310 isoleucine Drugs 0.000 description 9
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 9
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 description 8
- 125000001931 aliphatic group Chemical group 0.000 description 8
- 125000003118 aryl group Chemical group 0.000 description 8
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 125000004435 hydrogen atom Chemical class [H]* 0.000 description 8
- 229940072221 immunoglobulins Drugs 0.000 description 8
- 230000007246 mechanism Effects 0.000 description 8
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 7
- 229940119178 Interleukin 1 receptor antagonist Drugs 0.000 description 7
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 7
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 7
- 108700012920 TNF Proteins 0.000 description 7
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 230000001472 cytotoxic effect Effects 0.000 description 7
- 230000008030 elimination Effects 0.000 description 7
- 238000003379 elimination reaction Methods 0.000 description 7
- 239000003407 interleukin 1 receptor blocking agent Substances 0.000 description 7
- 235000013930 proline Nutrition 0.000 description 7
- 235000002639 sodium chloride Nutrition 0.000 description 7
- 239000000126 substance Substances 0.000 description 7
- 239000004474 valine Substances 0.000 description 7
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 6
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 6
- 239000004472 Lysine Substances 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 6
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 6
- 239000000370 acceptor Substances 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 238000010276 construction Methods 0.000 description 6
- 238000013461 design Methods 0.000 description 6
- 230000002255 enzymatic effect Effects 0.000 description 6
- 210000002865 immune cell Anatomy 0.000 description 6
- 235000018977 lysine Nutrition 0.000 description 6
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 6
- 230000000717 retained effect Effects 0.000 description 6
- 210000002966 serum Anatomy 0.000 description 6
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 5
- 208000015872 Gaucher disease Diseases 0.000 description 5
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 description 5
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 5
- 239000005557 antagonist Substances 0.000 description 5
- 230000005875 antibody response Effects 0.000 description 5
- 239000002246 antineoplastic agent Substances 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 201000011510 cancer Diseases 0.000 description 5
- 229910052799 carbon Inorganic materials 0.000 description 5
- 231100000433 cytotoxic Toxicity 0.000 description 5
- 230000029087 digestion Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 229930195712 glutamate Natural products 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 150000007523 nucleic acids Chemical class 0.000 description 5
- 229920001542 oligosaccharide Polymers 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 230000001131 transforming effect Effects 0.000 description 5
- 102000000844 Cell Surface Receptors Human genes 0.000 description 4
- 108010001857 Cell Surface Receptors Proteins 0.000 description 4
- 108091035707 Consensus sequence Proteins 0.000 description 4
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 4
- 101001060261 Homo sapiens Fibroblast growth factor 7 Proteins 0.000 description 4
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 4
- 102000000589 Interleukin-1 Human genes 0.000 description 4
- 108010002352 Interleukin-1 Proteins 0.000 description 4
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- 239000004473 Threonine Substances 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 108010060162 alglucerase Proteins 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 229940127089 cytotoxic agent Drugs 0.000 description 4
- 230000002349 favourable effect Effects 0.000 description 4
- 235000011187 glycerol Nutrition 0.000 description 4
- 102000057239 human FGF7 Human genes 0.000 description 4
- 125000001165 hydrophobic group Chemical group 0.000 description 4
- 210000002540 macrophage Anatomy 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- 229930182817 methionine Natural products 0.000 description 4
- 229910052757 nitrogen Inorganic materials 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 229910052760 oxygen Inorganic materials 0.000 description 4
- 230000036470 plasma concentration Effects 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 238000010254 subcutaneous injection Methods 0.000 description 4
- 239000007929 subcutaneous injection Substances 0.000 description 4
- 239000004475 Arginine Substances 0.000 description 3
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 108010008165 Etanercept Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 3
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 101000987586 Homo sapiens Eosinophil peroxidase Proteins 0.000 description 3
- 101000920686 Homo sapiens Erythropoietin Proteins 0.000 description 3
- 101001063991 Homo sapiens Leptin Proteins 0.000 description 3
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 206010040047 Sepsis Diseases 0.000 description 3
- 208000007502 anemia Diseases 0.000 description 3
- 230000003302 anti-idiotype Effects 0.000 description 3
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000001185 bone marrow Anatomy 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 238000002884 conformational search Methods 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 230000009881 electrostatic interaction Effects 0.000 description 3
- 229940073621 enbrel Drugs 0.000 description 3
- 229940126864 fibroblast growth factor Drugs 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 235000004554 glutamine Nutrition 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 102000044890 human EPO Human genes 0.000 description 3
- 102000046824 human IL1RN Human genes 0.000 description 3
- 102000049953 human LEP Human genes 0.000 description 3
- 239000002955 immunomodulating agent Substances 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 108020001756 ligand binding domains Proteins 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 235000015097 nutrients Nutrition 0.000 description 3
- 150000002482 oligosaccharides Chemical class 0.000 description 3
- 239000001301 oxygen Substances 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 150000003147 proline derivatives Chemical class 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 210000001541 thymus gland Anatomy 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 206010006895 Cachexia Diseases 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- YBSQGNFRWZKFMJ-UHFFFAOYSA-N Cerebroside B Natural products CCCCCCCCCCCCCCC(O)C(=O)NC(C(O)C=CCCC=C(C)CCCCCCCCC)COC1OC(CO)C(O)C(O)C1O YBSQGNFRWZKFMJ-UHFFFAOYSA-N 0.000 description 2
- 241000251204 Chimaeridae Species 0.000 description 2
- 241001227713 Chiron Species 0.000 description 2
- 150000008574 D-amino acids Chemical class 0.000 description 2
- 102000004594 DNA Polymerase I Human genes 0.000 description 2
- 108010017826 DNA Polymerase I Proteins 0.000 description 2
- 108010016626 Dipeptides Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102000003951 Erythropoietin Human genes 0.000 description 2
- 108090000394 Erythropoietin Proteins 0.000 description 2
- 108010054218 Factor VIII Proteins 0.000 description 2
- 102000001690 Factor VIII Human genes 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 101100425757 Homo sapiens TNFRSF1B gene Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 108010078049 Interferon alpha-2 Proteins 0.000 description 2
- 102100039350 Interferon alpha-7 Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 102000004882 Lipase Human genes 0.000 description 2
- 108090001060 Lipase Proteins 0.000 description 2
- 239000004367 Lipase Substances 0.000 description 2
- 208000015439 Lysosomal storage disease Diseases 0.000 description 2
- 108010031099 Mannose Receptor Proteins 0.000 description 2
- 241000255964 Pieridae Species 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 108010001267 Protein Subunits Proteins 0.000 description 2
- 102000002067 Protein Subunits Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 108090000787 Subtilisin Proteins 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 101710187743 Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 2
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 2
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 2
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 2
- 102000018594 Tumour necrosis factor Human genes 0.000 description 2
- 108050007852 Tumour necrosis factor Proteins 0.000 description 2
- 235000010724 Wisteria floribunda Nutrition 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 229940041181 antineoplastic drug Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 125000004432 carbon atom Chemical group C* 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 229940049197 cerezyme Drugs 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 125000004122 cyclic group Chemical group 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 230000001627 detrimental effect Effects 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 229940105423 erythropoietin Drugs 0.000 description 2
- 229960000301 factor viii Drugs 0.000 description 2
- 238000007429 general method Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 102000035122 glycosylated proteins Human genes 0.000 description 2
- 108091005608 glycosylated proteins Proteins 0.000 description 2
- 230000003394 haemopoietic effect Effects 0.000 description 2
- 239000000833 heterodimer Substances 0.000 description 2
- 108010039650 imiglucerase Proteins 0.000 description 2
- 230000001024 immunotherapeutic effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 229940079322 interferon Drugs 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 150000002519 isoleucine derivatives Chemical class 0.000 description 2
- 150000002614 leucines Chemical class 0.000 description 2
- 235000019421 lipase Nutrition 0.000 description 2
- 239000007791 liquid phase Substances 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 210000003712 lysosome Anatomy 0.000 description 2
- 230000001868 lysosomic effect Effects 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000003032 molecular docking Methods 0.000 description 2
- 238000012900 molecular simulation Methods 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 231100000255 pathogenic effect Toxicity 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 238000009520 phase I clinical trial Methods 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 2
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 150000003587 threonine derivatives Chemical class 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 229940046728 tumor necrosis factor alpha inhibitor Drugs 0.000 description 2
- 239000002451 tumor necrosis factor inhibitor Substances 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 150000003679 valine derivatives Chemical class 0.000 description 2
- MIJDSYMOBYNHOT-UHFFFAOYSA-N 2-(ethylamino)ethanol Chemical compound CCNCCO MIJDSYMOBYNHOT-UHFFFAOYSA-N 0.000 description 1
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 206010002199 Anaphylactic shock Diseases 0.000 description 1
- 241000024188 Andala Species 0.000 description 1
- 108010002913 Asialoglycoproteins Proteins 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 241000283725 Bos Species 0.000 description 1
- 241000701822 Bovine papillomavirus Species 0.000 description 1
- YDNKGFDKKRUKPY-JHOUSYSJSA-N C16 ceramide Natural products CCCCCCCCCCCCCCCC(=O)N[C@@H](CO)[C@H](O)C=CCCCCCCCCCCCCC YDNKGFDKKRUKPY-JHOUSYSJSA-N 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 101001007681 Candida albicans (strain WO-1) Kexin Proteins 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 241000699679 Cricetulus migratorius Species 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 101710147220 Ent-copalyl diphosphate synthase, chloroplastic Proteins 0.000 description 1
- 108091006020 Fc-tagged proteins Proteins 0.000 description 1
- 241000287227 Fringillidae Species 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 102100029966 HLA class II histocompatibility antigen, DP alpha 1 chain Human genes 0.000 description 1
- 108010010378 HLA-DP Antigens Proteins 0.000 description 1
- 102000015789 HLA-DP Antigens Human genes 0.000 description 1
- 108010062347 HLA-DQ Antigens Proteins 0.000 description 1
- 102100031000 Hepatoma-derived growth factor Human genes 0.000 description 1
- 208000028782 Hereditary disease Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000739876 Homo sapiens Brain-derived neurotrophic factor Proteins 0.000 description 1
- 101000864089 Homo sapiens HLA class II histocompatibility antigen, DP alpha 1 chain Proteins 0.000 description 1
- 101000930802 Homo sapiens HLA class II histocompatibility antigen, DQ alpha 1 chain Proteins 0.000 description 1
- 101000968032 Homo sapiens HLA class II histocompatibility antigen, DR beta 3 chain Proteins 0.000 description 1
- 101001083798 Homo sapiens Hepatoma-derived growth factor Proteins 0.000 description 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 1
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 101150083678 IL2 gene Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 101710144554 Interleukin-1 receptor antagonist protein Proteins 0.000 description 1
- 102100026018 Interleukin-1 receptor antagonist protein Human genes 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 229910021380 Manganese Chloride Inorganic materials 0.000 description 1
- GLFNIEUTAYBVOC-UHFFFAOYSA-L Manganese chloride Chemical compound Cl[Mn]Cl GLFNIEUTAYBVOC-UHFFFAOYSA-L 0.000 description 1
- 208000024556 Mendelian disease Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241000736257 Monodelphis domestica Species 0.000 description 1
- 101001055320 Myxine glutinosa Insulin-like growth factor Proteins 0.000 description 1
- CRJGESKKUOMBCT-VQTJNVASSA-N N-acetylsphinganine Chemical compound CCCCCCCCCCCCCCC[C@@H](O)[C@H](CO)NC(C)=O CRJGESKKUOMBCT-VQTJNVASSA-N 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 241000772415 Neovison vison Species 0.000 description 1
- 108010025020 Nerve Growth Factor Proteins 0.000 description 1
- 102000015336 Nerve Growth Factor Human genes 0.000 description 1
- 101100498071 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) cys-17 gene Proteins 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical class [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 241000700161 Rattus rattus Species 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000710961 Semliki Forest virus Species 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 239000005864 Sulphur Substances 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- ATJFFYVFTNAWJD-UHFFFAOYSA-N Tin Chemical compound [Sn] ATJFFYVFTNAWJD-UHFFFAOYSA-N 0.000 description 1
- 241000289678 Trichosurus Species 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 1
- 101710113414 Tumor necrosis factor ligand superfamily member 8 Proteins 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 125000002015 acyclic group Chemical group 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 238000011360 adjunctive therapy Methods 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 229960003122 alglucerase Drugs 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 208000003455 anaphylaxis Diseases 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000003409 anti-rejection Effects 0.000 description 1
- 210000000612 antigen-presenting cell Anatomy 0.000 description 1
- 229940034982 antineoplastic agent Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 150000001483 arginine derivatives Chemical class 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 102000023732 binding proteins Human genes 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 238000010322 bone marrow transplantation Methods 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000000337 buffer salt Substances 0.000 description 1
- 150000001720 carbohydrates Chemical group 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 229940106189 ceramide Drugs 0.000 description 1
- ZVEQCJWYRWKARO-UHFFFAOYSA-N ceramide Natural products CCCCCCCCCCCCCCC(O)C(=O)NC(CO)C(O)C=CCCC=C(C)CCCCCCCCC ZVEQCJWYRWKARO-UHFFFAOYSA-N 0.000 description 1
- 210000003679 cervix uteri Anatomy 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000020832 chronic kidney disease Diseases 0.000 description 1
- 208000022831 chronic renal failure syndrome Diseases 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 239000003636 conditioned culture medium Substances 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 1
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 1
- UFJPAQSLHAGEBL-RRKCRQDMSA-N dITP Chemical compound O1[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C[C@@H]1N1C(N=CNC2=O)=C2N=C1 UFJPAQSLHAGEBL-RRKCRQDMSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- 239000000386 donor Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000003013 erythroid precursor cell Anatomy 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 210000000497 foam cell Anatomy 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-L glutamate group Chemical class N[C@@H](CCC(=O)[O-])C(=O)[O-] WHUUTDBJXJRKMK-VKHMYHEASA-L 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycine anhydride Natural products [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 1
- 108010001064 glycyl-glycyl-glycyl-glycine Proteins 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 150000002410 histidine derivatives Chemical class 0.000 description 1
- 230000003284 homeostatic effect Effects 0.000 description 1
- 102000051542 human BDNF Human genes 0.000 description 1
- 102000057041 human TNF Human genes 0.000 description 1
- 229940077456 human brain-derived neurotrophic factor Drugs 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 235000011167 hydrochloric acid Nutrition 0.000 description 1
- 239000000852 hydrogen donor Substances 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 125000000741 isoleucyl group Chemical group [H]N([H])C(C(C([H])([H])[H])C([H])([H])C([H])([H])[H])C(=O)O* 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000011565 manganese chloride Substances 0.000 description 1
- 235000002867 manganese chloride Nutrition 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 150000002741 methionine derivatives Chemical class 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000000329 molecular dynamics simulation Methods 0.000 description 1
- 238000000324 molecular mechanic Methods 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000003039 myelosuppressive effect Effects 0.000 description 1
- DAZSWUUAFHBCGE-KRWDZBQOSA-N n-[(2s)-3-methyl-1-oxo-1-pyrrolidin-1-ylbutan-2-yl]-3-phenylpropanamide Chemical compound N([C@@H](C(C)C)C(=O)N1CCCC1)C(=O)CCC1=CC=CC=C1 DAZSWUUAFHBCGE-KRWDZBQOSA-N 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 210000003739 neck Anatomy 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 229940053128 nerve growth factor Drugs 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- VVGIYYKRAMHVLU-UHFFFAOYSA-N newbouldiamide Natural products CCCCCCCCCCCCCCCCCCCC(O)C(O)C(O)C(CO)NC(=O)CCCCCCCCCCCCCCCCC VVGIYYKRAMHVLU-UHFFFAOYSA-N 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 125000004430 oxygen atom Chemical group O* 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 210000001322 periplasm Anatomy 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 239000008196 pharmacological composition Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 150000008300 phosphoramidites Chemical class 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- OJMIONKXNSYLSR-UHFFFAOYSA-N phosphorous acid Chemical compound OP(O)O OJMIONKXNSYLSR-UHFFFAOYSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 230000004983 pleiotropic effect Effects 0.000 description 1
- 108010087782 poly(glycyl-alanyl) Proteins 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000232 polyglycine polymer Polymers 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 235000011056 potassium acetate Nutrition 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 150000003354 serine derivatives Chemical class 0.000 description 1
- 125000005629 sialic acid group Chemical group 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000002922 simulated annealing Methods 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229940126622 therapeutic monoclonal antibody Drugs 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Abstract
The invention relates to artificial modified proteins, preferably fusion proteins, having a reduced immunogenicity compared to the parent non-modifie d molecule when exposed to a species in vivo. The invention relates, above all , to novel immunoglobulin fusion proteins which essentially consist of an immunoglobulin molecule or a fragment thereof covalently fused via its C- terminus to the N-terminus of a biologically active non-immunoglobulin molecule, preferably a polypeptide or protein or a biologically active fragment thereof. In a specific embodiment, the invention relates to fusion proteins consisting of an Fc portion of an antibody which is fused as mentioned to the non-immunological target molecule which elicits biological or pharmacological efficacy. The molecules of the invention have amino acid sequences which are altered in one or more amino acid residue positions but have in principal the same biological activity as compared with the non- altered molecules. The changes are made in regions of the molecules which ar e identified as T-cell epitopes, which contribute to an immune reaction in a living host. Thus, the invention also relates to a novel method of making su ch fusion proteins by identifying said epitopes comprising calculation of T-cel l epitope values for MHC Class II molecule binding sites in a peptide by computer-aided methods.
Description
ARTIFICIAL PROTEINS WITH REDUCED IMMUNOGENICITY
TECHNICAL FIELD OF THE INVENTION
The invention relates to modified artificial proteins, preferably fusion proteins, having a reduced immunogenicity compared to the parent non-modified molecule when exposed to a species in vivo. Especially, the invention relates to proteins that are as single component normally not strongly immunogenic, but which have enhanced immunogenicity when attached to a second protein moiety to form an, as a rule, artificial fusion protein.
The invention relates, above all, to modified and, thus, novel immunoglobulin (Ig) fusion proteins which essentially 1o consist of an immunoglobulin molecule or a fragment thereof covalently fused via its C-terminus to the N-terminus of a biologically active non-immunoglobulin molecule, preferably a polypeptide or protein or a biologically active fragment thereof. In a specific embodiment, the invention relates to fusion proteins consisting of an Fc portion of an antibody which is fused as mentioned to the non-immunological target molecule which elicits biological or pharmacological efficacy.
The molecules of the invention have amino acid sequences which are altered in one or more amino acid residue positions but have in principal the same biological activity as compared with the non-altered molecules. The changes are made in regions of the molecules which are identified as T-cell epitopes, which contribute to an immune reaction in a living host. Thus, the invention also relates to a novel method for preparing said fusion proteins by identifying said epitopes comprising calculation of T-cell epitope values for MHC Class II
molecule binding sites in a peptide by computer-aided methods.
BACKGROUND OF THE INVENTION
Therapeutic fusion proteins are, as a rule, artificial molecules, which are produced to combine known favorable properties of the single components or to create new properties. For example, a fusion protein may contain an immunogenic moiety that causes a normally non-immunogenic fusion partner to become immunogenic. In other cases, each of the components are immunogenic and the fusion molecule has kept this usually undesired property. Finally, it is possible that fusing non or less immunogenic components the fusion product is immunogenic by creating the bonds, especially the junction region.
Fusion proteins of specific interests in this context are immunoconjugates.
Immunoconjugates are known since a couple of years and many of them have shown pharmacological efficacy in CONFIRMATION COPY
TECHNICAL FIELD OF THE INVENTION
The invention relates to modified artificial proteins, preferably fusion proteins, having a reduced immunogenicity compared to the parent non-modified molecule when exposed to a species in vivo. Especially, the invention relates to proteins that are as single component normally not strongly immunogenic, but which have enhanced immunogenicity when attached to a second protein moiety to form an, as a rule, artificial fusion protein.
The invention relates, above all, to modified and, thus, novel immunoglobulin (Ig) fusion proteins which essentially 1o consist of an immunoglobulin molecule or a fragment thereof covalently fused via its C-terminus to the N-terminus of a biologically active non-immunoglobulin molecule, preferably a polypeptide or protein or a biologically active fragment thereof. In a specific embodiment, the invention relates to fusion proteins consisting of an Fc portion of an antibody which is fused as mentioned to the non-immunological target molecule which elicits biological or pharmacological efficacy.
The molecules of the invention have amino acid sequences which are altered in one or more amino acid residue positions but have in principal the same biological activity as compared with the non-altered molecules. The changes are made in regions of the molecules which are identified as T-cell epitopes, which contribute to an immune reaction in a living host. Thus, the invention also relates to a novel method for preparing said fusion proteins by identifying said epitopes comprising calculation of T-cell epitope values for MHC Class II
molecule binding sites in a peptide by computer-aided methods.
BACKGROUND OF THE INVENTION
Therapeutic fusion proteins are, as a rule, artificial molecules, which are produced to combine known favorable properties of the single components or to create new properties. For example, a fusion protein may contain an immunogenic moiety that causes a normally non-immunogenic fusion partner to become immunogenic. In other cases, each of the components are immunogenic and the fusion molecule has kept this usually undesired property. Finally, it is possible that fusing non or less immunogenic components the fusion product is immunogenic by creating the bonds, especially the junction region.
Fusion proteins of specific interests in this context are immunoconjugates.
Immunoconjugates are known since a couple of years and many of them have shown pharmacological efficacy in CONFIRMATION COPY
vitro and in vivo. Immunoconjugates are chimeric molecules consisting, as a rule, of a portion deriving from an immunoglobulin or a fragment thereof and a target polypeptide or protein which is linked to the immunoglobulin molecule. Originally, immunoconjugates were prepared consisting of a complete antibody and a cytotoxic agent like a cytokine which was fused via its N- terminus to the C-terminus of the constant domain of the immunoglobulin, or alternatively, via its C-terminus to the N-terminus of the variable region of the antibody (see, for example EP 0439 095, WO 92/08495, US 5,349,053, EP 0659 439, EP 0706 799).
These chimeric molecules are bi-functional by targeting a specific antigen, for example, on a tumor cell surface by means of the binding sites within the CDRs of the variable domain of the antibody portion or a fragment thereof, and by the simultaneous cytotoxic effect of the cytokine which is coupled to the immunoglobulin and thus can, theoretically, only or predominantly attack the targeted cell. In this context, also tri- and mufti-functional immunoconjugates were developed including constructs consisting of sFv-, Fab-, Fab' or F(ab')2 fragments of different antibodies, wherein in each case the targeting function of the immunoglobulin portion was advantageously used.
Another immunoglobulin modification is the use of the Fc region of antibodies.
Antibodies comprise two functionally independent parts, a variable domain known as "Fab"
, "Fab", "F(ab')2", dependent on the kind of digestion of the molecule, which bind antigen, and a constant domain, known as "Fc" which provides the link to effector functions such as 2o complement or phagocytic cells. The Fc portion of an immunoglobulin has a long plasma half-life, whereas the Fab fragments are short-lived (Capon, et al., Nature 337: 525-531 (1989)).
Therapeutic protein products have been constructed using the Fc domain to provide longer half-life or to incorporate functions such as Fc receptor binding, protein A
binding, complement fixation and placental transfer which all reside in the Fc proteins of immunoglobulins. For example, the Fc region of an IgGI antibody has been fused to the N-terminal end of CD30-L, a molecule which binds CD30 receptors expressed on Hodgkin's Disease tumor cells, anaplastic lymphoma cells, T-cell leukemia cells and other malignant cell types (US 5,480,981).1L-10, an anti-inflammatory and antirejection agent has been fused to murine Fc~y2a in order to increase the cytokine's short circulating half-life (Zheng et al., The Journal of Immunology, 154: 5590-5600 (1995)). Studies have also evaluated the use of tumor necrosis factor receptor linked with the Fc protein of human IgGI to treat patients with septic shock (Fisher et al., N. Engl. J. Med., 334: 1697-1702 (1996); Van Zee et al., The Journal of Immunology, 156: 2221-2230 (1996)). Fc has also been fused with receptor to produce a therapeutic protein for treatment of AIDS (see: Capon et al., Nature, 337:525-531 (1989)). Principally, Fc can be fused to the target protein or peptide via its C- or N-terminus using the N- and C-terminus of the protein, respectively. A chimer of Fc and TNF
and EPO was disclosed in EP 0464 533 (Hoechst/ General Hospital), wherein the N-terminus of Fc was coupled to the C-terminus of the protein (X-Fc). The identical conjunction was selected for leptin-Fc chimers disclosed in WO 97/00319 (SKB) and WO 97/24440 (Genentech). There are a lot of publications and patent applications describing the opposite linkage of Fc-protein chimers (Fc-X), such as Fc-(IL-2), Fc-EPO, Fc-PSMA, Fc-(IL-12), Fc-TNFa, Fc-(GM-CSF), Fc-TNFR, Fc-endostatin, Fc, angiostatin, Fc-gp 120, Fc-leptin, Fc-IFNa, Fc-(G-CSF). Examples are WO 96/08570, (Fuji / Merck KGaA), WO 98/28427 (Amgen), WO 99/02709 (Beth Israel Medical Care Center) and WO 99/58662 (Fuji / Merck KGaA).
WO 00/24782 (Amgen) discloses a huge number of possible Fc-X conjugates, wherein the linkage between the two partners may be Fc-X or X-Fc. An extensive development of Fc-X
molecules was realized by Lexigen / Merck KgaA as disclosed in US 5,541,087, WO
99/43713, WO 99/29732, WO 99/52562, WO 99/53958, WO 00/11033, WO 01/07081, PCT/EP00/10843.Thus, X-Fc and Fc-X molecules which have "lost" their antigen binding sites, as well as molecules, wherein the binding sites and thus their antigen-specific targeting functions are conserved, are of great interest as promising therapeutic proteins and there exists a further need to develop analogue compositions for different clinical application.
Non-natural therapeutic proteins are often particularly immunogenic. For example, Enbrel is a fusion protein consisting of an extracellular domain of a Tumor Necrosis Factor Receptor (TNF-R) fused to an Fc region of an antibody. About 16% of patients treated with Enbrel have been reported to develop antibodies to this fusion protein (Physician's Desk Reference [2001] p. 3372). Similarly, a fusion protein consisting of erythropoietin (Epo) and granulocyte / macrophage-colony stimulating factor (GMCSF) was found to be highly immunogenic (Coscarella A, et al. [1998) Cytokine 10:964-9; Coscarella A, Mol Biotechnol.
[1998] 10:115-22). When injected into a primate, Epo-GMCSF fusion proteins were found to induce a strong antibody response to the Epo moiety of the fusion protein, resulting in anemia.
CeredaseTM and CerezymeTM are forms of the lysosomal enzyme glucocerebrosidase used to treat Gaucher's disease; as a result of genetic engineering, glucocerebrosidase is attached to an unusual high-mannose glycosylation. Patients with Gaucher's disease lack glucocerebrosidase in their lysosomes, and as a result the patients' macrophages tend to accumulate lipids and become foam cells (The Metabolic and Molecaclar Bases of Inherited Disease, 8'" Edition [2001] Scriver et al. eds. Chapter 146, "Gaucher Disease." p. 3635-3668).
After administration of CeredaseTM or CerezymeTM, the therapeutic protein is bound by mannose receptors on macrophages, endocytosed, and trafficked through the endosomes to the lysosome, which is its proper location. Patients treated with Ceredase often develop antibodies to glucocerebrosidase (Pastores GM, et al., Blood [1993] 82:408-16;
Physicians' Desk Reference [2001] p. 1325-1326). Such antibodies can interfere with treatment (Brady RO, et al., Pediatrics. [1997] 100(6):E1 l.). In a Phase I clinical trial using an antibody-cytokine fusion protein, several patients developed antibody responses to the therapeutic fusion protein. In this case, the antibody moiety was a humanized form of the 14.18 antibody, and the cytokine was interleukin-2 (IL-2). Many of the reactive patients' sera included significant levels of anti-idiotype antibodies.
Therapeutic use of a number of peptides, polypeptides and proteins is curtailed because of their immunogenicity in mammals, especially humans. For example, when murine antibodies are administered to patients who are not immunosuppressed, a majority of such patients exhibit an immune reaction to the introduced foreign material by making human anti-murine antibodies (HAMA) (e.g. Schroff, R. W. et al (1985) Cancer Res. 45: 879-885;
Shawler, D.L.
et al (1985) J. Immccnol. 135: 1530-1535). There are two serious consequences.
First, the patient's anti-murine antibody may bind and clear the therapeutic antibody or immunoconjugate before it has a chance to bind, for example to a tumor, and perform its therapeutic function. Second, the patient may develop an allergic sensitivity to the murine antibody and be at risk of anaphylactic shock upon any future exposure to murine immunoglobulin.
Several techniques have been employed to address the HAMA problem and thus enable the use in humans of therapeutic monoclonal antibodies (see, for example, W089/09622, EP0239400, EP0438310, W091/09967). These recombinant DNA approaches have generally reduced the mouse genetic information in the final antibody construct whilst increasing the human genetic information in the final construct. Notwithstanding, the resultant "humanized"
antibodies have, in several cases, still elicited an immune response in patients (Issacs J.D.
( 1990) Sem: Immunol. 2: 449, 456; Rebello, P.R. et al ( 1999) Transplantation 68: 1417-1420).
A common aspect of these methodologies has been the introduction into the therapeutic antibody, usually of rodent origin, of amino acid residues, even significant tracts of amino acid residue sequences, identical to those present in human antibody proteins. For antibodies, this process is possible owing to the relatively high degree of structural (and functional) conservatism among antibody molecules of different species. For potentially therapeutic peptides, polypeptides and proteins, however, where no structural homologue may exist in the host species (e.g., human) for the therapeutic protein, such processes are not applicable.
Furthermore, these methods have assumed that the general introduction of a human amino acid residue sequence will render the re-modeled antibody non-immunogenic. It is known, however, that certain short peptide sequences ("T-cell epitopes") can be released during the degradation of peptides, polypeptides or proteins within cells and subsequently be presented by molecules of the major histocompatability complex (MHC) in order to trigger the activation of T-cells. For peptides presented by MHC Class II, such activation of T-cells can then give rise to an antibody response by direct stimulation of B-cells to produce such antibodies.
Accordingly, it would be desirable to eliminate potential T-cell epitopes from a peptide, polypeptide or a protein. Even proteins of human origin and with the same amino acid sequences as occur within humans can still induce an immune response in humans. Notable examples include therapeutic use of granulocyte-macrophage colony stimulating factor (Wadhwa, M. et al (1999) Clin. Cancer Res. 5: 1353-1361) and interferon alpha 2 (Russo, D.
2o et al (1996) Bri. J. Haem. 94: 300-305; Stein, R. et al (1988) New Ervgl.
J. Med. 318: 1409-1413).
During the last couple of years several techniques were published which suggest solutions for rendering antibodies and target proteins having different biological functions non- or at least less immunogenic. Examples are: WO 92/10755 and WO 96/40792 (Novo Nordisk), EP
596 (Merck & Co.), EP 0699 755(Centro de Immunologia Moelcular), WO 98/52976 and WO
98/59244 and WO 00/34317 (Biovation Ltd.).
The general methods disclosed in the prior art and regarding the elimination of T-cell epitopes from proteins (e.g. WO 98/52976, WO 00/34317) comprise the following steps:
(a) Determining the amino acid sequence of the polypeptide or part thereof (b) Identifying one or more potential T-cell epitopes within the amino acid sequence of the protein by any method including determination of the binding of the peptides to MHC
molecules using in vitro or in silico techniques or biological assays.
(c) Designing new sequence variants with one or more amino acids within the identified potential T-cell epitopes modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope as determined by the binding of the peptides to MHC
molecules using in vitro or in silico techniques or biological assays. Such sequence variants are created in such a way to avoid creation of new potential T-cell epitopes by the sequence variations unless such new potential T-cell epitopes are, in turn, modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope.
(d) Constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties.
l0 Other techniques exploiting soluble complexes of recombinant MHC molecules in combination with synthetic peptides and able to bind to T-cell clones from peripheral blood samples from human or experimental animal subjects have been used in the art [Kern, F. et al (1998) Nature Medicine 4:975-978; Kwok, W.W. et al (2001) TRENDS in Immunology 22:
15 583-588] and may also be exploited in an epitope identification strategy.
The potential T-cell epitopes are generally defined as any amino acid residue sequence with the ability to bind to MHC Class II molecules. Such potential T-cell epitopes can be measured to establish MHC binding. In the general understanding the term "T-cell epitope" is an epitope 20 which when bound to MHC molecules can be recognized by the T-cell receptor, and which can, at least in principle, cause the activation of these T-cells. It is, however, usually understood that certain peptides which are found to bind to MHC Class II
molecules may be retained in a protein sequence because such peptides are tolerated by the immune within the organism into which the final protein is administered.
The invention is conceived to overcome the practical reality that soluble proteins introduced into an autologous host with therapeutic intent, can trigger an immune response resulting in development of host antibodies that bind to the soluble protein. One example amongst others is interferon alpha 2 to which a proportion of human patients make antibodies despite the fact that this protein is produced endogenously [Russo, D. et al (1996) Brit. J.
Haem. 94: 300-305;
Stein, R. et al (1988) New Engl. J. Med. 318: 1409-1413]
MHC Class II molecules are a group of highly polymorphic proteins which play a central role in helper T-cell selection and activation. The human leukocyte antigen group DR (HLA-DR) are the predominant isotype of this group of proteins and the major focus of the present invention. However, isotypes HLA-DQ and HLA-DP perform similar functions, hence the present invention is equally applicable to these. MHC HLA-DR molecules are homo-dimers where each "half ' is a hetero-dimer consisting of a and Li chains. Each hetero-dimer possesses a ligand binding domain which binds to peptides varying between 9 and 20 amino acids in length, although the binding groove can accommodate a maximum of 9 - 11 amino acids. The ligand binding domain is comprised of amino acids 1 to 85 of the oc chain, and amino acids 1 to to 94 of the f3 chain. DQ molecules have recently been shown to have an homologous structure and the DP family proteins are also expected to be very similar. In humans approximately 70 different allotypes of the DR isotype are known, for DQ there are 30 different allotypes and for DP 47 different allotypes are known. Each individual bears two to four DR
alleles, two DQ and two DP alleles. The structure of a number of DR molecules has been solved and such structures point to an open-ended peptide binding groove with a number of hydrophobic pockets which engage hydrophobic residues (pocket residues) of the peptide [Brown et al Nature (1993) 364: 33; Stern et al (1994) Nature 368: 215]. Polymorphism identifying the different allotypes of class II molecule contributes to a wide diversity of different binding surfaces for peptides within the peptide binding grove and at the population level ensures maximal flexibility with regard to the ability to recognize foreign proteins and mount an immune response to pathogenic organisms.
There is a considerable amount of polymorphism within the ligand binding domain with distinct "families" within different geographical populations and ethnic groups. This polymorphism affects the binding characteristics of the peptide binding domain, thus different "families" of DR molecules will have specificities for peptides with different sequence properties, although there may be some overlap. This specificity determines recognition of Th-cell epitopes (Class II T-cell response) which are ultimately responsible for driving the antibody response to B-cell epitopes present on the same protein from which the Th-cell epitope is derived. Thus, the immune response to a protein in an individual is heavily 3o influenced by T-cell epitope recognition which is a function of the peptide binding specificity of that individual's HLA-DR allotype. Therefore, in order to identify T-cell epitopes within a protein or peptide in the context of a global population, it is desirable to consider the binding _ g _ properties of as diverse a set of HLA-DR allotypes as possible, thus covering as high a percentage of the world population as possible.
A principal factor in the induction of an immune response is the presence within the protein of peptides that can stimulate the activity of T-cell via presentation on MHC
class II molecules.
In order to eliminate or reduce immunogenicity, it is thus desirable to identify and remove T-cell epitopes from the protein.
According to the above-cited methods and related processes several biological molecules, basically usual target proteins and antibodies have been prepared which reveal reduced immunogenicity and allergenicity. Examples are: WO 99/55369 (SKB), WO 99/40198 and to WO 96/21016 (Leuven Research & Development VZW), WO 00/08196 (Duke University), WO 96/21036 (Chiron Viragen), WO 97/31025 (Chiron Corp.), WO 98/30706 (Alliance Pharmaceutical Corp.).
In all these applications cited above single proteins or antibodies eliciting a lower immune response were disclosed; there is no hint that fusion proteins, above all immunoglobulin fusion proteins were completely or partially de-immunized, especially by reducing the number of T-cell epitopes within the sequence of said molecules by means of partially computational methods. In WO 97/24137 (Tannox Biosystems Inc.) a IFNa-Fc chimer is disclosed which contains a non-immunogenic linker molecule between the N-terminus of the Fc portion and the C-terminus of IFNa.
Therefore, it is still a need to provide for biological molecules, such as immunoconjugates, which are not or less immunogenic. Above all, it is of specific interest to provide for Fc-conjugates, preferably Fc-X chimers, wherein X is a selected protein or polypeptide of therapeutic interest.
SUMMARY OF THE INVENTION
The present invention relates to four general aspects:
(a) a novel application of the details of the immune response mechanism to situations involving fusion proteins and other artificial proteins, to help determine when an engineered or novel protein is likely to be immunogenic and therefore when application of a deimmunization methodology is appropriate, (b) novel biologically active artificial proteins to be administered especially to humans and in particular for therapeutic use, (c) a method of designing improved, less immunogenic artificial proteins that normally have enhanced immunogenicity, the method comprising identification of one or more candidate T-cell epitopes in the artificial protein and introducing a mutation that removes one or more T-cell epitopes, and (d) a convenient and effective computational method for the identification and calculation of T-cell epitopes for a globally diverse number of MHC Class II molecules and, based on this knowledge, for designing and constructing new sequence variants of biological molecules with improved properties. Once T-cell epitopes have been identified in an artificial protein, they are removed by mutation as described in (c).
1o Artificial proteins that have a component capable of binding to a surface receptor on a cell of the immune system are, in general, particularly immunogenic. Artificial proteins that are immunogenic as a consequence of having a moiety that binds to an immune cell surface receptor are particularly good candidates for the methods of the invention for reducing immunogenicity.
Without wishing to be bound by theory, Figures 1-6 present diagrams of artificial proteins containing moieties that bind to immune cell surface receptors such as an Fc receptor, a cytokine receptor, or an oligosaccharide receptor.
One method of the invention consists of the steps of identifying artificial proteins that contain 2o moieties that bind to an immune cell surface receptor, which may be done by sequence inspection, identifying candidate T-cell epitopes in the artificial protein, designing mutant derivatives of the artificial protein in which the number of T-cell epitopes is reduced, producing one or more mutant derivatives, testing the mutant derivatives for activity and optionally other desired properties, and choosing a mutant derivative that has an optimal balance of reduced T-cell epitopes, retained activity, and optionally other retained desired properties. Other desired properties may include, but are not limited to, pharmacokinetic properties and protein expression and assembly characteristics.
Artificial proteins that tend to form aggregates are a second category of proteins that can be improved by the methods of the invention.
3o One class of artificial proteins that can particularly be improved by the invention are Ig fusion proteins, such as fusion proteins comprising an entire antibody, as well as Fc-X and X-Fc fusion proteins. In particular, immunoglobulin fusion proteins comprising a functional Fc receptor binding site can be particularly improved by methods of the invention.
The invention provides improved forms of such antibody fusion proteins, which include fusion proteins comprising V regions that recognize tumor-specific antigens, other tissue-specific antigens, or other disease-specific antigens. In one preferred embodiment, each of these antibodies is fused to a cytokine, such as IL-2.
For example, the invention provides fusion proteins comprising the tumor-directed anti-EpCAM antibody KS 1/4 and anti-GD2 antibody 14.18, in which the V regions of the antibody contain mutations that remove T-cell epitopes.
In a distinct embodiment, the moiety that is fused to the antibody moiety is mutated such that T-cell epitopes are removed. For example, the invention discloses an antibody-IL-2 fusion to protein in which the IL-2 moiety has been altered to remove T-cell epitopes.
A second general class of Ig fusion proteins that can be significantly improved are the Fc-X
and X-Fc fusion proteins. Without wishing to be bound by theory, it is thought that these proteins are particularly immunogenic because the Fc receptor binding site, which is normally ~5 somewhat sterically blocked by the light chain in an intact antibody, is exposed. In any case, it has been empirically established that an Fc fusion protein can be more immunogenic than the fusion partner by itself (W001/07081).
Another class of immunogenic fusion proteins are proteins that are fused to a cytokine.
20 Without wishing to be bound by theory, it may be that these proteins are particularly immunogenic because when the fusion partner protein binds to an immune cell, for example a cell bearing an antibody that recognizes the fusion partner protein, the cytokine stimulates the cell in some way (see Figure 4).
25 A class of artificial proteins that are particularly immunogenic are normal proteins that contain an inappropriate oligosaccharide. For example, a protein containing an oligosaccharide that is bound by a specific receptor on an immune cell is often found to be immunogenic. For example, a protein, preferably a protein such as beta-glucocerebrosidase that can be used to treat a lysosomal storage disorder, contains a high mannose oligosaccharide.
Such an 30 immunogenic protein shows significantly reduced immunogenicity when modified according to the invention.
The invention provides less immunogenic forms of the following protein moieties that are incorporated into otherwise immunogenic fusion proteins such as:
erythropoietin, leptin, keratinocyte growth factor, G-CSF GM-CSF, IL-1R antagonist, sTNFR, TNF
inhibitor, sTNFR-Fc (Enbrel~), BNTF, CNTF, members of the interferon family, hGH, a-glucocerebrosidase. All these biologically active protein moieties listed above derive from well known non-modified (parent) protein moieties according to the invention.
The modified proteins according to the invention may be produced by the method indicated in Section "Detailed Description of the Invention". The method includes a novel method for identification T-cell epitopes by computational means. This method step is preferred according to the invention and described in more detail in EXAMPLE 1.
The invention discloses and claims as preferred embodiments of the invention altered or modified fusion proteins derived from parent fusion proteins, said parent fusion protein essentially consisting of an immunoglobulin molecule or a fragment thereof and a non-immunoglobulin target polypeptide (X), which is linked preferably by its N-terminal to the C-terminal of the immunoglobulin molecule or a fragment thereof, wherein the altered fusion protein has an amino acid sequence different from that of said parent fusion protein and exhibits reduced immunogenicity relative to the parent fusion protein when exposed to the immune system of a given species, that is preferably human.
The strategies that are used in practice according to the invention to reduce the immunogenicity of an immunogenic fusion protein are illustrated in detail for the antibody-cytokine fusions. These general strategies include:
~ Examining the amino acid sequences in the fusion protein and prioritizing them with respect to likely immunogenicity, based on the expected presence and abundance of the sequences during negative selection of T-cells in the thymus. For example, completely non-self epitopes are identified, and are the highest priority for removal of T-cell epitopes by mutation. The lowest priority for removal of T-cell epitopes are sequences that are present in abundant serum proteins, such as antibody constant regions or sequences that are found in un-rearranged antibody V regions. An intermediate priority for removal of T-cell epitopes by mutation are self sequences that are found in low abundance proteins, such as cytokines. Without wishing to be bound by theory, it is expected that low abundance proteins may not be present in the thymus in high enough amounts to promote negative T-cell selection, and may thus be recognized as non-self T-cell epitopes.
When a region is chosen for removal of T-cell epitopes by mutation, it is compared with naturally occurring human sequences found in abundant proteins. Mutations are introduced to make any non-self sequences more similar to self sequences. For example, to reduce the immunogenicity of a mouse V region, the sequence is compared to un-rearranged human V regions and the most closely related sequence is found.
"Veneering"
changes are introduced, in which some amino acids are converted from mouse to human.
This has the effect of converting some non-self T-cell epitopes into self T-cell epitopes, a method for reducing immunogenicity disclosed by US 5712120, and also has the effect of removing some B cell epitopes. However, it is still necessary to remove T-cell epitopes that derive from hypervariable region sequences.
~ To remove most or all of the remaining T-cell epitopes, mutations are introduced that, by the computer-based criteria defined above, prevent binding of a peptide into a groove of an MHC Class II molecule. In the case of antibody V regions, it is preferable to introduce mutations that lie outside the CDRs themselves, to avoid interfering with antigen binding.
~ In the case of fusion proteins of any type, it is generally the case that the fusion junction will contain non-self T-cell epitopes. These T-cell epitopes may be also removed by mutation.
As a specific embodiment the invention includes chimeric immunoglobulins or fragments thereof wherein the reduced immunogenicity, the reduced number of T-cell epitopes or the reduced number of peptides binding to MHC class II molecules is located to the target polypeptide portion X as well as to the immunoglobulin portion or fragments thereof of the altered fusion protein.
The invention includes also chimeric immunoglobulins as defined according to the invention wherein the immunoglobulin molecule and the non-immunoglobulin target polypeptide (X) are fused via a linker molecule (L). As a specific embodiment of the invention this linker molecule itself has no or lower immunogenicity. Thus, the invention may include immunoconjugates, wherein the linker molecule alone is de-immunized . Linker molecules which have reduced or no immunogenicity are known in the art or can be prepared by known methods or by the method according to the invention. The invention also includes such immunoglobulin fusion proteins, wherein the immunoglobulin portion as well as the target protein (X) portion of the fusion molecule and optionally the linker molecule and the junction region (see below) are immunogenicly modified. Alternatively, only one or more but not all portions of the molecule are modified according to the invention.
The invention relates, furthermore, to above-said immunoconjugates which may derive, in principal, from all immunoglobulin classes; however IgG is preferred. It is an object of the invention to provide such chimeric immunoglobulins which derive from IgGI, IgG2, IgG3 and IgG4. IgGI and IgG2 immunoglobulins are preferred; IgG2 immunoglobulins are most preferred.
Since it has been shown that even recombinant proteins of human origin and humanized antibodies may elicit an undesirable immune response in humans it is object of this invention to provide fusion proteins wherein the immunoglobulin portion as well as the target polypeptide portion (X) may be selected from non-human as well as from human origin.
Since humanized or human-derived molecules have, as a rule, a less number of T-cell epitopes, such molecules are preferred for de-immunization, because a less number of amino acid residues has to be modified.
Immunoconjugates (irnmunoglobulin (Ig) fusion proteins) according to the invention include also fragments of antibodies like sFv, Fab, Fab', F(ab')2 and Fc. It is a specific and preferred object of the invention to provide said above- and below-defined fusion proteins, wherein the immunoglobulin portion is a Fc domain of an antibody, preferably an IgGI or IgG2 antibody.
Fc-X molecules according to the invention which have reduced affinity to Fc receptors are a preferred object of the invention. Fc molecules having a reduced affinity to Fc receptors are well known in the art and can be prepared by modifying the amino acid sequence of the Fc domain (e.g. WO 99/43713).
In detail, the invention refers to:
an immunogenicly modified fusion protein derived from a parent fusion protein, essentially consisting of a first protein / polypeptide and a second protein /
polypeptide, wherein the first protein is an immunoglobulin molecule or a fragment thereof and the second protein / polypetide is non-immunoglobulin target polypeptide (X) each linked to the other directly or by a linker molecule; said modified fusion protein having an amino acid sequence different from that of said parent fusion protein and exhibiting reduced immunogenicity by a reduced number of T-cell epitopes within its amino acid sequence relative to the parent fusion protein when exposed to the immune system of a given species;
~ a corresponding fusion protein, wherein said T-cell epitopes are peptide sequences able to bind to MCH class II molecule binding groups;
~ a corresponding fusion protein, wherein the target polypeptide (X) is linked by its N-terminal to the C-terminal of the immunoglobulin moiety;.
~ a correspondingly modified fusion protein, wherein the given species is a human;
~ a corresponding fusion protein, wherein the fusion components are fused via a linker molecule L;
~ a modified fusion protein according to claim 4, wherein said linker molecule L is non-immunogenic or less immunogenic;
~ a corresponding fusion protein, wherein the junction region represented by the C-terminal region of the immunoglobulin portion and the N-terminal region of the non-immunoglobulin target polypeptide (X) has no or a reduced number of T-cell epitopes;
~ a corresponding fusion protein, wherein the immunoglobulin portion or a fragment thereof or the target polypeptide (X) portion is less immunogenic;
~ a corresponding fusion protein, wherein said immunoglobulin molecule or fragment thereof is IgGI or IgG2;
~ a corresponding fusion protein, wherein said immunoglobulin fragment is a Fc portion, wherein, preferably, said Fc portion has a reduced affinity to Fc receptors;
~ an immunogenicly modified fusion protein according having the formula Fc- L"-X
wherein Fc is the Fc portion of an immunoglobulin molecule (antibody), X is a non-immunoglobulin target polypeptide L is a linker peptide, n = Oorl,and 3o wherein X and / or L comprises amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule.
Preferred embodiments of these immunogenicly modified Fc fusion molecules are:
Fc - X"' , wherein X is modified only, Fc - Lm - Xm , wherein X and L are modified to have a reduced immunogenicity, Fc - X'" , wherein X and the junction region between Fc and X are modified, Fc - L'" - X"' , wherein X and L and the junction regions between Fc , X and L
are modified;
~ a corresponding Fc - (L) - X fusion protein wherein at least X is immunogenicly modified;
~ an immunogenicly modified fusion protein having the formula A- L,"- X
wherein to A is a whole antibody or its sFv, Fab, Fab', F(ab')Z fragments X is a non-immunoglobulin target polypeptide L is a linker peptide, n = 0 or 1, and wherein A and / or X and / or L comprise amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule;
Preferred embodiments of these immunogenicly modified fusion molecules are:
A - Xm , wherein X is modified only, optionally the A-X junction region, A'" - Xm , wherein A and X are modified, optionally their junction region, A - Lm - X'" , wherein X and L are modified only to have a reduced immunogenicity, Am - X , wherein A has reduced immunogenicity only, optionally the A-X
junction region, Am - Lm - X"', wherein A, L and X are immunogenicly modified, optionally the A-L-X
function regions;
~ a corresponding A - (L) - X fusion molecule, wherein at least X or A is immunogenicly modified;
~ a correponding fusion protein, wherein A is selected from the group:
anti- EGF receptor (HER1) antibodies anti- HER2 antibodies anti- CDx antibodies, wherein x is an integer from 1 - 25 anti- cytokine receptor antibodies anti- 17-lA antibodies, anti- KSA antibodies anti-GP IIb/IIIa antibodies anti-integrin receptor antibodies anti VEGF receptor antibodies;
~ a correpondingly fusion protein, wherein the antibody is selected from the group:
monoclonal antibody 225 and derivatives, monoclonal antibody 425 and derivatives monoclonal antibody KS 1/4 and derivatives monoclonal antibody 14.18 and derivatives monoclonal antibody 4D5 / HER2 (Herceptin~) and derivatives monoclonal antibody 17-lA and derivatives to monoclonal anti-CD3 antibodies monoclonal antibody 7E3 and derivatives monoclonal antibodies LM609, P1F6 and 14D9.F8 and derivatives monoclonal antibody DC-101 and derivatives monoclonal anti-Il-2R antibody (Zenapax~) and derivatives t5 ~ a corresponding fusion protein, wherein the target polypeptide X is selected from the group:
cytokines, integrin inhibitors, soluble cytokine receptors, glycoproteins, hormones, glycoprotein hormones, leptin, growth hormones, growth factors, antihemophilic factors, antigens, cytokine receptor antagonists;
20 ~ a corresponding fusion protein, wherein the target polypeptide X is selected from the group:
IL-2, G-CSF, GM-CSF, EPO, TPO, members of the interferon family, TNFa, soluble TNF receptor, IL-12, IL-8, factor VIII, FGF, TGF, EGF, VEGF, PMSA, IGF, insulin, RGD-peptides, endostatin, angiostatin, BDNF, CNTF, protein c, factor VIII and IX, and 25 and biologically active fragments thereof;
~ a more specidied corresponding fusion protein selected from the group:
MAb KS 1/4 - IL2, MAb 14.18 - IL2 MAb 425 - IL2, MAb c425 - IL2, MAb h425 - IL2, MAb 425 - TNFa MAb 225 - IL2, MAb c225 - IL2 30 MAb 4D5 - IL2, MAb DC 101- I12, MAb LM609 - IL2, Fc - IL2 , Fc - TNFa, Fc - G-CSF, Fc - EPO, Fc - Leptin, Fc - KGF, Fc - BFNF, FC - (3-Cerebrosidase, Fc - TPO, Fc - GM-CSF;
~ an immunogenicly modified artificial protein selected from the group:
(i) Y - (L) - X, wherein Y is a cytokine and X, (L) is a molecule as defined above, (ii) P - (L) - X, wherein P is a protein with unusual glycosylation moieties and X, (L) is a molecule as defined above, (iii) A - (L) - X, wherein A, X (L) is a molecule as defined above, derived from a parent artificial protein having an amino acid sequence which is different from that of said parent artificial protein and exhibits reduced immunogenicity by a reduced number of T-cell epitopes relative to~the parent fusion protein when exposed to the immune system of a given species, wherein said T-cell epitopes are peptide sequences able to bind to MCH class II molecule binding groups obtainable or obtained by a method as specified in this invention;
~ a DNA sequence encoding any fusion protein as specified above and below;
~ a DNA sequence encoding a corresponding fusion protein, comprising (i) a signal sequence (ii) a DNA sequence encoding all domains or a Fc, sFV, Fab, Fab' or F(ab')2 domain of an IgGI, IgG2 or IgG3 antibody, and (ii) a DNA sequence encoding the polypeptide (X), and optionally (iii) a DNA sequence encoding the linker molecule;
~ an expression vector comprising a corresponding DNA sequence;
~ a pharmaceutical composition comprising a fusion protein as specified above and below, optionally together with a suitable carrier, excipient or diluent or another therapeutically effective drug, such as chemotherapeutics or cytotoxic drugs;
~ a method for preparing an immunogenicly modified fusion protein as specified comprising the steps:
(i) determining the amino acid sequence of the parent fusion protein or part thereof;
(ii) identifying one or more potential T-cell epitopes within the amino acid sequence of the fusion protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays, (iii) designing new sequence variants by alteration of at least one amino acid residue within the originally identified T-cell epitope sequences, said variants are modified in such a way to substantially reduce or eliminate the activity or number of the T-cell epitope sequences and / or the number of MHC allotypes able to bind peptides derived from said biological molecule as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays or by binding of peptide-MHC
complexes to T-cells, (iv) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties, and (v) optionally repeating steps (ii) - (iv), characterized in that the identification of T-cell epitope sequences according to step (ii) is achieved by (a) selecting a region of the peptide having a known amino acid residue sequence;
(b) sequentially sampling overlapping amino acid residue segments of predetermined uniform size and constituted by at least three amino acid residues from the selected region; (c) calculating MHC Class II molecule binding score for each said sampled segment by summing assigned values for each hydrophobic amino acid residue side chain present in said sampled amino acid residue segment; and (d) identifying at least one of said segments suitable for modification, based on the calculated MHC Class II
molecule binding score for that segment, to change overall MHC Class II binding score for the peptide without substantially the reducing therapeutic utility of the peptide;
t5 ~ a corresponding method, wherein step (c) is carried out by using a Bohm scoring function modified to include 12-6 van der Waal's ligand-protein energy repulsive term and ligand conformational energy term by (1) providing a first data base of MHC Class II
molecule models; (2) providing a second data base of allowed peptide backbones for said MHC
Class II molecule models; (3) selecting a model from said first data base; (4) selecting an allowed peptide backbone from said second data base; (5) identifying amino acid residue side chains present in each sampled segment; (6) determining the binding affinity value for all side chains present in each sampled segment; and optionally (7) repeating steps (1) through (5) for each said model and each said backbone;
~ a corresponding method, wherein the sampled amino acid residue segment is constituted by 13 amino acid residues and / or consecutive sampled amino acid residue segments overlap by one to five amino acid residues;
~ a corresponding method, wherein 1 - 9 amino acid residues, preferably one amino acid residue, in any of the originally present T-cell epitope sequences (is) are altered;
~ a corresponding method, wherein the alteration of the amino acid residues is substitution, deletion or addition of originally present amino acids) residues) by other amino acid residues) at specific position(s);
~ a corresponding method, wherein additionally further alteration by substitution, deletion or addition is conducted to restore biological activity of said biological molecule.
The polypeptides according to the invention include also antigens, like PMSA
and others.
Antigens which elicit a not desired and too strong immune response can be modified according to the method of the invention and result in antigens which have a reduced immunogenicity which is however strong enough for using the antigen e.g. as vaccine.
The invention includes also variants and other modification of a specific polypeptide, protein, fusion protein, immunoglobulin or immunoconjugate which have in principal the same biological activity and a similar (reduced) immunogenicity. All proteins mentioned above are well known and described in the art or are already commercially available.
Most of them are to known to have a proved therapeutic benefit. The leader or signal sequences and linker sequences may be optional.
Preparing the fusion protein by linking the immunoglobulin component by its C-terminus or its fragment to the N-terminus of the non-immunoglobulin target polypeptide (X), optionally via the linker molecule according to step (ii) as described above, is carned out by:
(i) preparing a gene construct comprising a DNA sequence encoding the polypeptide X, a DNA sequence encoding the immunoglobulin molecule or fragments thereof [sFv, Fab, Fab', F(ab')Z, Fc], and optionally the DNA sequence of a the linker molecule, and (ii) expressing the gene construct by an expression system.
2o The immunoconjugates according to the present invention reveal enhanced properties. Thus decreased protein degradation, increased stability and enhanced serum circulation half-life can be measured as well as a distinctly reduced immunogenicity and / or allergenicity.
Surprisingly, the reduced immunogenicity leads in many cases to a further increase of half-life, especially in cases where Fc-X molecules according to the invention are used. The reduced immunogenicity makes the fusion proteins according to the invention more tolerable for a given species compared to the non-modified fusion proteins and, therefore, can be administered in higher dosages if necessary.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 illustrates one of the mechanisms by which fusion proteins displays enhanced immunogenicity. Figure la shows a protein ("X") fused to an Fc moiety binding to a cell bearing an Fc receptor. Figure 1b shows the fusion protein being processed such that the "X"
moiety is preferentially degraded. Figure lc shows a peptide remnant of "X"
being presented by an MHC molecule to a T-cell.
Fi ure 2 shows a mechanism of enhanced immunogenicity for a fusion protein comprising an Fc moiety and a second moiety. Figure 2a shows the binding of the fusion protein to a B cell that expresses an antibody specific for "X" on its surface. The fusion protein is bound by both the specific antibody and by Fc receptors that are not already bound by the antibody.
Fi ure 3 illustrates a second mechanism by which fusion proteins displays enhanced immunogenicity. Figure la shows a protein ("X") fused to an cytokine moiety binding to a B
1o cell with a surface-bound antibody. Figure 3b shows the fusion protein being processed.
Figure 3c shows a peptide remnant of "X" being presented by an MHC molecule to a T-cell, at the same time that additional X-cytokine fusion protein is bound to the surface of the B cell.
Figure 4 illustrates another mechanism by which an engineered protein displays enhanced immunogenicity. In this case, a cytokine-X fusion protein directly activates a B cell.
The B cell synthesizes a specific antibody to X, which increases the local concentration of the cytokine in the neighborhood of the B cell.
Fi.~ure 5 ~' illustrates another mechanism by which an engineered protein displays enhanced immunogenicity. Figure Sa shows the binding of a protein bearing a glycosylation moiety to a specific cell-surface receptor for that glycosylation moiety on an immune cell.
2o Figure Sb shows the uptake and degradation of the glycosylated protein.
Figure Sc shows the presentation of a peptide remnant of the glycosylated protein to a T-cell via an MHC
molecule.
Fygure 6 shows a mechanism by which an antibody-cytokine fusion protein displays enhanced immunogenicity. Figure 6a shows the binding of the antibody-cytokine fusion protein to a B cell that expresses an antibody specific for the CDRs of the antibody-cytokine fusion protein. The fusion protein is bound by both the specific antibody and by Fc receptors that are not already bound by the antibody. Figure 6b shows the fusion protein being processed. Figure 6c shows a peptide remnant of the CDRs being presented by an MHC
molecule to a T-cell, at the same time that additional antibody-cytokine fusion protein is 3o bound to the surface of the B cell.
DETAILED DESCRIPTION OF THE INVENTION
The term "T-cell epitope" means according to the understanding of this invention an amino acid sequence which is able to bind with reasonable efficiency MHC class II
molecules (or their equivalent in a non-human species), able to stimulate T-cells and / or also to bind (without necessarily measurably activating) T-cells in complex with MHC class II.
The term "peptide" as used herein and in the appended claims, is a compound that includes two or more amino acids. The amino acids are linked together by a peptide bond (defined herein below). There are 20 different naturally occurnng amino acids involved in the biological production of peptides, and any number of them may be linked in any order to form a peptide chain or ring. The naturally occurring amino acids employed in the biological production of peptides all have the L-configuration. Synthetic peptides can be prepared employing conventional synthetic methods, utilizing L-amino acids, D-amino acids, or various combinations of amino acids of the two different configurations. Some peptides contain only a few amino acid units. Short peptides, e.g., having less than ten amino acid units, are sometimes referred to as "oligopeptides". Other peptides contain a large number of amino acid residues, e.g. up to 100 or more, and are referred to as "polypeptides".
By convention, a "polypeptide" may be considered as any peptide chain containing three or more amino acids, whereas a "oligopeptide" is usually considered as a particular type of "short"
polypeptide.
Thus, as used herein, it is understood that any reference to a "polypeptide"
also includes an oligopeptide. Further, any reference to a "peptide" includes polypeptides, oligopeptides, and proteins. Each different arrangement of amino acids forms different polypeptides or proteins.
The number of polypeptides-and hence the number of different proteins-that can be formed is practically unlimited.
The term "less or reduced immunogenic(ity)" used before and thereafter is a relative term and relates to the immunogenicity of the respective original source molecule when exposed in vivo to the same type of species compared with the molecule modified according to the invention.
The term "modified protein" as used according to this invention describes a protein which has reduced number of T-cell epitopes and elicits therefore a reduced immunogenicity relative to the parent protein when exposed to the immune system of a given species.
The term "non-modified protein" as used according to this invention describes the "parent"
protein as compared to the "modified protein" and has a larger number of T-cell epitopes and, therefore, an enhanced immunogenicity relative to the modified protein when exposed to the immune system of a given species.
The term "biologically active protein" as used here and in the claims includes according to the invention polypetides, proteins, immunoglobulins such as antibodies, antibody fragments, fusion proteins, enzymes, antigens and so on, if not defined otherwise, which elicit a biological and / or therapeutic effect.
The term "cytokine" is used herein to describe proteins, analogs thereof, and fragments thereof which are produced and excreted by a cell, and which elicit a specific response in a cell which has a receptor for that cytokine. Preferably, cytokines include interleukins such as interleukin-2 (IL-2), hematopoietic factors such as granulocyte-macrophage colony stimulating factor (GM-CSF), tumor necrosis factor (TNF) such as TNFa, and lymphokines such as lymphotoxin. Preferably, the antibody-cytokine fusion protein of the present invention displays cytokine biological activity. In principal, the inventions encompasses all cytokines as recently classified according to their receptor code (Inglot, 1997, Archivum Immunologiae et Therapiae Experimentalis, 45: 353).
The phrase "single chain Fv" or "scFv" refers to an antibody in which the heavy chain and the light chain of a traditional two chain antibody have been joined to form one chain. Typically, a linker peptide is inserted between the two chains to allow for proper folding and creation of an active binding site.
The term "Fc region" or "Fc domain" as used in this invention is understood to mean the carboxyl terminal portion of an immunoglobulin heavy chain constant region, or an analog or portion thereof capable of binding an Fc receptor. As is known, each immunoglobulin heavy chain constant region comprises four or five domains. The domains are named sequentially as follows: CH1 -hinge-CH2-CH3(-CH4). CH4 is present in IgM, which has no hinge region. The immunoglobulin heavy chain constant region useful in the practice of the invention preferably comprises an immunoglobulin hinge region, and preferably also includes a CH3 domain. The immunoglobulin heavy chain constant region most preferably comprises an immunoglobulin hinge region, a CH2 domain and a CH3 domain. The preferred Fc domain according to this invention consists thus of the hinge-CH2-CH3 domain.
As used herein, the term immunoglobulin "hinge region" is understood to mean an entire immunoglobulin hinge region or at least a portion of the immunoglobulin hinge region sufficient to form one or more disulfide bonds with a second immunoglobulin hinge region.
As used herein, the term "signal sequence" is understood to mean a segment which directs the secretion of the fusion protein and thereafter is cleaved following translation in the host cell.
The signal sequence of the invention is a polynucleotide which encodes an amino acid sequence which initiates transport of a protein across the membrane of the endoplasmic reticulum. Signal sequences which are useful in the invention include antibody light chain signal sequences, e.g., antibody 14.18 (Gillies et. al. (1989) J. Immunol.
Meth. 125 : 191), and any other signal sequences which are known in the art (see, e.g., Watson, 1984, Nucleic Acid Research 12:5145).
The term "mutant or variant" used with respect to a particular protein encompasses any molecule such as a truncated or other derivative of the relevant protein which retains substantially the same activity in humans as the relevant protein. Such other derivatives can be prepared by the addition, deletion, substitution, or rearrangement of amino acids or by to chemical modifications thereof.
It is contemplated that suitable immunoglobulin heavy chain constant regions may be derived from antibodies belonging to each of the immunoglobulin classes referred to as IgA, IgD, IgE, IgG, and IgM, however, immunoglobulin heavy chain constant regions from the IgG class are preferred.
Furthermore, it is contemplated that immunoglobulin heavy chain constant regions may be derived from any of the IgG antibody subclasses referred to in the art as IgGl, IgG2, IgG3, and IgG4. Immunoglobulin heavy chain constant region domains have cross-homology among the immunoglobulin classes. For example, the CH2 domain of IgG is homologous to 2o the CH2 domain of IgA and IgD, and to the CH3 domain of IgM and IgE. The choice of appropriate immunoglobulin heavy chain constant regions is discussed in detail in US
These chimeric molecules are bi-functional by targeting a specific antigen, for example, on a tumor cell surface by means of the binding sites within the CDRs of the variable domain of the antibody portion or a fragment thereof, and by the simultaneous cytotoxic effect of the cytokine which is coupled to the immunoglobulin and thus can, theoretically, only or predominantly attack the targeted cell. In this context, also tri- and mufti-functional immunoconjugates were developed including constructs consisting of sFv-, Fab-, Fab' or F(ab')2 fragments of different antibodies, wherein in each case the targeting function of the immunoglobulin portion was advantageously used.
Another immunoglobulin modification is the use of the Fc region of antibodies.
Antibodies comprise two functionally independent parts, a variable domain known as "Fab"
, "Fab", "F(ab')2", dependent on the kind of digestion of the molecule, which bind antigen, and a constant domain, known as "Fc" which provides the link to effector functions such as 2o complement or phagocytic cells. The Fc portion of an immunoglobulin has a long plasma half-life, whereas the Fab fragments are short-lived (Capon, et al., Nature 337: 525-531 (1989)).
Therapeutic protein products have been constructed using the Fc domain to provide longer half-life or to incorporate functions such as Fc receptor binding, protein A
binding, complement fixation and placental transfer which all reside in the Fc proteins of immunoglobulins. For example, the Fc region of an IgGI antibody has been fused to the N-terminal end of CD30-L, a molecule which binds CD30 receptors expressed on Hodgkin's Disease tumor cells, anaplastic lymphoma cells, T-cell leukemia cells and other malignant cell types (US 5,480,981).1L-10, an anti-inflammatory and antirejection agent has been fused to murine Fc~y2a in order to increase the cytokine's short circulating half-life (Zheng et al., The Journal of Immunology, 154: 5590-5600 (1995)). Studies have also evaluated the use of tumor necrosis factor receptor linked with the Fc protein of human IgGI to treat patients with septic shock (Fisher et al., N. Engl. J. Med., 334: 1697-1702 (1996); Van Zee et al., The Journal of Immunology, 156: 2221-2230 (1996)). Fc has also been fused with receptor to produce a therapeutic protein for treatment of AIDS (see: Capon et al., Nature, 337:525-531 (1989)). Principally, Fc can be fused to the target protein or peptide via its C- or N-terminus using the N- and C-terminus of the protein, respectively. A chimer of Fc and TNF
and EPO was disclosed in EP 0464 533 (Hoechst/ General Hospital), wherein the N-terminus of Fc was coupled to the C-terminus of the protein (X-Fc). The identical conjunction was selected for leptin-Fc chimers disclosed in WO 97/00319 (SKB) and WO 97/24440 (Genentech). There are a lot of publications and patent applications describing the opposite linkage of Fc-protein chimers (Fc-X), such as Fc-(IL-2), Fc-EPO, Fc-PSMA, Fc-(IL-12), Fc-TNFa, Fc-(GM-CSF), Fc-TNFR, Fc-endostatin, Fc, angiostatin, Fc-gp 120, Fc-leptin, Fc-IFNa, Fc-(G-CSF). Examples are WO 96/08570, (Fuji / Merck KGaA), WO 98/28427 (Amgen), WO 99/02709 (Beth Israel Medical Care Center) and WO 99/58662 (Fuji / Merck KGaA).
WO 00/24782 (Amgen) discloses a huge number of possible Fc-X conjugates, wherein the linkage between the two partners may be Fc-X or X-Fc. An extensive development of Fc-X
molecules was realized by Lexigen / Merck KgaA as disclosed in US 5,541,087, WO
99/43713, WO 99/29732, WO 99/52562, WO 99/53958, WO 00/11033, WO 01/07081, PCT/EP00/10843.Thus, X-Fc and Fc-X molecules which have "lost" their antigen binding sites, as well as molecules, wherein the binding sites and thus their antigen-specific targeting functions are conserved, are of great interest as promising therapeutic proteins and there exists a further need to develop analogue compositions for different clinical application.
Non-natural therapeutic proteins are often particularly immunogenic. For example, Enbrel is a fusion protein consisting of an extracellular domain of a Tumor Necrosis Factor Receptor (TNF-R) fused to an Fc region of an antibody. About 16% of patients treated with Enbrel have been reported to develop antibodies to this fusion protein (Physician's Desk Reference [2001] p. 3372). Similarly, a fusion protein consisting of erythropoietin (Epo) and granulocyte / macrophage-colony stimulating factor (GMCSF) was found to be highly immunogenic (Coscarella A, et al. [1998) Cytokine 10:964-9; Coscarella A, Mol Biotechnol.
[1998] 10:115-22). When injected into a primate, Epo-GMCSF fusion proteins were found to induce a strong antibody response to the Epo moiety of the fusion protein, resulting in anemia.
CeredaseTM and CerezymeTM are forms of the lysosomal enzyme glucocerebrosidase used to treat Gaucher's disease; as a result of genetic engineering, glucocerebrosidase is attached to an unusual high-mannose glycosylation. Patients with Gaucher's disease lack glucocerebrosidase in their lysosomes, and as a result the patients' macrophages tend to accumulate lipids and become foam cells (The Metabolic and Molecaclar Bases of Inherited Disease, 8'" Edition [2001] Scriver et al. eds. Chapter 146, "Gaucher Disease." p. 3635-3668).
After administration of CeredaseTM or CerezymeTM, the therapeutic protein is bound by mannose receptors on macrophages, endocytosed, and trafficked through the endosomes to the lysosome, which is its proper location. Patients treated with Ceredase often develop antibodies to glucocerebrosidase (Pastores GM, et al., Blood [1993] 82:408-16;
Physicians' Desk Reference [2001] p. 1325-1326). Such antibodies can interfere with treatment (Brady RO, et al., Pediatrics. [1997] 100(6):E1 l.). In a Phase I clinical trial using an antibody-cytokine fusion protein, several patients developed antibody responses to the therapeutic fusion protein. In this case, the antibody moiety was a humanized form of the 14.18 antibody, and the cytokine was interleukin-2 (IL-2). Many of the reactive patients' sera included significant levels of anti-idiotype antibodies.
Therapeutic use of a number of peptides, polypeptides and proteins is curtailed because of their immunogenicity in mammals, especially humans. For example, when murine antibodies are administered to patients who are not immunosuppressed, a majority of such patients exhibit an immune reaction to the introduced foreign material by making human anti-murine antibodies (HAMA) (e.g. Schroff, R. W. et al (1985) Cancer Res. 45: 879-885;
Shawler, D.L.
et al (1985) J. Immccnol. 135: 1530-1535). There are two serious consequences.
First, the patient's anti-murine antibody may bind and clear the therapeutic antibody or immunoconjugate before it has a chance to bind, for example to a tumor, and perform its therapeutic function. Second, the patient may develop an allergic sensitivity to the murine antibody and be at risk of anaphylactic shock upon any future exposure to murine immunoglobulin.
Several techniques have been employed to address the HAMA problem and thus enable the use in humans of therapeutic monoclonal antibodies (see, for example, W089/09622, EP0239400, EP0438310, W091/09967). These recombinant DNA approaches have generally reduced the mouse genetic information in the final antibody construct whilst increasing the human genetic information in the final construct. Notwithstanding, the resultant "humanized"
antibodies have, in several cases, still elicited an immune response in patients (Issacs J.D.
( 1990) Sem: Immunol. 2: 449, 456; Rebello, P.R. et al ( 1999) Transplantation 68: 1417-1420).
A common aspect of these methodologies has been the introduction into the therapeutic antibody, usually of rodent origin, of amino acid residues, even significant tracts of amino acid residue sequences, identical to those present in human antibody proteins. For antibodies, this process is possible owing to the relatively high degree of structural (and functional) conservatism among antibody molecules of different species. For potentially therapeutic peptides, polypeptides and proteins, however, where no structural homologue may exist in the host species (e.g., human) for the therapeutic protein, such processes are not applicable.
Furthermore, these methods have assumed that the general introduction of a human amino acid residue sequence will render the re-modeled antibody non-immunogenic. It is known, however, that certain short peptide sequences ("T-cell epitopes") can be released during the degradation of peptides, polypeptides or proteins within cells and subsequently be presented by molecules of the major histocompatability complex (MHC) in order to trigger the activation of T-cells. For peptides presented by MHC Class II, such activation of T-cells can then give rise to an antibody response by direct stimulation of B-cells to produce such antibodies.
Accordingly, it would be desirable to eliminate potential T-cell epitopes from a peptide, polypeptide or a protein. Even proteins of human origin and with the same amino acid sequences as occur within humans can still induce an immune response in humans. Notable examples include therapeutic use of granulocyte-macrophage colony stimulating factor (Wadhwa, M. et al (1999) Clin. Cancer Res. 5: 1353-1361) and interferon alpha 2 (Russo, D.
2o et al (1996) Bri. J. Haem. 94: 300-305; Stein, R. et al (1988) New Ervgl.
J. Med. 318: 1409-1413).
During the last couple of years several techniques were published which suggest solutions for rendering antibodies and target proteins having different biological functions non- or at least less immunogenic. Examples are: WO 92/10755 and WO 96/40792 (Novo Nordisk), EP
596 (Merck & Co.), EP 0699 755(Centro de Immunologia Moelcular), WO 98/52976 and WO
98/59244 and WO 00/34317 (Biovation Ltd.).
The general methods disclosed in the prior art and regarding the elimination of T-cell epitopes from proteins (e.g. WO 98/52976, WO 00/34317) comprise the following steps:
(a) Determining the amino acid sequence of the polypeptide or part thereof (b) Identifying one or more potential T-cell epitopes within the amino acid sequence of the protein by any method including determination of the binding of the peptides to MHC
molecules using in vitro or in silico techniques or biological assays.
(c) Designing new sequence variants with one or more amino acids within the identified potential T-cell epitopes modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope as determined by the binding of the peptides to MHC
molecules using in vitro or in silico techniques or biological assays. Such sequence variants are created in such a way to avoid creation of new potential T-cell epitopes by the sequence variations unless such new potential T-cell epitopes are, in turn, modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope.
(d) Constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties.
l0 Other techniques exploiting soluble complexes of recombinant MHC molecules in combination with synthetic peptides and able to bind to T-cell clones from peripheral blood samples from human or experimental animal subjects have been used in the art [Kern, F. et al (1998) Nature Medicine 4:975-978; Kwok, W.W. et al (2001) TRENDS in Immunology 22:
15 583-588] and may also be exploited in an epitope identification strategy.
The potential T-cell epitopes are generally defined as any amino acid residue sequence with the ability to bind to MHC Class II molecules. Such potential T-cell epitopes can be measured to establish MHC binding. In the general understanding the term "T-cell epitope" is an epitope 20 which when bound to MHC molecules can be recognized by the T-cell receptor, and which can, at least in principle, cause the activation of these T-cells. It is, however, usually understood that certain peptides which are found to bind to MHC Class II
molecules may be retained in a protein sequence because such peptides are tolerated by the immune within the organism into which the final protein is administered.
The invention is conceived to overcome the practical reality that soluble proteins introduced into an autologous host with therapeutic intent, can trigger an immune response resulting in development of host antibodies that bind to the soluble protein. One example amongst others is interferon alpha 2 to which a proportion of human patients make antibodies despite the fact that this protein is produced endogenously [Russo, D. et al (1996) Brit. J.
Haem. 94: 300-305;
Stein, R. et al (1988) New Engl. J. Med. 318: 1409-1413]
MHC Class II molecules are a group of highly polymorphic proteins which play a central role in helper T-cell selection and activation. The human leukocyte antigen group DR (HLA-DR) are the predominant isotype of this group of proteins and the major focus of the present invention. However, isotypes HLA-DQ and HLA-DP perform similar functions, hence the present invention is equally applicable to these. MHC HLA-DR molecules are homo-dimers where each "half ' is a hetero-dimer consisting of a and Li chains. Each hetero-dimer possesses a ligand binding domain which binds to peptides varying between 9 and 20 amino acids in length, although the binding groove can accommodate a maximum of 9 - 11 amino acids. The ligand binding domain is comprised of amino acids 1 to 85 of the oc chain, and amino acids 1 to to 94 of the f3 chain. DQ molecules have recently been shown to have an homologous structure and the DP family proteins are also expected to be very similar. In humans approximately 70 different allotypes of the DR isotype are known, for DQ there are 30 different allotypes and for DP 47 different allotypes are known. Each individual bears two to four DR
alleles, two DQ and two DP alleles. The structure of a number of DR molecules has been solved and such structures point to an open-ended peptide binding groove with a number of hydrophobic pockets which engage hydrophobic residues (pocket residues) of the peptide [Brown et al Nature (1993) 364: 33; Stern et al (1994) Nature 368: 215]. Polymorphism identifying the different allotypes of class II molecule contributes to a wide diversity of different binding surfaces for peptides within the peptide binding grove and at the population level ensures maximal flexibility with regard to the ability to recognize foreign proteins and mount an immune response to pathogenic organisms.
There is a considerable amount of polymorphism within the ligand binding domain with distinct "families" within different geographical populations and ethnic groups. This polymorphism affects the binding characteristics of the peptide binding domain, thus different "families" of DR molecules will have specificities for peptides with different sequence properties, although there may be some overlap. This specificity determines recognition of Th-cell epitopes (Class II T-cell response) which are ultimately responsible for driving the antibody response to B-cell epitopes present on the same protein from which the Th-cell epitope is derived. Thus, the immune response to a protein in an individual is heavily 3o influenced by T-cell epitope recognition which is a function of the peptide binding specificity of that individual's HLA-DR allotype. Therefore, in order to identify T-cell epitopes within a protein or peptide in the context of a global population, it is desirable to consider the binding _ g _ properties of as diverse a set of HLA-DR allotypes as possible, thus covering as high a percentage of the world population as possible.
A principal factor in the induction of an immune response is the presence within the protein of peptides that can stimulate the activity of T-cell via presentation on MHC
class II molecules.
In order to eliminate or reduce immunogenicity, it is thus desirable to identify and remove T-cell epitopes from the protein.
According to the above-cited methods and related processes several biological molecules, basically usual target proteins and antibodies have been prepared which reveal reduced immunogenicity and allergenicity. Examples are: WO 99/55369 (SKB), WO 99/40198 and to WO 96/21016 (Leuven Research & Development VZW), WO 00/08196 (Duke University), WO 96/21036 (Chiron Viragen), WO 97/31025 (Chiron Corp.), WO 98/30706 (Alliance Pharmaceutical Corp.).
In all these applications cited above single proteins or antibodies eliciting a lower immune response were disclosed; there is no hint that fusion proteins, above all immunoglobulin fusion proteins were completely or partially de-immunized, especially by reducing the number of T-cell epitopes within the sequence of said molecules by means of partially computational methods. In WO 97/24137 (Tannox Biosystems Inc.) a IFNa-Fc chimer is disclosed which contains a non-immunogenic linker molecule between the N-terminus of the Fc portion and the C-terminus of IFNa.
Therefore, it is still a need to provide for biological molecules, such as immunoconjugates, which are not or less immunogenic. Above all, it is of specific interest to provide for Fc-conjugates, preferably Fc-X chimers, wherein X is a selected protein or polypeptide of therapeutic interest.
SUMMARY OF THE INVENTION
The present invention relates to four general aspects:
(a) a novel application of the details of the immune response mechanism to situations involving fusion proteins and other artificial proteins, to help determine when an engineered or novel protein is likely to be immunogenic and therefore when application of a deimmunization methodology is appropriate, (b) novel biologically active artificial proteins to be administered especially to humans and in particular for therapeutic use, (c) a method of designing improved, less immunogenic artificial proteins that normally have enhanced immunogenicity, the method comprising identification of one or more candidate T-cell epitopes in the artificial protein and introducing a mutation that removes one or more T-cell epitopes, and (d) a convenient and effective computational method for the identification and calculation of T-cell epitopes for a globally diverse number of MHC Class II molecules and, based on this knowledge, for designing and constructing new sequence variants of biological molecules with improved properties. Once T-cell epitopes have been identified in an artificial protein, they are removed by mutation as described in (c).
1o Artificial proteins that have a component capable of binding to a surface receptor on a cell of the immune system are, in general, particularly immunogenic. Artificial proteins that are immunogenic as a consequence of having a moiety that binds to an immune cell surface receptor are particularly good candidates for the methods of the invention for reducing immunogenicity.
Without wishing to be bound by theory, Figures 1-6 present diagrams of artificial proteins containing moieties that bind to immune cell surface receptors such as an Fc receptor, a cytokine receptor, or an oligosaccharide receptor.
One method of the invention consists of the steps of identifying artificial proteins that contain 2o moieties that bind to an immune cell surface receptor, which may be done by sequence inspection, identifying candidate T-cell epitopes in the artificial protein, designing mutant derivatives of the artificial protein in which the number of T-cell epitopes is reduced, producing one or more mutant derivatives, testing the mutant derivatives for activity and optionally other desired properties, and choosing a mutant derivative that has an optimal balance of reduced T-cell epitopes, retained activity, and optionally other retained desired properties. Other desired properties may include, but are not limited to, pharmacokinetic properties and protein expression and assembly characteristics.
Artificial proteins that tend to form aggregates are a second category of proteins that can be improved by the methods of the invention.
3o One class of artificial proteins that can particularly be improved by the invention are Ig fusion proteins, such as fusion proteins comprising an entire antibody, as well as Fc-X and X-Fc fusion proteins. In particular, immunoglobulin fusion proteins comprising a functional Fc receptor binding site can be particularly improved by methods of the invention.
The invention provides improved forms of such antibody fusion proteins, which include fusion proteins comprising V regions that recognize tumor-specific antigens, other tissue-specific antigens, or other disease-specific antigens. In one preferred embodiment, each of these antibodies is fused to a cytokine, such as IL-2.
For example, the invention provides fusion proteins comprising the tumor-directed anti-EpCAM antibody KS 1/4 and anti-GD2 antibody 14.18, in which the V regions of the antibody contain mutations that remove T-cell epitopes.
In a distinct embodiment, the moiety that is fused to the antibody moiety is mutated such that T-cell epitopes are removed. For example, the invention discloses an antibody-IL-2 fusion to protein in which the IL-2 moiety has been altered to remove T-cell epitopes.
A second general class of Ig fusion proteins that can be significantly improved are the Fc-X
and X-Fc fusion proteins. Without wishing to be bound by theory, it is thought that these proteins are particularly immunogenic because the Fc receptor binding site, which is normally ~5 somewhat sterically blocked by the light chain in an intact antibody, is exposed. In any case, it has been empirically established that an Fc fusion protein can be more immunogenic than the fusion partner by itself (W001/07081).
Another class of immunogenic fusion proteins are proteins that are fused to a cytokine.
20 Without wishing to be bound by theory, it may be that these proteins are particularly immunogenic because when the fusion partner protein binds to an immune cell, for example a cell bearing an antibody that recognizes the fusion partner protein, the cytokine stimulates the cell in some way (see Figure 4).
25 A class of artificial proteins that are particularly immunogenic are normal proteins that contain an inappropriate oligosaccharide. For example, a protein containing an oligosaccharide that is bound by a specific receptor on an immune cell is often found to be immunogenic. For example, a protein, preferably a protein such as beta-glucocerebrosidase that can be used to treat a lysosomal storage disorder, contains a high mannose oligosaccharide.
Such an 30 immunogenic protein shows significantly reduced immunogenicity when modified according to the invention.
The invention provides less immunogenic forms of the following protein moieties that are incorporated into otherwise immunogenic fusion proteins such as:
erythropoietin, leptin, keratinocyte growth factor, G-CSF GM-CSF, IL-1R antagonist, sTNFR, TNF
inhibitor, sTNFR-Fc (Enbrel~), BNTF, CNTF, members of the interferon family, hGH, a-glucocerebrosidase. All these biologically active protein moieties listed above derive from well known non-modified (parent) protein moieties according to the invention.
The modified proteins according to the invention may be produced by the method indicated in Section "Detailed Description of the Invention". The method includes a novel method for identification T-cell epitopes by computational means. This method step is preferred according to the invention and described in more detail in EXAMPLE 1.
The invention discloses and claims as preferred embodiments of the invention altered or modified fusion proteins derived from parent fusion proteins, said parent fusion protein essentially consisting of an immunoglobulin molecule or a fragment thereof and a non-immunoglobulin target polypeptide (X), which is linked preferably by its N-terminal to the C-terminal of the immunoglobulin molecule or a fragment thereof, wherein the altered fusion protein has an amino acid sequence different from that of said parent fusion protein and exhibits reduced immunogenicity relative to the parent fusion protein when exposed to the immune system of a given species, that is preferably human.
The strategies that are used in practice according to the invention to reduce the immunogenicity of an immunogenic fusion protein are illustrated in detail for the antibody-cytokine fusions. These general strategies include:
~ Examining the amino acid sequences in the fusion protein and prioritizing them with respect to likely immunogenicity, based on the expected presence and abundance of the sequences during negative selection of T-cells in the thymus. For example, completely non-self epitopes are identified, and are the highest priority for removal of T-cell epitopes by mutation. The lowest priority for removal of T-cell epitopes are sequences that are present in abundant serum proteins, such as antibody constant regions or sequences that are found in un-rearranged antibody V regions. An intermediate priority for removal of T-cell epitopes by mutation are self sequences that are found in low abundance proteins, such as cytokines. Without wishing to be bound by theory, it is expected that low abundance proteins may not be present in the thymus in high enough amounts to promote negative T-cell selection, and may thus be recognized as non-self T-cell epitopes.
When a region is chosen for removal of T-cell epitopes by mutation, it is compared with naturally occurring human sequences found in abundant proteins. Mutations are introduced to make any non-self sequences more similar to self sequences. For example, to reduce the immunogenicity of a mouse V region, the sequence is compared to un-rearranged human V regions and the most closely related sequence is found.
"Veneering"
changes are introduced, in which some amino acids are converted from mouse to human.
This has the effect of converting some non-self T-cell epitopes into self T-cell epitopes, a method for reducing immunogenicity disclosed by US 5712120, and also has the effect of removing some B cell epitopes. However, it is still necessary to remove T-cell epitopes that derive from hypervariable region sequences.
~ To remove most or all of the remaining T-cell epitopes, mutations are introduced that, by the computer-based criteria defined above, prevent binding of a peptide into a groove of an MHC Class II molecule. In the case of antibody V regions, it is preferable to introduce mutations that lie outside the CDRs themselves, to avoid interfering with antigen binding.
~ In the case of fusion proteins of any type, it is generally the case that the fusion junction will contain non-self T-cell epitopes. These T-cell epitopes may be also removed by mutation.
As a specific embodiment the invention includes chimeric immunoglobulins or fragments thereof wherein the reduced immunogenicity, the reduced number of T-cell epitopes or the reduced number of peptides binding to MHC class II molecules is located to the target polypeptide portion X as well as to the immunoglobulin portion or fragments thereof of the altered fusion protein.
The invention includes also chimeric immunoglobulins as defined according to the invention wherein the immunoglobulin molecule and the non-immunoglobulin target polypeptide (X) are fused via a linker molecule (L). As a specific embodiment of the invention this linker molecule itself has no or lower immunogenicity. Thus, the invention may include immunoconjugates, wherein the linker molecule alone is de-immunized . Linker molecules which have reduced or no immunogenicity are known in the art or can be prepared by known methods or by the method according to the invention. The invention also includes such immunoglobulin fusion proteins, wherein the immunoglobulin portion as well as the target protein (X) portion of the fusion molecule and optionally the linker molecule and the junction region (see below) are immunogenicly modified. Alternatively, only one or more but not all portions of the molecule are modified according to the invention.
The invention relates, furthermore, to above-said immunoconjugates which may derive, in principal, from all immunoglobulin classes; however IgG is preferred. It is an object of the invention to provide such chimeric immunoglobulins which derive from IgGI, IgG2, IgG3 and IgG4. IgGI and IgG2 immunoglobulins are preferred; IgG2 immunoglobulins are most preferred.
Since it has been shown that even recombinant proteins of human origin and humanized antibodies may elicit an undesirable immune response in humans it is object of this invention to provide fusion proteins wherein the immunoglobulin portion as well as the target polypeptide portion (X) may be selected from non-human as well as from human origin.
Since humanized or human-derived molecules have, as a rule, a less number of T-cell epitopes, such molecules are preferred for de-immunization, because a less number of amino acid residues has to be modified.
Immunoconjugates (irnmunoglobulin (Ig) fusion proteins) according to the invention include also fragments of antibodies like sFv, Fab, Fab', F(ab')2 and Fc. It is a specific and preferred object of the invention to provide said above- and below-defined fusion proteins, wherein the immunoglobulin portion is a Fc domain of an antibody, preferably an IgGI or IgG2 antibody.
Fc-X molecules according to the invention which have reduced affinity to Fc receptors are a preferred object of the invention. Fc molecules having a reduced affinity to Fc receptors are well known in the art and can be prepared by modifying the amino acid sequence of the Fc domain (e.g. WO 99/43713).
In detail, the invention refers to:
an immunogenicly modified fusion protein derived from a parent fusion protein, essentially consisting of a first protein / polypeptide and a second protein /
polypeptide, wherein the first protein is an immunoglobulin molecule or a fragment thereof and the second protein / polypetide is non-immunoglobulin target polypeptide (X) each linked to the other directly or by a linker molecule; said modified fusion protein having an amino acid sequence different from that of said parent fusion protein and exhibiting reduced immunogenicity by a reduced number of T-cell epitopes within its amino acid sequence relative to the parent fusion protein when exposed to the immune system of a given species;
~ a corresponding fusion protein, wherein said T-cell epitopes are peptide sequences able to bind to MCH class II molecule binding groups;
~ a corresponding fusion protein, wherein the target polypeptide (X) is linked by its N-terminal to the C-terminal of the immunoglobulin moiety;.
~ a correspondingly modified fusion protein, wherein the given species is a human;
~ a corresponding fusion protein, wherein the fusion components are fused via a linker molecule L;
~ a modified fusion protein according to claim 4, wherein said linker molecule L is non-immunogenic or less immunogenic;
~ a corresponding fusion protein, wherein the junction region represented by the C-terminal region of the immunoglobulin portion and the N-terminal region of the non-immunoglobulin target polypeptide (X) has no or a reduced number of T-cell epitopes;
~ a corresponding fusion protein, wherein the immunoglobulin portion or a fragment thereof or the target polypeptide (X) portion is less immunogenic;
~ a corresponding fusion protein, wherein said immunoglobulin molecule or fragment thereof is IgGI or IgG2;
~ a corresponding fusion protein, wherein said immunoglobulin fragment is a Fc portion, wherein, preferably, said Fc portion has a reduced affinity to Fc receptors;
~ an immunogenicly modified fusion protein according having the formula Fc- L"-X
wherein Fc is the Fc portion of an immunoglobulin molecule (antibody), X is a non-immunoglobulin target polypeptide L is a linker peptide, n = Oorl,and 3o wherein X and / or L comprises amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule.
Preferred embodiments of these immunogenicly modified Fc fusion molecules are:
Fc - X"' , wherein X is modified only, Fc - Lm - Xm , wherein X and L are modified to have a reduced immunogenicity, Fc - X'" , wherein X and the junction region between Fc and X are modified, Fc - L'" - X"' , wherein X and L and the junction regions between Fc , X and L
are modified;
~ a corresponding Fc - (L) - X fusion protein wherein at least X is immunogenicly modified;
~ an immunogenicly modified fusion protein having the formula A- L,"- X
wherein to A is a whole antibody or its sFv, Fab, Fab', F(ab')Z fragments X is a non-immunoglobulin target polypeptide L is a linker peptide, n = 0 or 1, and wherein A and / or X and / or L comprise amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule;
Preferred embodiments of these immunogenicly modified fusion molecules are:
A - Xm , wherein X is modified only, optionally the A-X junction region, A'" - Xm , wherein A and X are modified, optionally their junction region, A - Lm - X'" , wherein X and L are modified only to have a reduced immunogenicity, Am - X , wherein A has reduced immunogenicity only, optionally the A-X
junction region, Am - Lm - X"', wherein A, L and X are immunogenicly modified, optionally the A-L-X
function regions;
~ a corresponding A - (L) - X fusion molecule, wherein at least X or A is immunogenicly modified;
~ a correponding fusion protein, wherein A is selected from the group:
anti- EGF receptor (HER1) antibodies anti- HER2 antibodies anti- CDx antibodies, wherein x is an integer from 1 - 25 anti- cytokine receptor antibodies anti- 17-lA antibodies, anti- KSA antibodies anti-GP IIb/IIIa antibodies anti-integrin receptor antibodies anti VEGF receptor antibodies;
~ a correpondingly fusion protein, wherein the antibody is selected from the group:
monoclonal antibody 225 and derivatives, monoclonal antibody 425 and derivatives monoclonal antibody KS 1/4 and derivatives monoclonal antibody 14.18 and derivatives monoclonal antibody 4D5 / HER2 (Herceptin~) and derivatives monoclonal antibody 17-lA and derivatives to monoclonal anti-CD3 antibodies monoclonal antibody 7E3 and derivatives monoclonal antibodies LM609, P1F6 and 14D9.F8 and derivatives monoclonal antibody DC-101 and derivatives monoclonal anti-Il-2R antibody (Zenapax~) and derivatives t5 ~ a corresponding fusion protein, wherein the target polypeptide X is selected from the group:
cytokines, integrin inhibitors, soluble cytokine receptors, glycoproteins, hormones, glycoprotein hormones, leptin, growth hormones, growth factors, antihemophilic factors, antigens, cytokine receptor antagonists;
20 ~ a corresponding fusion protein, wherein the target polypeptide X is selected from the group:
IL-2, G-CSF, GM-CSF, EPO, TPO, members of the interferon family, TNFa, soluble TNF receptor, IL-12, IL-8, factor VIII, FGF, TGF, EGF, VEGF, PMSA, IGF, insulin, RGD-peptides, endostatin, angiostatin, BDNF, CNTF, protein c, factor VIII and IX, and 25 and biologically active fragments thereof;
~ a more specidied corresponding fusion protein selected from the group:
MAb KS 1/4 - IL2, MAb 14.18 - IL2 MAb 425 - IL2, MAb c425 - IL2, MAb h425 - IL2, MAb 425 - TNFa MAb 225 - IL2, MAb c225 - IL2 30 MAb 4D5 - IL2, MAb DC 101- I12, MAb LM609 - IL2, Fc - IL2 , Fc - TNFa, Fc - G-CSF, Fc - EPO, Fc - Leptin, Fc - KGF, Fc - BFNF, FC - (3-Cerebrosidase, Fc - TPO, Fc - GM-CSF;
~ an immunogenicly modified artificial protein selected from the group:
(i) Y - (L) - X, wherein Y is a cytokine and X, (L) is a molecule as defined above, (ii) P - (L) - X, wherein P is a protein with unusual glycosylation moieties and X, (L) is a molecule as defined above, (iii) A - (L) - X, wherein A, X (L) is a molecule as defined above, derived from a parent artificial protein having an amino acid sequence which is different from that of said parent artificial protein and exhibits reduced immunogenicity by a reduced number of T-cell epitopes relative to~the parent fusion protein when exposed to the immune system of a given species, wherein said T-cell epitopes are peptide sequences able to bind to MCH class II molecule binding groups obtainable or obtained by a method as specified in this invention;
~ a DNA sequence encoding any fusion protein as specified above and below;
~ a DNA sequence encoding a corresponding fusion protein, comprising (i) a signal sequence (ii) a DNA sequence encoding all domains or a Fc, sFV, Fab, Fab' or F(ab')2 domain of an IgGI, IgG2 or IgG3 antibody, and (ii) a DNA sequence encoding the polypeptide (X), and optionally (iii) a DNA sequence encoding the linker molecule;
~ an expression vector comprising a corresponding DNA sequence;
~ a pharmaceutical composition comprising a fusion protein as specified above and below, optionally together with a suitable carrier, excipient or diluent or another therapeutically effective drug, such as chemotherapeutics or cytotoxic drugs;
~ a method for preparing an immunogenicly modified fusion protein as specified comprising the steps:
(i) determining the amino acid sequence of the parent fusion protein or part thereof;
(ii) identifying one or more potential T-cell epitopes within the amino acid sequence of the fusion protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays, (iii) designing new sequence variants by alteration of at least one amino acid residue within the originally identified T-cell epitope sequences, said variants are modified in such a way to substantially reduce or eliminate the activity or number of the T-cell epitope sequences and / or the number of MHC allotypes able to bind peptides derived from said biological molecule as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays or by binding of peptide-MHC
complexes to T-cells, (iv) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties, and (v) optionally repeating steps (ii) - (iv), characterized in that the identification of T-cell epitope sequences according to step (ii) is achieved by (a) selecting a region of the peptide having a known amino acid residue sequence;
(b) sequentially sampling overlapping amino acid residue segments of predetermined uniform size and constituted by at least three amino acid residues from the selected region; (c) calculating MHC Class II molecule binding score for each said sampled segment by summing assigned values for each hydrophobic amino acid residue side chain present in said sampled amino acid residue segment; and (d) identifying at least one of said segments suitable for modification, based on the calculated MHC Class II
molecule binding score for that segment, to change overall MHC Class II binding score for the peptide without substantially the reducing therapeutic utility of the peptide;
t5 ~ a corresponding method, wherein step (c) is carried out by using a Bohm scoring function modified to include 12-6 van der Waal's ligand-protein energy repulsive term and ligand conformational energy term by (1) providing a first data base of MHC Class II
molecule models; (2) providing a second data base of allowed peptide backbones for said MHC
Class II molecule models; (3) selecting a model from said first data base; (4) selecting an allowed peptide backbone from said second data base; (5) identifying amino acid residue side chains present in each sampled segment; (6) determining the binding affinity value for all side chains present in each sampled segment; and optionally (7) repeating steps (1) through (5) for each said model and each said backbone;
~ a corresponding method, wherein the sampled amino acid residue segment is constituted by 13 amino acid residues and / or consecutive sampled amino acid residue segments overlap by one to five amino acid residues;
~ a corresponding method, wherein 1 - 9 amino acid residues, preferably one amino acid residue, in any of the originally present T-cell epitope sequences (is) are altered;
~ a corresponding method, wherein the alteration of the amino acid residues is substitution, deletion or addition of originally present amino acids) residues) by other amino acid residues) at specific position(s);
~ a corresponding method, wherein additionally further alteration by substitution, deletion or addition is conducted to restore biological activity of said biological molecule.
The polypeptides according to the invention include also antigens, like PMSA
and others.
Antigens which elicit a not desired and too strong immune response can be modified according to the method of the invention and result in antigens which have a reduced immunogenicity which is however strong enough for using the antigen e.g. as vaccine.
The invention includes also variants and other modification of a specific polypeptide, protein, fusion protein, immunoglobulin or immunoconjugate which have in principal the same biological activity and a similar (reduced) immunogenicity. All proteins mentioned above are well known and described in the art or are already commercially available.
Most of them are to known to have a proved therapeutic benefit. The leader or signal sequences and linker sequences may be optional.
Preparing the fusion protein by linking the immunoglobulin component by its C-terminus or its fragment to the N-terminus of the non-immunoglobulin target polypeptide (X), optionally via the linker molecule according to step (ii) as described above, is carned out by:
(i) preparing a gene construct comprising a DNA sequence encoding the polypeptide X, a DNA sequence encoding the immunoglobulin molecule or fragments thereof [sFv, Fab, Fab', F(ab')Z, Fc], and optionally the DNA sequence of a the linker molecule, and (ii) expressing the gene construct by an expression system.
2o The immunoconjugates according to the present invention reveal enhanced properties. Thus decreased protein degradation, increased stability and enhanced serum circulation half-life can be measured as well as a distinctly reduced immunogenicity and / or allergenicity.
Surprisingly, the reduced immunogenicity leads in many cases to a further increase of half-life, especially in cases where Fc-X molecules according to the invention are used. The reduced immunogenicity makes the fusion proteins according to the invention more tolerable for a given species compared to the non-modified fusion proteins and, therefore, can be administered in higher dosages if necessary.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 illustrates one of the mechanisms by which fusion proteins displays enhanced immunogenicity. Figure la shows a protein ("X") fused to an Fc moiety binding to a cell bearing an Fc receptor. Figure 1b shows the fusion protein being processed such that the "X"
moiety is preferentially degraded. Figure lc shows a peptide remnant of "X"
being presented by an MHC molecule to a T-cell.
Fi ure 2 shows a mechanism of enhanced immunogenicity for a fusion protein comprising an Fc moiety and a second moiety. Figure 2a shows the binding of the fusion protein to a B cell that expresses an antibody specific for "X" on its surface. The fusion protein is bound by both the specific antibody and by Fc receptors that are not already bound by the antibody.
Fi ure 3 illustrates a second mechanism by which fusion proteins displays enhanced immunogenicity. Figure la shows a protein ("X") fused to an cytokine moiety binding to a B
1o cell with a surface-bound antibody. Figure 3b shows the fusion protein being processed.
Figure 3c shows a peptide remnant of "X" being presented by an MHC molecule to a T-cell, at the same time that additional X-cytokine fusion protein is bound to the surface of the B cell.
Figure 4 illustrates another mechanism by which an engineered protein displays enhanced immunogenicity. In this case, a cytokine-X fusion protein directly activates a B cell.
The B cell synthesizes a specific antibody to X, which increases the local concentration of the cytokine in the neighborhood of the B cell.
Fi.~ure 5 ~' illustrates another mechanism by which an engineered protein displays enhanced immunogenicity. Figure Sa shows the binding of a protein bearing a glycosylation moiety to a specific cell-surface receptor for that glycosylation moiety on an immune cell.
2o Figure Sb shows the uptake and degradation of the glycosylated protein.
Figure Sc shows the presentation of a peptide remnant of the glycosylated protein to a T-cell via an MHC
molecule.
Fygure 6 shows a mechanism by which an antibody-cytokine fusion protein displays enhanced immunogenicity. Figure 6a shows the binding of the antibody-cytokine fusion protein to a B cell that expresses an antibody specific for the CDRs of the antibody-cytokine fusion protein. The fusion protein is bound by both the specific antibody and by Fc receptors that are not already bound by the antibody. Figure 6b shows the fusion protein being processed. Figure 6c shows a peptide remnant of the CDRs being presented by an MHC
molecule to a T-cell, at the same time that additional antibody-cytokine fusion protein is 3o bound to the surface of the B cell.
DETAILED DESCRIPTION OF THE INVENTION
The term "T-cell epitope" means according to the understanding of this invention an amino acid sequence which is able to bind with reasonable efficiency MHC class II
molecules (or their equivalent in a non-human species), able to stimulate T-cells and / or also to bind (without necessarily measurably activating) T-cells in complex with MHC class II.
The term "peptide" as used herein and in the appended claims, is a compound that includes two or more amino acids. The amino acids are linked together by a peptide bond (defined herein below). There are 20 different naturally occurnng amino acids involved in the biological production of peptides, and any number of them may be linked in any order to form a peptide chain or ring. The naturally occurring amino acids employed in the biological production of peptides all have the L-configuration. Synthetic peptides can be prepared employing conventional synthetic methods, utilizing L-amino acids, D-amino acids, or various combinations of amino acids of the two different configurations. Some peptides contain only a few amino acid units. Short peptides, e.g., having less than ten amino acid units, are sometimes referred to as "oligopeptides". Other peptides contain a large number of amino acid residues, e.g. up to 100 or more, and are referred to as "polypeptides".
By convention, a "polypeptide" may be considered as any peptide chain containing three or more amino acids, whereas a "oligopeptide" is usually considered as a particular type of "short"
polypeptide.
Thus, as used herein, it is understood that any reference to a "polypeptide"
also includes an oligopeptide. Further, any reference to a "peptide" includes polypeptides, oligopeptides, and proteins. Each different arrangement of amino acids forms different polypeptides or proteins.
The number of polypeptides-and hence the number of different proteins-that can be formed is practically unlimited.
The term "less or reduced immunogenic(ity)" used before and thereafter is a relative term and relates to the immunogenicity of the respective original source molecule when exposed in vivo to the same type of species compared with the molecule modified according to the invention.
The term "modified protein" as used according to this invention describes a protein which has reduced number of T-cell epitopes and elicits therefore a reduced immunogenicity relative to the parent protein when exposed to the immune system of a given species.
The term "non-modified protein" as used according to this invention describes the "parent"
protein as compared to the "modified protein" and has a larger number of T-cell epitopes and, therefore, an enhanced immunogenicity relative to the modified protein when exposed to the immune system of a given species.
The term "biologically active protein" as used here and in the claims includes according to the invention polypetides, proteins, immunoglobulins such as antibodies, antibody fragments, fusion proteins, enzymes, antigens and so on, if not defined otherwise, which elicit a biological and / or therapeutic effect.
The term "cytokine" is used herein to describe proteins, analogs thereof, and fragments thereof which are produced and excreted by a cell, and which elicit a specific response in a cell which has a receptor for that cytokine. Preferably, cytokines include interleukins such as interleukin-2 (IL-2), hematopoietic factors such as granulocyte-macrophage colony stimulating factor (GM-CSF), tumor necrosis factor (TNF) such as TNFa, and lymphokines such as lymphotoxin. Preferably, the antibody-cytokine fusion protein of the present invention displays cytokine biological activity. In principal, the inventions encompasses all cytokines as recently classified according to their receptor code (Inglot, 1997, Archivum Immunologiae et Therapiae Experimentalis, 45: 353).
The phrase "single chain Fv" or "scFv" refers to an antibody in which the heavy chain and the light chain of a traditional two chain antibody have been joined to form one chain. Typically, a linker peptide is inserted between the two chains to allow for proper folding and creation of an active binding site.
The term "Fc region" or "Fc domain" as used in this invention is understood to mean the carboxyl terminal portion of an immunoglobulin heavy chain constant region, or an analog or portion thereof capable of binding an Fc receptor. As is known, each immunoglobulin heavy chain constant region comprises four or five domains. The domains are named sequentially as follows: CH1 -hinge-CH2-CH3(-CH4). CH4 is present in IgM, which has no hinge region. The immunoglobulin heavy chain constant region useful in the practice of the invention preferably comprises an immunoglobulin hinge region, and preferably also includes a CH3 domain. The immunoglobulin heavy chain constant region most preferably comprises an immunoglobulin hinge region, a CH2 domain and a CH3 domain. The preferred Fc domain according to this invention consists thus of the hinge-CH2-CH3 domain.
As used herein, the term immunoglobulin "hinge region" is understood to mean an entire immunoglobulin hinge region or at least a portion of the immunoglobulin hinge region sufficient to form one or more disulfide bonds with a second immunoglobulin hinge region.
As used herein, the term "signal sequence" is understood to mean a segment which directs the secretion of the fusion protein and thereafter is cleaved following translation in the host cell.
The signal sequence of the invention is a polynucleotide which encodes an amino acid sequence which initiates transport of a protein across the membrane of the endoplasmic reticulum. Signal sequences which are useful in the invention include antibody light chain signal sequences, e.g., antibody 14.18 (Gillies et. al. (1989) J. Immunol.
Meth. 125 : 191), and any other signal sequences which are known in the art (see, e.g., Watson, 1984, Nucleic Acid Research 12:5145).
The term "mutant or variant" used with respect to a particular protein encompasses any molecule such as a truncated or other derivative of the relevant protein which retains substantially the same activity in humans as the relevant protein. Such other derivatives can be prepared by the addition, deletion, substitution, or rearrangement of amino acids or by to chemical modifications thereof.
It is contemplated that suitable immunoglobulin heavy chain constant regions may be derived from antibodies belonging to each of the immunoglobulin classes referred to as IgA, IgD, IgE, IgG, and IgM, however, immunoglobulin heavy chain constant regions from the IgG class are preferred.
Furthermore, it is contemplated that immunoglobulin heavy chain constant regions may be derived from any of the IgG antibody subclasses referred to in the art as IgGl, IgG2, IgG3, and IgG4. Immunoglobulin heavy chain constant region domains have cross-homology among the immunoglobulin classes. For example, the CH2 domain of IgG is homologous to 2o the CH2 domain of IgA and IgD, and to the CH3 domain of IgM and IgE. The choice of appropriate immunoglobulin heavy chain constant regions is discussed in detail in US
5,541,087 and 5,726,044. The choice of particular immunoglobulin heavy chain constant region sequences from certain immunoglobulin classes and subclasses to achieve a particular result is considered to be within the level of skill in the art. It may be useful, in some circumstances, to modify the immunoglobulin heavy chain constant region, for example, by mutation, deletion or other changes mediated by genetic engineering or other approaches, so that certain activities, such as complement fixation or stimulation of antibody-dependent cell-mediated cytotoxicity (ADCC) are reduced or eliminated.
The Fc region is considered non- or weakly immunogenic if the immunoglobulin heavy chain constant region fails to generate a detectable antibody response.
Furthermore, it is contemplated that substitution or deletion of amino acids within the immunoglobulin heavy chain constant regions may be useful in the practice of the invention. One example may include introducing amino acid substitutions in the upper CH2 region to create a Fc variant with reduced affinity for Fc receptors (Cole et al. (1997) J.
Immuno1.159:3613). An antibody-based fusion protein with an enhanced in vivo circulating half-life can be obtained by constructing a fusion protein having reduced binding affinity for a Fc receptor, and avoiding the use of sequences from antibody isotypes that bind to Fc receptors (WO 99/43713). For example, of the four known IgG isotypes, IgGI
(Cyl) and IaG3 (Cy3) are known to bind FcR~yl with high affinity, whereas IgG4 has a 10-fold lower binding affinity, and IgG2 (Cy2) does not bind to FcRyl. Thus, an antibody-based fusion protein with reduced binding affinity for a Fc receptor could be obtained by constructing a fusion protein with a C~y2 constant region (Fc region) or a C~y4 Fc region, and avoiding constructs with a Cyl Fc region or a Cy3 Fc region. An antibody-based fusion protein with an enhanced in vivo circulating half-life can be obtained by modifying sequences necessary for binding. to Fc receptors in isotypes that have binding affinity for an Fc receptor, in order to reduce or eliminate binding.
The important sequences for FcyR binding are Leu-Leu-Gly-Gly (residues 234 through 237 in C~yl), located in the CH2 domain adjacent to the hinge (Canfield and Morrison, J. Exp. Med.
173: 1483-1491 (1991)). Another important structural component necessary for effective FcR
binding is the presence of an N-linked carbohydrate chain covalently bound to Asnz9~.
Enzymatic removal of this structure or mutation of the Asn residue effectively abolish, or at least dramatically reduce, binding to all classes of Fc~yR.
The resulting antibody-based fusion proteins have a longer ire vivo circulating half-life than the unlinked second non-immunoglobulin protein. Dimerization of a ligand can increase the apparent binding affinity between the ligand and its receptor. For instance, if one X moiety of an Fc-X fusion protein can bind to a receptor on a cell with a certain affinity, the second X
moiety of the same Fc-Interferon-alpha fusion protein may bind to a second receptor on the same cell with a much higher avidity (apparent affinity). This may occur because of the physical proximity of the second X moiety to the receptor after the first X
moiety already is bound. In the case of an antibody binding to an antigen, the apparent affinity may be increased by at least ten thousand-fold. Each protein subunit, i.e., "X," has its own independent function so that in a multivalent molecule, the functions of the protein subunits may be additive or synergistic. Thus, fusion of the normally dimeric Fc molecule or another antibody fragment to a polypeptide X may increase the activity of X.
Nucleic acid sequences encoding, and amino acid sequences defining a human immunoglobulin Fc region, especially a Fc~yl, Fcy2 and Fcy3, useful in the practice of the invention are set forth in in the prior, such as disclosed in (WO
00/40615, WO 00/69913, WO 00/24782) or in the Genbank and/or EMBL databases, for example, AF045536.1 (Macaca fuscicularis), AF045537.1 (Macaca mulatta), AB016710 (Felix catus), (Oryctolagus cuniculus), U03780 (Sus scrofa), 248947 (Camelus dromedarius), X62916 (Bos taurLCS), L07789 (Mustela vison), X69797 (Ovis aries), U17 166 (Cricetulus migratorius), X07189 (Rattus rattus), AF57619.1 (Trichosurus vulpecccla), or AF035195 (Monodelphis domestica).
Thus, vectors reported earlier (Lo et al. (1998) Protein Engeneering 11:495-500) were modified by replacing the human IgGI Fc sequence with sequences from cDNA
encoding the mouse IgG2a Fc (US 5,726,044).
The invention encompasses mutations in the immunoglobulin component which eliminate undesirable properties of the native immunoglobulin, such as Fc receptor binding and/or introduce desirable properties such as stability. For example, Angal S., King D.J., Bodmer M.W., Turner A., Lawson A.D.G., Roberts G., Pedley B. and Adair R., Molecular Immunology,130, pp105-108, 1993, describe an IgG4 molecule where residue 241 (Kabat numbering) is altered from serine to proline. This change increases the serum half-life of the IgG4 molecule. Canfield S.M. and Morrison S.L., Journal of Experimental Medicine vo1173pp1483-149 1, describe the alteration of residue 248 (Kabat numbering) from leucine to glutamate in IgG3 and from glutamate to leucine in mouse IgG2b. Substitution of leucine for glutamate in the former decreases the affinity of the immunoglobulin molecule concerned for the FcyRl receptor, and substitution of glutamate for leucine in the latter increases the affinity. EP 0307 434 discloses various mutations including an L
to E mutation at residue 248 (Kabat numbering) in IgG. The constant domains) or fragment thereof is 3o preferably the whole or a substantial part of the constant region of the heavy chain of human IgG. The IgG component suitably comprises the CH2 and CH3 domains and the hinge region including cysteine residues contributing to inter-heavy chain disulphide bonding. For example when the IgG component is derived from IgG4 it includes cysteine residues 8 and 11 of the IaG4 hinge region (Pinck J.R. and Milstein C., Nature, 121, 6pp941-942, 1967).
The process of the invention may be performed by conventional recombinant techniques such as described in Maniatis et. al. ( Molecular Cloning - A Laboratory Manual;
Cold Spring Harbor, 1982) and DNA Cloning Vols I, II and III (D.M. Glover ed., IRL Press Ltd) or Sambrook et al. (1989, Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY, USA).
1o In particular, the process may comprise the steps of:
(i) preparing a replicable expression vector capable, in a host cell, of expressing a DNA
polymer comprising a nucleotide sequence that encodes said compound;
(ii) transforming a host cell with said vector;
(iii) culturing said transformed host cell under conditions permitting expression of said DNA
polymer to produce said compound; and (iv) recovering said compound.
The invention also provides a process for preparing the DNA polymer by the condensation of appropriate mono-, di- or oligomeric nucleotide units. The preparation may be carned out chemically, enzymatically, or by a combination of the two methods, in virro or in vivo as appropriate. Thus, the DNA polymer may be prepared by the enzymatic ligation of appropriate DNA fragments, by conventional methods such as those described by D. M.
Roberts et al in Biochemistry 1985, 24, 5090-5098. The DNA fragments may be obtained by digestion of DNA containing the required sequences of nucleotides with appropriate restriction enzymes, by chemical synthesis, by enzymatic polymerisation on DNA or RNA templates, or by a combination of these methods. Digestion with restriction enzymes may be performed in an appropriate buffer at a temperature of 20°=70°C with 0.1- 10~g DNA. Enzymatic polymerisation of DNA may be carried out in vitro using a DNA polymerase such as DNA
polymerase I (Klenow fragment) in an appropriate buffer containing the nucleoside uiphosphates dATP, dCTP, dGTP and dITP as required at a temperature of 10°-37°C, generally in a volume of 501 or less. Enzymatic ligation of DNA fragments may be carned out using a DNA lipase such as T4 DNA lipase in an appropriate buffer at a temperature of 40°C to ambient, generally in a volume of 501 or less.
The chemical synthesis of the DNA polymer or fragments may be carned out by conventional phosphotriester, phosphite or phosphoramidite chemistry, using solid phase techniques such as those described in "Chemical and Enzymatic Synthesis of Gene Fragments - A
Laboratory Manual" (ed. H.G. Gassen and A. Lang), Verlag Chemie, Weinheim (1982),or in other scientific publications, for example M.J. Gait, H.W.D. Matthes, M. Singh, B.S.
Sproat, and R.C. Titmas, Nucleic Acids Research, 1982,10, 6243; B.S. Sproat and W.
Bannwarth, Tetrahedron Letters, 1983,24,5771; M.D. Matteucci and M.H Caruthers, Tetrahedron Letters, 1980,21,719; M.D. Matteucci and M.H. Caruthers, Journal of the American Chemical Society, to 1981,103, 3185; S.P. Adams et al., Journal of the American Chemical Society,1983, 105, 661;
N.D. Sinha, J. Biemat, J. McMannus, and H. Koester, Nucleic Acids Research, 1984, 12,4539;
and H.W.D. Matthes et al., EMBO Journal, 1984,3,801. Preferably an automated DNA synthesizer is employed.
The DNA molecules may be obtained by the digestion with suitable restriction enzymes of vectors carrying the required coding sequences or by use of polymerise chain reaction technology. The precise structure of the DNA molecules and the way in which they are obtained depends upon the structure of the desired product. The design of a suitable strategy for the construction of the DNA molecule coding for the compound is a routine matter for the skilled worker in the art.
The expression of the DNA polymer encoding the compound in a recombinant host cell may be carned out by means of a replicable expression vector capable, in the host cell, of expressing the DNA polymer. The expression vector is novel and also forms part of the invention. The replicable expression vector may be prepared in accordance with the invention, by cleaving a vector compatible with the host cell to provide a linear DNA
segment having an intact replicon, and combining said linear segment with one or more DNA
molecules which, together with said linear segment, encode the compound, under ligating conditions. The ligation of the linear segment and more than one DNA molecule may be carried out 3o simultaneously or sequentially as desired. Thus, the DNA polymer may be preformed or formed during the construction of the vector, as desired. A useful expression vector is described at Lo et al. (1988) Protein Engineeering 11:495, in which the transcription of the Fc-X gene utilizes the enhancer/promoter of the human cytomegalovirus and the polyadenylation signal. Suitable vectors include plasmids, bacteriophages, cosmids and recombinant viruses derived from, for example, baculoviruses, vaccinia or Semliki Forest virus. Thus, vectors reported earlier (Lo et al. (1998) Protein Engeneering 11:495-500) were modified by replacing the human IgGI Fc sequence with sequences from cDNA
encoding the mouse IgG2a Fc (US 5,726,044).
The choice of vector will be determined in part by the host cell, which may be prokaryotic, such as E. coli, or eukaryotic, such as mouse C 127, mouse myeloma, Chinese hamster ovary, COS or Hela cells, fungi e.g. filamentous fungi or unicellular yeast or an insect cell such as Drosophila. Currently preferred host cells for use in the invention include immortal hybridoma cells, NS/0 myeloma cells, 293 cells, Chinese hamster ovary cells, HELA cells, and COS cells.
The host cell may also be a transgenic animal.
Polymerisation and ligation may be performed as described above for the preparation of the DNA polymer. Digestion with restriction enzymes may be performed in an appropriate buffer at a temperature of 20°- 70°C with 0.1 -10~g DNA. The recombinant host cell is prepared, in accordance with the invention, by transforming a host cell with a replicable expression vector of the invention under transforming conditions. Suitable transforming conditions are conventional and are described in, for example, Maniatis et al., cited above, or "DNA
2o Cloning" Vol. II, D.M. Glover ed., IRL Press Ltd, 1985. The choice of transforming conditions is determined by the host cell. Thus, a bacterial host such as E.
coli may be treated with a solution of CaCIZ (Cohen er al, Proc. Nat. Acad. Sci., 1973,69,2110) or with a solution comprising a mixture of RbCI, MnCl2, potassium acetate and glycerol, and then with 3-[N-morpholinol-propane- sulphonic acid, RbCI and glycerol. Mammalian cells in culture may .
be transformed by calcium co-precipitation of the vector DNA onto the cells.
The invention also extends to a host cell transformed or transfected with a replicable expression vector of the invention. Culturing the transformed host cell under conditions permitting expression of the DNA polymer is carned out conventionally, as described in, for example, Maniatis et al. and "DNA Cloning" cited above. Thus, preferably the cell is supplied with nutrient 3o and cultured at a temperature below 45°C. The expression product is recovered by conventional methods according to the host cell. Thus, where the host cell is bacterial, such as E. coli it may be lysed physically, chemically or enzymatically and the protein product isolated from the resulting lysate. If the product is to be secreted from the bacterial cell it may be recovered from the periplasmic space or the nutrient medium. Where the host cell is mammalian, the product may generally be isolated from the nutrient medium.
The DNA
polymer may be assembled into vectors designed for isolation of stable transformed mammalian cell lines expressing the product: e.g. bovine papillomavirus vectors or amplified vectors in Chinese hamster ovary cells (DNA cloning Vol.l 1 D.M. Glover ed.
IRL Press 1985;
Kaufman, R.J., Molecular and Cellular Biology 5, 1750-1759, 1985; Pavlakis G.N. and Hamer, D.H., Proceedings of the National Academy of Sciences (USA) 80,397-401,1983;
Goeddel, D.V. et al., and EP 0 093 619,1983).
The immunoconjugates of the invention may comprise linker molecules. The linker is preferably made up of amino acids linked together by peptide bonds. Thus, in preferred embodiments, the linker is made up of from 1 to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids. Some of these amino acids may be glycosylated, as is well understood by those in the art. In a more preferred embodiment, the 1 to 20 amino acids are selected from glycine, alanine, proline, asparagine, glutamine, and lysine. Even more preferably, a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine. Thus, preferred linkers are polyglycines such as polyGly (particularly (Gly)2 - (Gly)~), 2o poly(Gly-Ala), polyAla .
Other specific examples of suitable linkers are:
(Gly)3Lys(Gly)a (Gly)3AsnGlySer(Gly)Z
(Gly)3Cys(Gly)4 and GlyProAsnGlyGly Combinations of Gly and Ala are also preferred. The linkers shown here are exemplary;
linkers within the scope of this invention may be much longer and may include other residues. Non-peptide linkers are also possible. The peptide linkers may be altered to form derivatives in the same manner as described above.
Preferred linkers of the invention are not or less immunogenic. Most of the above-cited linker peptides are at least less immunogenic. However it is possible that creating the linkage between an antibody or a sFv, Fab, Fab' or F(ab')2 or a Fc domain and the target protein via a linker peptide molecule as mentioned above, new immunogenic epitopes may be newly created within the linkage region resulting in an immunoconjugate which has an increased immunogenicity compared to the immunogenicity of the single (de-immunized) components.
This situation can also be extended to fusion protein having no linker molecule. Therefore, the invention also relates to de-immunized regions of a fusion protein according to the invention, the so-called fusion or junction regions. When fusing a first protein molecule with a second protein molecule (which also can be a linker molecule) via the C- and N-terminals a sequence region is created that is artificial and, thus, was usually not yet seen by the immune system.
This region is deemed is be immunogenic. The region of amino acid residues comprise according to the invention approximately 10 residues of each protein terminal (N- or C-terminal). The complete fusion region comprises, therefore, about 20 amino acid residues, preferably 2 - 16, more preferably 2 - 10 (which is 1 - 8 and 1 - 5 amino acid residues, respectively, of each fusion partner).
The invention includes also further Fc variants. Such further Fc variants, one may remove one or more sites of a native Fc that provide structural features or functional activity not required by the fusion molecules of this invention. One may remove these sites by, for example, substituting or deleting residues, inserting residues into the site, or truncating portions containing the site. The inserted or substituted residues may also be altered amino acids, such as peptidomimetics or D- amino acids. For example, one or more glycosylation sites may be removed. Residues that are typically glycosylated (e.g., asparagine) may confer cytolytic response. Such residues may be deleted or substituted with unglycosylated residues (e.g., alanine). ADCC site as well as sites involved in interaction with complement, such as the Clq binding site, may also be removed if there is a specific need.
The invention includes also derivatives of the target polypeptide (X) of the invention. Such derivatives may further improve the solubility, absorption, biological half life, and the like of (X). The modified (X) may alternatively eliminate or attenuate any undesirable side-effect and the like. Exemplary derivatives include also compounds in which (X) or some portion thereof is cyclic. For example, the peptide portion may be modified to contain two or more Cys residues (e.g., in the linker), which could cyclize by disulfide bond formation. The compound is cross-linked or is rendered capable of cross-linking between molecules. For example, the peptide portion may be modified to contain one Cys residue and thereby be able to form an intermolecular disulfide bond with a like molecule.
In a final aspect the present invention relates to pharmaceutical compositions comprising said biologically active proteins obtainable by the methods disclosed in the present invention, and methods for therapeutic treatment of humans using the modified molecules and pharmaceutical compositions.
Therapeutic compositions of the present invention contain a physiologically tolerable Garner together with the relevant agent as described herein, dissolved or dispersed therein as an active 1o ingredient. As used herein. the terms "pharmaceutically acceptable", "physiologically tolerable" and grammatical variations thereof, as they refer to compositions, carriers, diluents and reagents, are used interchangeably and represent that the materials are capable of administration to or upon a mammal without the production of undesirable physiological effects such as nausea, dizziness, gastric upset and the like. The preparation of a t5 pharmacological composition that contains active ingredients dissolved or dispersed therein is well understood in the art and need not be limited based on formulation.
Typically, such compositions are prepared as injectables either as liquid solutions or suspensions, however, solid forms suitable for solution, or suspensions, in liquid prior to use can also be prepared.
The preparation can also be emulsified. The active ingredient can be mixed with excipients 20 which are pharmaceutically acceptable and compatible with the active ingredient and in amounts suitable for use in the therapeutic methods described herein. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol or the like and combinations thereof. In addition, if desired, the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents and the like which enhance the 25 effectiveness of the active ingredient.
The therapeutic composition of the present invention can include pharmaceutically acceptable salts of the components therein. Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the polypeptide) that are formed with inorganic acids such as. for example, hydrochloric or phosphoric acids, or such organic acids as acetic, 30 tartaric, mandelic and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine and the like. Particularly preferred is the HCI salt when used in the preparation of cyclic polypeptide av antagonists. Physiologically tolerable earners are well known in the art. Exemplary of liquid earners are sterile aqueous solutions that contain no materials in addition to the active ingredients and water, or contain a buffer such as sodium phosphate at physiological pH value, physiological saline or both, such as phosphate-buffered saline. Still further, aqueous earners can contain more than one buffer salt, as well as salts such as sodium and potassium chlorides, dextrose, polyethylene glycol and other solutes.
Liquid compositions can also contain liquid phases in addition to and to the exclusion of water. Exemplary of such additional liquid phases are glycerin. vegetable oils such as cottonseed oil, and water-oil emulsions.
Typically, a therapeutically effective amount of a modified immunoglobulin in the form of an modified antibody or antibody fragment according to the invention is an amount such that when administered in physiologically tolerable composition is sufficient to achieve a plasma concentration of from about 0.01 microgram (pg) per milliliter (ml) to about 100 ~g/ml, preferably from about 1 p,g/ml to about 5 ~g/ml and usually about 5 ~g/ml.
Stated differently.
the dosage can vary from about 0.1 mg/kg to about 300 mg/kg, preferably from about 0.2 mg/kg to about 200 mg/kg, most preferably from about 0.5 mg/kg to about 20 mg/kg, in one or more dose administrations daily for one or several days. Where the immunotherapeutic agent is in the form of a fragment of a monoclonal antibody or a conjugate, the amount can readily be adjusted based on the mass of the fragment / conjugate relative to the mass of the whole antibody. A preferred plasma concentration in molarity is from about 2 micromolar (~M) to about 5 millimolar (mM) and preferably, about 100 p,M to 1 mM antibody antagonist.
A therapeutically effective amount of an agent according of this invention which is a non-immunotherapeutic peptide or a protein is typically an amount of such a molecule such that when administered in a physiologically tolerable composition is sufficient to achieve a plasma concentration of from about 0.1 microgram (p,g) per milliliter (ml) to about 200 ~g/ml, preferably from about 1 ~g/ml to about 150 p,g/ml. Based on a protein having a mass of about 500 grams per mole, the preferred plasma concentration in molarity is from about 2 micromolar (~M) to about 5 millimolar (mM) and preferably about 100 ~M to 1 mM
polypeptide antagonist.
The pharmaceutical compositions of the invention can comprise phrase encompasses treatment of a subject with agents that reduce or avoid side effects associated with the combination therapy of the present invention ("adjunctive therapy"), including, but not limited to, those agents, for example, that reduce the toxic effect of anticancer drugs. Said adjunctive agents prevent or reduce the incidence of nausea and vomiting associated with chemotherapy, radiotherapy or operation, or reduce the incidence of infection associated with the administration of myelosuppressive anticancer drugs. Adjunctive agents are well known in the art. The modified proteins according to the invention can additionally administered with adjuvants like BCG and immune system stimulators.
Furthermore, the compositions may include immunotherapeutic agents, chemotherapeutic agents and anti-neoplastic agents which may contain cytotoxic effective radio labeled isotopes, or other cytotoxic agents, such as a cytotoxic peptides (e.g.
cytokines) or cytotoxic drugs and the like. The typical dosage of an active agent, which is a preferably a chemical antagonist or a (chemical) chemotherapeutic agent according to the invention (neither an immunotherapeutic agent nor a non-immunotherapeutic peptide/protein) is 10 mg to 1000 mg, preferably about 20 to 200 mg, and more preferably 50 to 100 mg per kilogram body weight t5 per day.
The following examples describe the in invention in more detail. However, this listing does not limit the invention.
2o EXAMPLE 1:
The following example describes in detail a preferred method for identification of immunogenic sequence regions (T-cell epitopes) within the sequences of the fusion proteins as disclosed in this invention. However, it should be pointed out, that said molecules can be obtained by other known methods.
The identification of T-cell epitopes of the molecules which were modified in order to obtain the immunoconjugates according to the present invention can be achieved by different methods which are described in the prior art (WO 92/10755 and WO 96/40792 (Novo Nordisk), EP 0519 596 (Merck & Co.), EP 0699 755(Centro de Immunologia Moelcular), WO
98/52976 and WO 98/59244 (Biovation Ltd.) or related methods.
Advantageous immunoconjugates, however, can be obtained if the identification of said epitopes is realized by the following new method which is described herewith in detail:
There are a number of factors that play important roles in determining the total structure of a protein, polypeptide or immunoglobulin. First, the peptide bond, i.e., that bond which joins the amino acids in the chain together, is a covalent bond. This bond is planar in structure, essentially a substituted amide. An "amide" is any of a group of organic compounds containing the grouping -CONH-.
The planar peptide bond linking Ca of adjacent amino acids may be represented as depicted below:
Ca -_______________.H
0________________~ \
Because the O=C and the C-N atoms lie in a relatively rigid plane, free rotation does not occur t0 about these axes. Hence, a plane schematically depicted by the interrupted line is sometimes referred to as an "amide" or "peptide plane" plane wherein lie the oxygen (O), carbon (C), nitrogen (N), and hydrogen (H) atoms of the peptide backbone. At opposite corners of this amide plane are located the Ca atoms. Since there is substantially no rotation about the O=C
and C-N atoms in the peptide or amide plane, a polypeptide chain thus comprises a series of planar peptide linkages joining the Ca atoms.
A second factor that plays an important role in defining the total structure or conformation of a polypeptide or protein is the angle of rotation of each amide plane about the common Ca linkage. The terms "angle of rotation" and "torsion angle" are hereinafter regarded as equivalent terms. Assuming that the O, C, N, and H atoms remain in the amide plane (which is usually a valid assumption, although there may be some slight deviations from planarity of these atoms for some conformations), these angles of rotation define the N and R
polypeptide's backbone conformation, i.e., the structure as it exists between adjacent residues.
These two angles are known as ~ and W. A set of the angles ~1, W1, where the subscript i represents a particular residue of a polypeptide chain, thus effectively defines the polypeptide secondary structure. The conventions used in defining the ~, W angles, i.e., the reference points at which the amide planes form a zero degree angle, and the definition of which angle is ~, and which angle is W, for a given polypeptide, are defined in the literature. See, e.g"
Ramachandran et al. Adv. Prot. Chem. 23:283-437 (1968), at pages 285-94, which pages are incorporated herein by reference.
The present method can be applied to any protein, and is based in part upon the discovery that in humans the primary Pocket 1 anchor position of MHC Class II molecule binding grooves has a well designed specificity for particular amino acid side chains. The specificity of this pocket is determined by the identity of the amino acid at position 86 of the beta chain of the MHC Class II molecule. This site is located at the bottom of Pocket 1 and determines the size of the side chain that can be accommodated by this pocket. Marshall, K.W., J.
Immunol., 152:4946-4956 (1994). If this residue is a glycine, then all hydrophobic aliphatic and aromatic 1o amino acids (hydrophobic aliphatics being: valine, leucine, isoleucine, methionine and aromatics being: phenylalanine, tyrosine and tryptophan) can be accommodated in the pocket, a preference being for the aromatic side chains. If this pocket residue is a valine, then the side chain of this amino acid protrudes into the pocket and restricts the size of peptide side chains that can be accommodated such that only hydrophobic aliphatic side chains can be accommodated. Therefore, in an amino acid residue sequence, wherever an amino acid with a hydrophobic aliphatic or aromatic side chain is found, there is the potential for a MHC Class II
restricted T-cell epitope to be present. If the side-chain is hydrophobic aliphatic, however, it is approximately twice as likely to be associated with a T-cell epitope than an aromatic side chain (assuming an approximately even distribution of Pocket 1 types throughout the global 2o population).
A computational method embodying the present invention profiles the likelihood of peptide regions to contain T-cell epitopes as follows:
(1) The primary sequence of a peptide segment of predetermined length is scanned, and all hydrophobic aliphatic and aromatic side chains present are identified. (2)The hydrophobic aliphatic side chains are assigned a value greater than that for the aromatic side chains;
preferably about twice the value assigned to the aromatic side chains, e.g., a value of 2 for a hydrophobic aliphatic side chain and a value of 1 for an aromatic side chain.
(3) The values determined to be present are summed for each overlapping amino acid residue segment (window) of predetermined uniform length within the peptide, and the total value for a 3o particular segment (window) is assigned to a single amino acid residue at an intermediate position of the segment (window), preferably to a residue at about the midpoint of the sampled segment (window). This procedure is repeated for each sampled overlapping amino acid residue segment (window). Thus, each amino acid residue of the peptide is assigned a value that relates to the likelihood of a T-cell epitope being present in that particular segment (window). (4) The values calculated and assigned as described in Step 3, above, can be plotted against the amino acid coordinates of the entire amino acid residue sequence being assessed.
(5) All portions of the sequence which have a score of a predetermined value, e.g., a value of 1, are deemed likely to contain a T-cell epitope and can be modified, if desired.
This particular aspect of the present invention provides a general method by which the regions of peptides likely to contain T-cell epitopes can be described. Modifications to the peptide in these regions have the potential to modify the MHC Class II binding characteristics.
According to another aspect of the present invention, T-cell epitopes can be predicted with 1o greater accuracy by the use of a more sophisticated computational method which takes into account the interactions of peptides with models of MHC Class II alleles.
The computational prediction of T-cell epitopes present within a peptide according to this particular aspect contemplates the construction of models of at least 42 MHC
Class II alleles based upon the structures of all known MHC Class II molecules and a method for the use of 15 these models in the computational identification of T-cell epitopes, the construction of libraries of peptide backbones for each model in order to allow for the known variability in relative peptide backbone alpha carbon (Ccc) positions, the construction of libraries of amino-acid side chain conformations for each backbone dock with each model for each of the 20 amino-acid alternatives at positions critical for the interaction between peptide and MHC
2o Class II molecule, and the use of these libraries of backbones and side-chain conformations in conjunction with a scoring function to select the optimum backbone and side-chain conformation for a particular peptide docked with a particular MHC Class II
molecule and the derivation of a binding score from this interaction.
Models of MHC Class II molecules can be derived via homology modeling from a number of 25 similar structures found in the Brookhaven Protein Data Bank ("PDB"). These may be made by the use of semi-automatic homology modeling software (Modeller, Sali A. &
Blundell TL., 1993. J. Mol Biol 234:779-815) which incorporates a simulated annealing function, in conjunction with the CHARMm force-field for energy minimisation (available from Molecular Simulations Inc., San Diego, Ca.). Alternative modeling methods can be utilized as 3o well.
The present method differs significantly from other computational methods which use libraries of experimentally derived binding data of each amino-acid alternative at each position in the binding groove for a small set of MHC Class II molecules (Marshall, K.W., et al., Biomed.
Pept. Proteins Nucleic Acids, 1(3):157-162) (1995) or yet other computational methods which use similar experimental binding data in order to define the binding characteristics of particular types of binding pockets within the groove, again using a relatively small subset of MHC Class II molecules, and then 'mixing and matching' pocket types from this pocket library to artificially create further 'virtual' MHC Class II molecules (Sturniolo T., et al., Nat.
Biotech, 17(6): 555-561 (1999). Both prior methods suffer the major disadvantage that, due to the complexity of the assays and the need to synthesize large numbers of peptide variants, only a small number of MHC Class II molecules can be experimentally scanned.
Therefore the first prior method can only make predictions for a small number of MHC Class II
molecules. The second prior method also makes the assumption that a pocket lined with similar amino-acids in one molecule will have the same binding characteristics when in the context of a different Class II allele and suffers further disadvantages in that only those MHC Class II molecules can be 'virtually' created which contain pockets contained within the pocket library. Using the modeling approach described herein, the structure of any number and type of MHC Class II
molecules can be deduced, therefore alleles can be specifically selected to be representative of the global population. In addition, the number of MHC Class II molecules scanned can be increased by making further models further than having to generate additional data via complex experimentation.
The use of a backbone library allows for variation in the positions of the Ca atoms of the 2o various peptides being scanned when docked with particular MHC Class II
molecules. This is again in contrast to the alternative prior computational methods described above which rely on the use of simplified peptide backbones for scanning amino-acid binding in particular pockets.
These simplified backbones are not likely to be representative of backbone conformations found in 'real' peptides leading to inaccuracies in prediction of peptide binding. The present backbone library is created by superposing the backbones of all peptides bound to MHC Class II molecules found within the Protein Data Bank and noting the root mean square (RMS) deviation between the Ca atoms of each of the eleven amino-acids located within the binding groove. While this library can be derived from a small number of suitable available mouse and human structures (currently 13), in order to allow for the possibility of even greater variability, the RMS figure for each C"-a position is increased by 50%. The average Ca position of each amino-acid is then determined and a sphere drawn around this point whose radius equals the RMS deviation at that position plus 50%. This sphere represents all allowed Ca positions.
Working from the Ca with the least RMS deviation (that of the amino-acid in Pocket 1 as mentioned above, equivalent to Position 2 of~the 11 residues in the binding groove), the sphere is three-dimensionally gridded, and each vertex within the grid is then used as a possible location for a Ca of that amino-acid. The subsequent amide plane, corresponding to the peptide bond to the subsequent amino-acid is grafted onto each of these Cas and the ~ and ~r angles are rotated step-wise at set intervals in order to position the subsequent Ca. If the subsequent Ca falls within the 'sphere of allowed positions' for this Ca than the orientation of the dipeptide is accepted, whereas if it falls outside the sphere then the dipeptide is rejected.
This process is then repeated for each of the subsequent Ca positions, such that the peptide grows from the Pocket 1 Ca 'seed', until all nine subsequent Cas have been positioned from all possible permutations of the preceding Cas. The process is then repeated once more for the single Ca preceding pocket 1 to create a library of backbone Ca positions located within the binding groove.
The number of backbones generated is dependent upon several factors: The size of the ~ 'spheres of allowed positions'; the fineness of the gridding of the 'primary sphere' at the Pocket 1 position; the fineness of the step-wise rotation of the ~ and ~
angles used to position.
subsequent Cas. Using this process, a large library of backbones can be created. The larger the backbone library, the more likely it will be that the optimum fit will be found for a particular peptide within the binding groove of an MHC Class II molecule.
Inasmuch as all backbones will not be suitable for docking with all the models of MHC Class II
molecules due to clashes with amino-acids of the binding domains, for each allele a subset of the library is created comprising backbones which can be accommodated by that allele. The use of the backbone library, in conjunction with the models of MHC Class II molecules creates an exhaustive database consisting of allowed side chain conformations for each amino-acid in each position of the binding groove for each MHC Class II molecule docked with each allowed backbone. This data set is generated using a simple steric overlap function where a MHC Class II molecule is docked with a backbone and an amino-acid side chain is grafted onto the backbone at the desired position. Each of the rotatable bonds of the side chain is rotated step-wise at set intervals and the resultant positions of the atoms dependent upon that bond noted. The interaction of the atom with atoms of side-chains of the binding groove is noted and positions are either accepted or rejected according to the following criteria: The sum total of the overlap of all atoms so far positioned must not exceed a pre-determined value.
Thus the stringency of the conformational search is a function of the interval used in the step-wise rotation of the bond and the pre-determined limit for the total overlap.
This latter value can be small if it is known that a particular pocket is rigid, however the stringency can be relaxed if the positions of pocket side-chains are known to be relatively flexible. Thus allowances can be made to imitate variations in flexibility within pockets of the binding groove. This conformational search is then repeated for every amino-acid at every position of each backbone when docked with each of the MHC Class II molecules to create the exhaustive database of side-chain conformations.
A suitable mathematical expression is used to estimate the energy of binding between models of MHC Class II molecules in conjunction with peptide ligand conformations which have to be empirically derived by scanning the large database of backbone/side-chain conformations described above. Thus a protein is scanned for potential T-cell epitopes by subjecting each possible peptide of length varying between 9 and 20 amino-acids (although the length is kept constant for each scan) to the following computations: An MHC Class II
molecule is selected together with a peptide backbone allowed for that molecule and the side-chains corresponding to the desired peptide sequence are grafted on. Atom identity and interatomic..distance data relating to a particular side-chain at a particular position on the backbone are collected for each allowed conformation of that amino-acid (obtained from the database described above).
This is repeated for each side-chain along the backbone and peptide scores derived using a scoring function. The best score for that backbone is retained and the process repeated for each allowed backbone for the selected model. The scores from all allowed backbones are compared and the highest score is deemed to be the peptide score for the desired peptide in that MHC Class II model. This process is then repeated for each model with every possible peptide derived from the protein being scanned, and the scores for peptides versus models are displayed.
In the context of the present invention, each ligand presented for the binding affinity calculation is an amino-acid segment selected from a peptide or protein as discussed above.
Thus, the ligand is a selected stretch of amino acids about 9 to 20 amino acids in length derived from a peptide, polypeptide or protein of known sequence. The terms "amino acids"
and "residues" are hereinafter regarded as equivalent terms. The ligand, in the form of the consecutive amino acids of the peptide to be examined grafted onto a backbone from the backbone library, is positioned in the binding cleft of an MHC Class II
molecule from the MHC Class II molecule model library via the coordinates of the C"-a atoms of the peptide backbone and an allowed conformation for each side-chain is selected from the database of allowed conformations. The relevant atom identities and interatomic distances are also retrieved from this database and used to calculate the peptide binding score.
Ligands with a high binding affinity for the MHC Class II binding pocket are flagged as candidates for site-s directed mutagenesis. Amino-acid substitutions are made in the flagged ligand (and hence in the protein of interest) which is then retested using the scoring function in order to determine changes which reduce the binding affinity below a predetermined threshold value. These changes can then be incorporated into the protein of interest to remove T-cell epitopes.
Binding between the peptide ligand and the binding groove of MHC Class II
molecules involves non-covalent interactions including, but not limited to: hydrogen bonds, electrostatic interactions, hydrophobic (lipophilic) interactions and Van der Walls interactions. These are included in the peptide scoring function as described in detail below. It should be understood that a hydrogen bond is a non-covalent bond which can be formed between polar or charged groups and consists of a hydrogen atom shared by two other atoms. The hydrogen of the hydrogen donor has a positive charge where the hydrogen acceptor has a partial negative charge. For the purposes of peptide/protein interactions, hydrogen bond donors may be either nitrogens with hydrogen attached or hydrogens attached to oxygen or nitrogen.
Hydrogen bond acceptor atoms may be oxygens not attached to hydrogen, nitrogens with no hydrogens attached and one or two connections, or sulphurs with only one connection.
Certain atoms, 2o such as oxygens attached to hydrogens or imine nitrogens (e.g. C=NH) may be both hydrogen acceptors or donors. Hydrogen bond energies range from 3 to 7 Kcal/mol and are much stronger than Van der Waal's bonds, but weaker than covalent bonds. Hydrogen bonds are also highly directional and are at their strongest when the donor atom, hydrogen atom and acceptor atom are co-linear. Electrostatic bonds are formed between oppositely charged ion pairs and the strength of the interaction is inversely proportional to the square of the distance between the atoms according to Coulomb's law. The optimal distance between ion pairs is about 2.8A. In protein/peptide interactions, electrostatic bonds may be formed between arginine, histidine or lysine and aspartate or glutamate. The strength of the bond will depend upon the pKa of the ionizing group and the dielectric constant of the medium although they 3o are approximately similar in strength to hydrogen bonds.
Lipophilic interactions are favorable hydrophobic-hydrophobic contacts that occur between he protein and peptide ligand. Usually, these will occur between hydrophobic amino acid side chains of the peptide buried within the pockets of the binding groove such that they are not exposed to solvent. Exposure of the hydrophobic residues to solvent is highly unfavorable since the surrounding solvent molecules are forced to hydrogen bond with each other forming cage-like clathrate structures. The resultant decrease in entropy is highly unfavorable.
Lipophilic atoms may be sulphurs which are neither polar nor hydrogen acceptors and carbon atoms which are not polar.
Van der Waal's bonds are non-specific forces found between atoms which are 3-4A apart.
They are weaker and less specific than hydrogen and electrostatic bonds. The distribution of electronic charge around an atom changes with time and, at any instant, the charge distribution is not symmetric. This transient asymmetry in electronic charge induces a similar asymmetry 1o in neighboring atoms. The resultant attractive forces between atoms reaches a maximum at the Van der Waal's contact distance but diminishes very rapidly at about 1A to about 2A.
Conversely, as atoms become separated by less than the contact distance, increasingly strong repulsive forces become dominant as the outer electron clouds of the atoms overlap. Although the attractive forces are relatively weak compared to electrostatic and hydrogen bonds (about ~5 0.6 Kcal/mol), the repulsive forces in particular may be very important in determining whether a peptide ligand may bind successfully to a protein.
In one embodiment, the Bohm scoring function (SCORE1 approach) is used to estimate the binding constant. (Bohm, H.J., J. Comput Aided Mol. Des., 8(3):243-256 (1994) which is hereby incorporated in its entirety). In another embodiment, the scoring function (SCORE2 2o approach) is used to estimate the binding affinities as an indicator of a ligand containing a T-cell epitope (Bohm, H.J., J. Compcct Aided Mol. Des., 12(4):309-323 (1998) which is hereby incorporated in its entirety). However, the Bohm scoring functions as described in the above references are used to estimate the binding affinity of a ligand to a protein where it is already known that the ligand successfully binds to the protein and the proteinlligand complex has had 25 its structure solved, the solved structure being present in the Protein Data Bank ("PDB").
Therefore, the scoring function has been developed with the benefit of known positive binding data. In order to allow for discrimination between positive and negative binders, a repulsion term must be added to the equation. In addition, a more satisfactory estimate of binding energy is achieved by computing the lipophilic interactions in a pairwise manner rather than 30 using the area based energy term of the above Bohm functions. Therefore, in a preferred embodiment, the binding energy is estimated using a modified Bohm scoring function. In the modified Bohm scoring function, the binding energy between protein and ligand (OGb;"d) is estimated considering the following parameters: The reduction of binding energy due to the overall loss of translational and rotational entropy of the ligand (OGo);
contributions from ideal hydrogen bonds (~G,,b) where at least one partner is neutral; contributions from unperturbed ionic interactions (OG;°n~~); lipophilic interactions between lipophilic ligand atoms and lipophilic acceptor atoms (OG,;P°); the loss of binding energy due to the freezing of internal degrees of freedom in the ligand, i.e., the freedom of rotation about each C-C
bond is reduced (OG~°~); the energy of the interaction between the protein and ligand (Evdw). Consideration of these terms gives eduation 1:
(~Gbind) _ ( OGp) + ( OGhbXNhb) + ( ~C,ionicXNionic) + ( OGlipoXNlipo) + ( OGrot+Nrot) + ( E vdW) Where N is the number of qualifying interactions for a specific term and, in one embodiment, ~Go, OGhb, OG;°".c, ~Gi,P° and OG~°~ are constants which are given the values: 5.4, -4.7, -4.7, -0.17, and 1.4, respectively.
The term Nhb is calculated according to eguation 2:
Nhb = Lh-bonds f ( ~R , ~a ) X f ( Nneighb ) x f p~s f(~R, Via) is a penalty function which accounts for large deviations of hydrogen bonds from ideality and is calculated according to eguation 3:
f (OR, ~-a> - fl (OR) x f2 (0a) Where: f1 (0R) - 1 if 0R <= TOL
or = 1 - ( 0R - TOL ) / 0 . 4 i f 0R < = 0 . 4 + TOL
or = 0 if 0R >0.4 + TOL
And: f2 (0a) - 1 if 0a <30°
or = 1- ( ~a - 30) /50 if 0a <=80°
or = 0 if Da >80°
a TOL is the tolerated deviation in hydrogen bond length = 0.25A
~R is the deviation of the H-O/N hydrogen bond length from the ideal value =
1.9~
Da is the deviation of the hydrogen bond angle L rvio-H..omr from its idealized value of 180°
f(Nneighb) distinguishes between concave and convex parts of a protein surface and therefore assigns greater weight to polar interactions found in pockets rather than those found at the protein surface. This function is calculated according to e~c uation 4 below:
f (Nneighb) - (Nneighb/Nneighb.0) a where a = 0.5 N"e;ahb is the number of non-hydrogen protein atoms that are closer than SA to any given protein atom.
N~e~dnb,o is a constant = 25 fP~s is a function which allows for the polar contact surface area per hydrogen bond and therefore distinguishes between strong and W eak hydrogen bonds and its value is determined according to the following criteria:
fpcs- ~ when Apolar/NHB < 10 Az or fps= 1 when Apolar/NHB > 10 Az Apoiar is the size of the polar protein-ligand contact surface NHB is the number of hydrogen bonds f3 is a constant whose value = 1.2 For the implementation of the modified Bohm scoring function, the contributions from ionic to interactions, ~G;on;~, are computed in a similar fashion to those from hydrogen bonds described above since the same geometry dependency is assumed.
The term N,;Po is calculated according to eguation 5 below:
Niipo - W Lf (rrL) f(r,~) is calculated for all lipophilic ligand atoms, l, and all lipophilic protein atoms, L, 15 according to the following criteria:
f ( r1L ) =1 when r1L <= R1 f ( r1L ) _ ( ric - R1 ) / ( R2 -R1 ) when R2 <r1L
> Rl f (r1L) =0 when rl~ >= R2 Where: R1 = rl"aW + rL"a'" + 0.5 and R2 = R1 + 3.0 2o and r,~dW is the Van der Waal's radius of atom 1 and r~°aW is the Van der Waal's radius of atom L
The term N~o~ is the number of rotable bonds of the amino acid side chain and is taken to be the number of acyclic spa - spa and spa - spz bonds. Rotations of terminal -CH3 or -NH3 are not taken into account.
25 The final term, Evdw, is calculated according to eguation 6 below:
Evaw = ~i~z ( ( rl°aW +rz~aw) iz / riz - ( r ~aW +r ~aW s s z ) / r ) , where:
E, and ~2 are constants dependant upon atom identity r,"d'" +r2"dW are the Van der Waal's atomic radii r is the distance between a pair of atoms.
30 With regard to Equation 6, in one embodiment, the constants ~~ and s2 are given the atom values: C: 0.245, N: 0.283, O: 0.316, S: 0.316, respectively (i.e. for atoms of Carbon, Nitrogen, Oxygen and Sulphur, respectively). With regards to equations 5 and 6, the Van der Waal's radii are given the atom values C: 1.85, N: 1.75, O: 1.60, S: 2.00A.
It should be understood that all predetermined values and constants given in the equations above are determined within the constraints of current understandings of protein ligand interactions with particular regard to the type of computation being undertaken herein.
Therefore, it is possible that, as this scoring function is refined further, these values and constants may change hence any suitable numerical value which gives the desired results in terms of estimating the binding energy of a protein to a ligand may be used and hence fall within the scope of the present invention.
As described above, the scoring function is applied to data extracted from the database of side-chain conformations, atom identities, and interatomic distances. For the purposes of the t0 present description, the number of MHC Class II molecules included in this database is 42 models plus four solved structures. It should be apparent from the above descriptions that the modular nature of the construction of the computational method of the present invention means that new models can simply be added and scanned with the peptide backbone library and side-chain conformational search function to create additional data sets which can be processed by the peptide scoring function as described above. This allows for the repertoire of scanned MHC Class II molecules to easily be increased, or structures and associated data to be replaced if data are available to create more accurate models of the existing alleles.
The present prediction method can be calibrated against a data set comprising a large number of peptides whose affinity for various MHC Class II molecules has previously been experimentally determined. By comparison of calculated versus experimental data, a cut of value can be determined above which it is known that all experimentally determined T-cell epitopes are correctly predicted.
It should be understood that, although the above scoring function is relatively simple compared to some sophisticated methodologies that are available, the calculations are performed extremely rapidly. It should also be understood that the objective is not to calculate the true binding energy per se for each peptide docked in the binding groove of a selected MHC Class II protein. The underlying objective is to obtain comparative binding energy data as an aid to predicting the location of T-cell epitopes based on the primary structure (i.e.
amino acid sequence) of a selected protein. A relatively high binding energy or a binding energy above a selected threshold value would suggest the presence of a T-cell epitope in the ligand. The ligand may then be subjected to at least one round of amino-acid substitution and the binding energy recalculated. Due to the rapid nature of the calculations, these manipulations of the peptide sequence can be performed interactively within the program's user interface on cost-effectively available computer hardware. Major investment in computer hardware is thus not required.
It would be apparent to one skilled in the art that other available software could be used for the same purposes. In particular, more sophisticated software which is capable of docking ligands into protein binding-sites may be used in conjunction with energy minimization. Examples of docking software are: DOCK (Kuntz et al., J. Mol. Biol., 161:269-288 (1982)), LUDI (Bohm, H.J., J. ComputAided Mol. Des., 8:623-632 (1994)) and FLEXX (Rarey M., et al., ISMB, 3:300-308 (1995)). Examples of molecular modeling and manipulation software include:
AMBER (Tripos) and CHARMm (Molecular Simulations Inc.). The use of these to computational methods would severely limit the throughput of the method of this invention due to the lengths of processing time required to make the necessary calculations. However, it is feasible that such methods could be used as a 'secondary screen' to obtain more accurate calculations of binding energy for peptides which are found to be 'positive binders' via the method of the present invention. The limitation of processing time for sophisticated molecular mechanic or molecular dynamic calculations is one which is defined both by the design of the software which makes these calculations and the current technology limitations of computer hardware. It may be anticipated that, in the future, with the writing of more efficient code and the continuing increases in speed of computer processors, it may become feasible to make such calculations within a more manageable time-frame. Further information on energy functions applied to macromolecules and consideration of the various interactions that take place within a folded protein structure can be found in: Brooks, B.R., et al., J. Comput. Chem., 4:187-217 (1983) and further information concerning general protein-ligand interactions can be found in: Dauber-Osguthorpe et al., Proteins4(1):31-47(1988), which are incorporated herein by reference in their entirety. Useful background information can also be found, for example, in Fasman, G.D., ed., Prediction of Protein Structure and the Principles of Protein Conformation, Plenum Press, New York, ISBN: 0-306 4313-9.
EXAMPLE 2: De-immunized forms of Fc-Leptin Leptin is a secreted signaling 146 amino acid residue protein involved in the homeostatic 3o mechanisms maintaining adipose mass (e.g. WO 00/40615, WO 98/28427, WO
96/05309).
The protein (and its antagonists) offers significant therapeutic potential for the treatment of diabetes, high blood pressure and cholesterol metabolism.
Fc-leptin is a fusion protein for which the serum half-life is profoundly improved compared to leptin itself (WO 0040615). However, certain forms of Fc-leptin, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection. In a Phase I clinical trial, leptin alone was found to be at least somewhat immunogenic. The invention discloses sequences identified within the leptin primary sequence that are potential T-cell epitopes by virtue of MHC class II binding potential. This disclosure specifically pertains to the human leptin moiety containing about 146 amino acid residues.
Others have provided modified leptin (US, 5,900,404; W096/05309) but these approaches 1o have been directed towards improvements in the commercial production of leptin, for example improved in vitro stability. Such teachings do not recognize the importance of T-cell epitopes to the immunogenic properties of the protein nor have been conceived to directly influence said properties in a specific and controlled way according to the scheme of the present invention. Specific Fc-leptin forms: Fcyl-leptin, Fc~y2-leptin, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Sequences to be modified in leptin are shown below:
An amino acid sequence which is part of the sequence of an immunogenically non-modified human obesity protein (1e tin and has a potential MHC class II binding activity is selected from the following group identified according to the method of the invention:
Peptide sequences in human leptin with potential human MHC class 11 binding activity.
VPIQKVQDDTKTL, QKVQDDTKTLIKT, KTLIKTIVTRIND, TLIKTIVTRINDI, KTIVTRINDISHT, TIVTRINDISHTQ, TRINDISHTQSVS, NDISHTQSVSSKQ, QSVSSKQKVTGLD, SSKQKVTGLDFIP, QKVTGLDFIPGLH, TGLDFIPGLHPIL, LDFIPGLHPILTL, DFIPGLHPILTLS, PGLHPILTLSKMD, GLHPILTLSKMDQ, HPILTLSKMDQTL, PILTLSKMDQTLA, LTLSKMDQTLAW, SKMDQTLAWQQI, QTLAWQQILTSM, LAWQQILTSMPS, AWQQILTSMPSR, QQILTSMPSRNVI, QILTSMPSRNVIQ, TSMPSRNVIQISN, SRNVIQISNDLEN, RNVIQISNDLENL, NVIQISNDLENLR, IQISNDLENLRDL, NDLENLRDLLHVL, LENLRDLLHVLAF, ENLRDLLHVLAFS, RDLLHVLAFSKSC, DLLHVLAFSKSCH, LHVLAFSKSCHLP, HVLAFSKSCHLPW, LAFSKSCHLPWAS, CHLPWASGLETLD, SGLETLDSLGGVL, DSLGGVLEASGYS, SLGGVLEASGYST, GGVLEASGYSTEV, SGYSTEWALSRL, TEWALSRLQGSL, EWALSRLQGSLQ, VALSRLQGSLQDM, SRLQGSLQDMLWQ, QGSLQDMLWQLDL, GSLQDMLWQLDLS, QDMLWQLDLSPGC
Substitutions leading to the elimination of potential T-cell epitopes of human leptin (WT =
wild type).
ResidueWT Substitutions # residue T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
110 L A C D E G H K ' P Q R S
N T
T
T
T
T
T
T
T
T
T
Any of the above-cited peptide sequences can be used for modifying by exchanging one or more amino acids to obtain a sequence having a reduced or no immunogenicity .
EXAMPLE 3: De-immunized forms of Fc-IL-1 Ra The present invention provides for modified forms of an interleukin-1 receptor antagonist (IL-1Ra) with one or more T-cell epitopes removed. IL-1 is an important inflammatory and immune modulating cytokine with pleiotropic effects on a variety of tissues but may contribute to the pathology associated with rheumatoid arthritis and other diseases associated with local tissue damage. An IL-1 receptor antagonist able to inhibit the action of IL-1 has been purified and the gene cloned [Eisenburg S.P. et al (1990) Nature, 343:
341-346; Carter, D.B. et al (1990) Nature, 344: 633-637]. Others have provided IL-1Ra molecules (e.g. US
5,075,222]. Recombinant forms of this protein have therapeutic potential in disease settings 1o where the effects of IL-1 are deleterious. However, there remains a continued need for IL-1Ra analogues with enhanced properties. Desired enhancements include alternative schemes and modalities for the expression and purification of the said therapeutic, but also and especially, improvements in the biological properties of the protein. There is a particular need for enhancement of the in vivo characteristics when administered to the human subject. In this regard, it is highly desired to provide IL-1Ra with reduced or absent potential to induce an immune response in the human subject. Such proteins would expect to display an increased circulation time within the human subject and would be of particular benefit in chronic or recurring disease settings such as is the case for a number of indications for IL-lRa. The present invention provides for modified forms of IL-1Ra proteins that are expected to display 2o enhanced properties in vivo. This disclosure specifically pertains a human IL-1Ra protein being of 152 amino acid residues (Eisenburg, S.P. et al (1991) Proc. Natl.
Acad. Sci. U.S.A.
88: 5232-5236).
Specific Fc- IL-1Ra forms: Fcyl- IL-lRa, Fcy2- IL-lRa, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human interleukin-1 receptor antagonist (IL-1RA) with potential human MHC class II binding activity.
RKSSKMQAFRIWD, SKMQAFRIWDVNQ, QAFRIWDVNQKTF, FRIWDVNQKTFYL, RIWDVNQKTFYLR, IWDVNQKTFYLRN, WDVNQKTFYLRNN, KTFYLRNNQLVAG, TFYLRNNQLVAGY, FYLRNNQLVAGYL, LRNNQLVAGYLQG, RNNQLVAGYLQGP, NQLVAGYLQGPNV, QLVAGYLQGPNVN, LVAGYLQGPNVNL, AGYLQGPNVNLEE, GYLQGPNVNLEEK, PNVNLEEKIDWP, VNLEEKIDWPIE, EKIDWPIEPHAL, IDWPIEPHALFL, DWPIEPHALFLG, VPIEPHALFLGIH, HALFLGIHGGKMC, ALFLGIHGGKMCL, LFLGIHGGKMCLS, LGIHGGKMCLSCV, GKMCLSCVKSGDE, MCLSCVKSGDETR, SCVKSGDETRLQL, ETRLQLEAVNITD, TRLQLEAVNITDL, LQLEAVNITDLSE, EAVNITDLSENRK, VNITDLSENRKQD, TDLSENRKQDKRF, ENRKQDKRFAFIR, KRFAFIRSDSGPT, FAFIRSDSGPTTS, AFIRSDSGPTTSF, TSFESAACPGWFL, SFESAACPGWFLC, PGWFLCTAMEADQ, WFLCTAMEADQPV, TAMEADQPVSLTN, QPVSLTNMPDEGV, VSLTNMPDEGVMV, TNMPDEGVMVTKF, PDEGVMVTKFYFQ, EGVMVTKFYFQED, GVMVTKFYFQEDE
Substitutions leading to the elimination of potential T-cell epitopes of human interleukin-1 receptor antagonist (IL-1 RA) ( WT = wild type).
Residue WT
# Residue Substitution M A C D E G H K N P Q R S T
I A C D E G H K N P Q R S T
L A C D E G H K N P Q R S T
L A C D E G H K N P Q R S T
L A C D E G H K N P Q R S T
V A C D E G H K N P Q R S T
EXAMPLE 4: De-immm2ized~'orms of Fc-BNDF
The present invention provides for modified forms of human brain-derived neurotrophic factor (BNDF) with one or more T-cell epitopes removed. BNDF is glycoprotein of the nerve growth factor family of proteins. The mature 119 amino acid glycoprotein is processed from a larger pre-cursor to yield a neutrophic factor that promotes the survival of neuronal cell populations [Jones K.R. & Reichardt, L.F. (1990) Proc. Natl. Acad. Sci U.S.A.
87: 8060-8064]. Others have provided modified BNDF molecules [US, 5,770,577] and approaches towards the commercial production of recombinant BNDF molecules [US, 5,986,070]. Such neuronal cells are all located either in the central nervous system or directly connected to it.
Recombinant preparations of BNDF have enabled the therapeutic potential of the protein to be explored for the promotion of nerve regeneration and degenerative disease therapy.
Specific Fc- BNDF forms: Fcyl- BNDF, Fc~y2- BNDF, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human brain-derived neutrophic factor (BDNF) with potential human MHC class II binding activity.
GELSVCDSISEWV, LSVCDSISEWVTA, DSISEWVTAADKK, SEWVTAADKKTAV, EWVTAADKKTRVD, WVTAADKKTAVDM, KTAVDMSGGTVTV, TAVDMSGGTVTVL, VDMSGGTVTVLEK, GTVTVLEKVPVSK,VTVLEKVPVSKGQ, TVLEKVPVSKGQL, EKVPVSKGQLKQY, VPVSKGQLKQYFY,GQLKQYFYETKCN, KQYFYETKCNPMG, QYFYETKCNPMGY,YFYETKCNPMGYT,NPMGYTKEGCRGI, MGYTKEGCRGIDK, RGIDKRHWNSQCR, RHWNSQCRTTQSY,HWNSQCRTTQSYV, QSYVRALTMDSKK, SYVRALTMDSKKR, RALTMDSKKRIGW,LTMDSKKRIGWRF, KRIGWRFIRIDTS, IGWRFIRIDTSCV, GWRFIRIDTSCVC, WRFIRIDTSCVCT, RFIRIDTSCVCTL, IRIDTSCVCTLTI, IDTSCVCTLTIKR
Substitutions leading to the elimination of potential T-cell epitopes of human brain-derived neutrophic factor (BDNF) (WT = wild type).
ResidueWT
Substitution # Residue ~
ResidueWT
Substitution # Residue .
EXAMPLE 5: De-immunized forms o~f Fc-EPO
The present invention provides for modified forms of human erythropioetin (EPO) with one or more T-cell epitopes removed. EPO is a 165 amino acid residues glycoprotein hormone involved in the maturation of erythroid progenitor cells into erythrocytes.
Naturally occurring EPO is produced by the liver during foetal life and by the kidney of adults and circulates in the blood to stimulate production of red blood cells in bone marrow. Anaemia is almost invariably a consequence of renal failure due to decreased production of EPO
from the kidney.
Recombinant EPO is used as an effective treatment of anaemia resulting from chronic renal failure.
Recombinant EPO (expressed in mammalian cells) having the amino acid sequence 1-165 of human erythropoietin [Jacobs, K. et al (1985) Nature, 313: 806-810; Lin, F.-K.
et al (1985) Proc. Natl. Acad. Sci. U.S.A. 82:7580-7585] contains three N-linked and one O-linked oligosaccharide chains each containing terminal sialic acid residues. The latter are significant in enabling EPO to evade rapid clearance from the circulation by the hepatic asialoglycoprotein binding protein.
Non-de-immunized Fc-EPO is known e.g. from WO 99/58662, WO 99/02709.
Specific Fc- EPO forms: Fcyl- EPO, Fc~y2- EPO, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors. The EPO may be glycosylated, partially glycosylated or has a modified glycosylation pattern.
Peptide sequences in human erythropoietin (EPO) with potential human MHC class II binding activity.
PRLICDSRVLERY, RLICDSRVLERYL, ICDSRVLERYLLE, CDSRVLERYLLEA, SRVLERYLLEAKE, RVLERYLLEAKEA, LERYLLEAKEAEN, ERYLLEAKEAENI, RYLLEAKEAENIT, YLLEAKEAENITT, LEAKEAENITTGC, KEAENITTGCAEH, ENITTGCAEHCSL, CSLNENITVPDTK, NENITVPDTKVNF, ENITVPDTKVNFY, NITVPDTKVNFYA, ITVPDTKVNFYAW, TKVNFYAWKRMEV, VNFYAWKRMEVGQ, NFYAWKRMEVGQQ, YAWKRMEVGQQAV, KRMEVGQQAVEVW, RMEVGQQAVEVWQ, MEVGQQAVEVWQG, QAVEVWQGLALLS, AVEVWQGLALLSE, VEVWQGLALLSEA, EVWQGLALLSEAV, VWQGLALLSEAVL, WQGLALLSEAVLR, QGLALLSEAVLRG, LALLSEAVLRGQA, ALLSEAVLRGQAL, LSEAVLRGQALLV, SEAVLRGQALLVN, EAVLRGQALLVNS, AVLRGQALLVNSS, QALLVNSSQPWEP, ALLVNSSQPWEPL, LLVNSSQPWEPLQ, QPWEPLQLHVDKA, EPLQLHVDKAVSG, LQLHVDKAVSGLR, LHVDKAVSGLRSL, KAVSGLRSLTTLL, SGLRSLTTLLRAL, RSLTTLLRALGAQ, SLTTLLRALGAQK, TTLLRALGAQKEA, TLLRALGAQKEAI, RALGAQKEAISPP, AQKEAISPPDAAS, EAISPPDAASAAP, SPPDAASAAPLRT, ASAAPLRTITADT, APLRTITADTFRK, RTITADTFRKLFR, TITADTFRKLFRV, DTFRKLFRVYSNF, RKLFRVYSNFLRG, KLFRVYSNFLRGK, FRVYSNFLRGKLK, RVYSNFLRGKLKL, YSNFLRGKLKLYT, SNFLRGKLKLYTG, NFLRGKLKLYTGE, RGKLKLYTGEACR, GKLKLYTGEACRT, LKLYTGEACRTGD, KLYTGEACRTGDR
Substitutions leading to the elimination of potential T-cell epitopes of human erythropoietin 2o (EPO) (WT = wild type).
ResidueWT Substitutions # residue T
T
T
T
T
T
T
I A C D E G H K N P Q R S
T
L A C D E G H K N P Q R S
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
ResidueWT
Substit utions # residue -EXAMPLE 6: De-immunized forms of G-CSF
The present invention provides for modified forms of human granulocyte colony stimulating factor (G-CSF) with one or more T-cell epitopes removed. G-CSF is an important haemopoietic cytokine currently used in treatment of indications where an increase in blood neutrophils will provide benefits. These include cancer therapy, various infectious diseases and related conditions such as sepsis. G-CSF is also used alone, or in combination with other compounds and cytokines in the ex vivo expansion of haemopoeitic cells for bone marrow transplantation.
Two forms of human G-CSF are commonly recognized for this cytokine. One is a protein of 177 amino acids, the other a protein of 174 amino acids [Nagata et al. (1986), EMBO J. 5:
575-581], the 174 amino acid form has been found to have the greatest specific in vivo biological activity. Recombinant DNA techniques have enabled the production of commercial scale quantities of G-CSF exploiting both eukaryotic and prokaryotic host cell expression systems. This disclosure specifically pertains to both recognized forms of the human G-CSF
protein being the 177 amino acid species and the 174 amino acid species.
Other polypeptide analogues and peptide fragments of G-CSF have been previously disclosed, including forms modified by site-specific amino acid substitutions and or by modification by chemical adducts. Thus US 4,810,643 discloses analogues with the particular Cys residues replaced with another amino acid, and G-CSF with an Ala residue in the first (N-terminal) position. EP 0 335 423 discloses the modification of at least one amino group in a polypeptide having G-CSF activity. EP 0 272 703 discloses G-CSF derivatives having amino acid substituted or deleted near the N-terminus. EP 0 459 630 discloses G-CSF
derivatives in which Cys 17 and Asp 27 are replaced by Ser residues. EP 0 243 153 discloses G-CSF
modified by inactivating at least one yeast KEX2 protease processing site for increased yield in recombinant production and US 4,904,584 discloses lysine altered proteins.
discloses further Cys altered variants and Australian patent document AU
10948/92 discloses the addition of amino acids to either terminus of a G-CSF molecule for the purpose of aiding in the folding of the molecule after prokaryotic expression. A further Australian document;
AU 76380/91, discloses G-CSF variants at positions 50-56 of the G-CSF 174 amino acid form, and positions 53-59 of the 177 amino acid form. Additional changes at particular His residues were also disclosed.
Non-deimmunized Fc-G-CSF is known e.g. from WO 99/58662. Specific Fc- G-CSF
forms:
Fcyl- G-CSF, Fc~y2- G-CSF, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human granulocyte colony stimulating factor (G-CSF) with potential human. MHC class II binding activity.
TPLGPASSLPQSF, SSLPQSFLLKCLE, QSFLLKCLEQVRK, SFLLKCLEQVRKI, FLLKCLEQVRKIQ, KCLEQVRKIQGDG, EQVRKIQGDGAAL, RKIQGDGAALQEK, AALQEKLVSECAT, EKLVSECATYKLC, KLVSECATYKLCH, AALQEKLCATYKL, EKLCATYKLCHPE, ATYKLCHPEELVL, YKLCHPEELVLLG,EELVLLGHSLGIP, ELVLLGHSLGIPW, HSLGIPWAPLSSC, IPWAPLSSCPSQA, APLSSCPSQALQL, QALQLAGCLSQLH, GCLSQLHSGLFLY, SQLHSGLFLYQGL, SGLFLYQGLLQAL, GLFLYQGLLQALE, LFLYQGLLQALEG, FLYQGLLQALEGI, QGLLQALEGISPE, GLLQALEGISPEL, QALEGISPELGPT, EGISPELGPTLDT, PTLDTLQLDVADF, DTLQLDVADFATT, LQLDVADFATTIW, LDVADFATTIWQQ, TTIWQQMEELGMA, TIWQQMEELGMAP, QQMEELGMAPALQ, EELGMAPALQPTQ, LGMAPALQPTQGA, PALQPTQGAMPAF, GAMPAFASAFQRR, PAFASAFQRRAGG, SAFQRRAGGVLVA, GGVLVASHLQSFL, GVLVASHLQSFLE, VLVASHLQSFLEV, SHLQSFLEVSYRV, QSFLEVSYRVLRH, SFLEVSYRVLRHL, LEVSYRVLRHLAQ
- SS -Substitutions leading to the elimination of potential T-cell epitopes of human granulocyte colony stimulating factor (G-CSF) (WT = wild type).
ResidueWT Substitution # Residue EXAMPLE 7: De-immacrzized forms of KGF
The present invention provides for modified forms of human keratinocyte growth factor (KGF) with one or more T-cell epitopes removed. KGF is a member of the fibroblast growth factor (FGF) / heparin-binding growth factor family of proteins. It is a secreted glycoprotein expressed predominantly in the lung, promoting wound healing by stimulating the growth of keratinocytes and other epithelial cells [Finch et al (1989), Science 24: 752-755; Rubin et al (1989), Proc. Natl. Acad. Sci. U.S.A. 86: 802-806]. The mature (processed) form of the glycoprotein comprises 163 amino acid residues and may be isolated from conditioned media following culture of particular cell lines [Rubin et al, (1989) ibid.), or produced using recombinant techniques [Ron et al (1993) J. Biol. Chem. 268: 2984-2988]. The protein is of therapeutic value for the stimulation of epithelial cell growth in a number of significant disease and injury repair settings. This disclosure specifically pertains the human KGF protein being the mature (processed) form of 163 amino acid residues. Others have also provided KGF molecules [e.g. US, 6,008,328; W090/08771;J including modified KGF [Ron et al (1993) ibid; W09501434] but Specific Fc- KGF forms: Fcyl- KGF, Fc~y2- KGF, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human keratinocyte growth factor (KGF) with potential human MHC
class II binding activity.
NDMTPEQMATNVN, DMTPEQMATNVNC, EQMATNVNCSSPE, TNVNCSSPERHTR, RSYDYMEGGDIRV, YDYMEGGDIRVRR, DYMEGGDIRVRRL, GDIRVRRLFCRTQ, IRVRRLFCRTQWY, RRLFCRTQWYLRI, RLFCRTQWYLRID, TQWYLRIDKRGKV, QWYLRIDKRGKVK, WYLRIDKRGKVKG, LRIDKRGKVKGTQ, GKVKGTQEMKNNY, QEMKNNYNIMEIR, NNYNIMEIRTVAV, YNIMEIRTVAVGI, NIMEIRTVAVGIV, MEIRTVAVGIVAI, RTVAVGIVAIKGV, VAVGIVAIKGVES, VGIVAIKGVESEF, VAIKGVESEFYLA, KGVESEFYLAMNK, SEFYLAMNKEGKL, EFYLAMNKEGKLY, FYLAMNKEGKLYA, LAMNKEGKLYAKK, GKLYAKKECNEDC, KLYAKKECNEDCN, CNFKELILENHYN, KELILENHYNTYA, ELILENHYNTYAS, LILENHYNTYASA, NHYNTYASAKWTH, NTYASAKWTHNGG, AKWTHNGGEMFVA, GEMFVALNQKGIP, EMFVALNQKGIPV, FVALNQKGIPVRG, VALNQKGIPVRGK, KGIPVRGKKTKKE, IPVRGKKTKKEQK, KTKKEQKTAHFLP
Substitutions leading to the elimination of potential T-cell epitopes of human keratinocyte growth factor (KGF) (WT = wild type).
ResidueWT Substitution # residue M A C D E G H K N P Q R S T
M A C D E G H K N P Q R S T
EXAMPLE 8: De-immunized sTNF-R(1) and sTNF Inhibitor within corresponding Fc ficsions 5 Fc-sTNF-R(I) and Fc-sTNF Inhibitor are fusion proteins in which the serum half-life is extended compared to sTNF-R(I) and sTNF Inhibitor itself. However, certain forms of Fc-TNF-RI, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection. The present invention provides for modified forms of a soluble tumor necrosis factor receptor type I (sTNF-RI) with one or more T-cell epitopes removed.
The sTNF-RI (soluble tumor necrosis factor receptor type I) is a derivative of the human tumor necrosis factor receptor described previously [Gray, P.W. et al (1990) Proc. Nat. Acad.
Sci. U.S.A. 87: 7380-7384; Loetschere, H. et al, (1990) Cell 61: 351-359;
Schall, T.J. et al (1990) Cell 61: 361-370], comprising the extracellular domain of the intact receptor and exhibiting an approximate molecular weight of 30KDa. Additional soluble TNF
inhibitors and in particular a 40KDa form are also known [US 6,143,866]. The soluble forms are able to bind tumor necrosis factor alpha with high affinity and inhibit the cytotoxic activity of the cytokine in vitro. Recombinant preparations of sTNF-RI are of significant therapeutic value for the treatment of diseases where an excess level of tumor necrosis factor is causing a pathogenic effect. Indications such as cachexia, sepsis and autoimmune disorders including, and in particular, rheumatoid arthritis and others may be targeted by such therapeutic ~5 preparations of sTNF-RI. Others including Brewer et al., US, 6,143,866, have provided modified sTNF-RI molecules Peptide sequences in a human 30KDa sTNF-RI with potential human MHC class II
binding activity:
DSVCPQGKYIHPQ, KYIHPQNNSICCT, NSICCTKCHKGTY, TYLYNDCPGPGQD, YLYNDCPGPGQDT, NHLRHCLSCSKCR, HCLSCSKCRKEMG, KEMGQVEISSCTV, GQVEISSCTVDRD, VEISSCTVDRDTV, CTVDRDTVCGCRK, DTVCGCRKNQYRH, NQYRHYWSENLFQ, RHYWSENLFQCFN, HYWSENLFQCFNC, ENLFQCFNCSLCL, NLFQCFNCSLCLN, QCFNCSLCLNGTV, CSLCLNGTVHLSC, LCLNGTVHLSCQE, GTVHLSCQEKQNT, VHLSCQEKQNTVC, EKQNTVCTCHAGF, NTVCTCHAGFFLR, GFFLRENECVSCS, FFLRENECVSCSN, ECVSCSNCKKSLE, KSLECTKLCLPQI, TKLCLPQIENVKG, LCLPQIENVKGTE, PQIENVKGTEDSG, SGTTVLLPLVIFF
Peptide sequences in a human 40KDa sTNF inhibitor with potential human MHC
class II
binding activity.
TPYAPEPGSTCRL, CRLREYYDQTAQM, REYYDQTAQMCCS, EYYDQTAQMCCSK, AQMCCSKCSPGQH, KCSPGQHAKVFCT, AKVFCTKTSDTVC, KVFCTKTSDTVCD, STYTQLWNWVPEC, TQLWNWVPECLSC, QLWNWVPECLSCG, NWPECLSCGSRC, ECLSCGSRCSSDQ, SRCSSDQEVTQAC, QEVTQACTREQNR, QNRICTCRPGWYC, NRICTCRPGWCA, PGWYCALSKQEGC, GWCALSKQEGCR, CALSKQEGCRLCA, APLRKCRPGFGVA, PGFGVARPGTETS, FGVARPGTETSDV, SDWCKPCAPGTF, GTFSNTTSSTDIC, TDICRPHQICNW, HQICNWAIPGNA, ICNWAIPGNASR, CNWAIPGNASRD, NWAIPGNASRDA, VAIPGNASRDAVC, DAVCTSTTTPTRS, _ 59 _ TRSMAPGAVHLPQ, RSMAPGAVHLPQP, VHLPQPVSTRSQH, QPVSTRSQHTQPT, PEPSTAPSTSFLL, SFLLPMGPSPPAE, FLLPMGPSPPAEG
EXAMPLE 9 (soluble TNF-R2):
Fc-sTNF-R2 is a fusion proteins in which the serum half-life is extended compared to sTNF-R2 itself. However, certain forms of Fc-TNF-R2, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection.
Soluble tumor necrosis factor receptor 2 (sTNF-R2) is a derivative of the human tumor necrosis factor receptor 2 described previously [Smith, C.A. et al (1990) Science 248: 1019-1023; Kohno, T. et al (1990) Proc. Nat. Acad. Sci. U.S.A. 87: 8331-8335;
Beltinger, C.P. et al (1996) Genomics 35:94-100] comprising the extracellular domain of the intact receptor. The soluble forms are able to bind tumour necrosis factor with high affinity and inhibit the cytotoxic activity of the cytokine in vitro. Recombinant preparations of sTNF-R2 are of significant therapeutic value for the treatment of diseases where an excess level of tumour necrosis factor is causing a pathogenic effect. A particular recombinant preparation termed ethanercept has gained clinical approval for the treatment of rheumatoid arthritis and this and other similar agents may be of value in the treatment of other indications such as cachexia, sepsis and autoimmune disorders. Ethanercept is a dimeric fusion protein comprising the 2o extracellular domain of the human TNFR2 molecule in combination with the Fc domain of the human IgGI molecule. The dimeric molecule comprises 934 amino acids [US,5,395,760;
US,5,605,690; US,5,945,397].
Peptide sequences in the TNF binding domain of the human TNFR2 protein with potential human MHC class II binding activity are:
TPYAPEPGSTCRL,CRLREYYDQTAQM,REYYDQTAQMCCS,EYYDQTAQMCCSK, AQMCCSKCSPGQH, KCSPGQHAKVFCT,AKVFCTKTSDTVC,KVFCTKTSDTVCD, STYTQLWNWVPEC, TQLWNWVPECLSC,QLWNWVPECLSCG,NWPECLSCGSRC, ECLSCGSRCSSDQ, SRCSSDQEVTQAC,QEVTQACTREQNR,QNRICTCRPGWC, NRICTCRPGWYCA, PGWCALSKQEGC,GWYCALSKQEGCR,CALSKQEGCRLCA, APLRKCRPGFGVA,PGFGVARPGTETS,FGVARPGTETSDV,SDWCKPCAPGTF, GTFSNTTSSTDIC, TDICRPHQICNW,HQICNWAIPGNA, ICNWAIPGNASR, CNWAIPGNASRD, NWAIPGNASRDA,VAIPGNASRDAVC,DAVCTSTTTPTRS, TRSMAPGAVHLPQ, RSMAPGAVHLPQP,VHLPQPVSTRSQH,QPVSTRSQHTQPT, PEPSTAPSTSFLL, SFLLPMGPSPPAE,FLLPMGPSPPAEG
EXAMPLE 10: non-natural orms of Beta-Glucocerebrosidase (/3-GCR) Fc - a-GCR is a fusion proteins in which the serum half-life is extended compared to the a-GCR itself. However, certain forms of Fc - ~i-GCR, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection. The present invention provides for modified forms of human GCR, preferably Fc-f3-GCR, with one or more T-cell epitopes removed.
Beta-Glucocerebrosidase (b-D-glucosyl-N-acylsphingosine glucohydrolase, E.C.
3.2.1.45) is a monomeric glycoprotein of 497 amino acid residues. The enzyme catalyses the hydrolysis of to the glycolipid glucocerebroside to glucose and ceramide. Deficiency in GCR
activity results in a lysosomal storage disease referred to as Gaucher disease. The disease is characterised by the accumulation of glucocerebroside engorged tissue macrophages that accumulate in the liver, spleen, bone marrow and other organs. The disease has varying degrees of severity from type 1 disease with haematologic problems but no neuronal involvement, to type 2 disease manifesting early after birth with extensive neuronal involvement and is universally progressive and fatal within 2 years of age. Type 3 disease is also recognised in some classifications and also shows neurologic involvement. Previously the only useful therapy for Gaucher disease has been administration of GCR derived from human placenta (known as alglucerase) but more recently pharmaceutical preparations of recombinant GCR
("Ceredase"
and "Cerezyme") have shown efficacy in the treatment of type I disease [Niederau, C. et al (1998) Eur. J. Med. Res. 3: 25-30].
According to the invention, the particular commercial forms of glucocerebrosidase are examined at predicted to be particularly immunogenic because these forms are engineered to have a high mannose oligosaccharide. Upon administration of such a protein, such as Ceredase or Cerezyme, the non-natural protein is preferentially bound by mannose receptors on antigen-presenting cells such as macrophages or dendritic cells. The non-natural protein is then taken up, a portion is degraded into peptides, and the peptides presented through MHC
Class II to the T-cell receptor. By mutating the glucocerebrosidase sequence such that derived peptides cannot bind to MHC Class II, immunogenicity is reduced.
Others have provided GCR molecules including modified GCR [US,5,236,838 ] but this teaching does not recognize the importance of T-cell epitopes to the immunogenic properties of the protein.
Peptide sequences in human f3-GCR with potential human MHC class II binding activity are:
PCIPKSFGYSSW,KSFGYSSWCVCN,FGYSSVVCVCNAT,SSWCVCNATYCD,SWCVCNATYCDS, VCVCNATYCDSFD,ATYCDSFDPPTFP,DSFDPPTFPALGT,PTFPALGTFSRYE,PALGTFSRYESTR, GTFSRYESTRSGR,SRYESTRSGRRME,GRRMELSMGPIQA,RRMELSMGPIQAN,RMELSMGPIQANH, MELSMGPIQANHT,LSMGPIQANHTGT,MGPIQANHTGTGL,GPIQANHTGTGLL,TGLLLTLQPEQKF, GLLLTLQPEQKFQ,LLLTLQPEQKFQK,LTLQPEQKFQKVK,TLQPEQKFQKVKG,PEQKFQKVKGFGG, QKFQKVKGFGGAM,QKVKGFGGAMTDA,KGFGGAMTDAAAL,GFGGAMTDAAALN,GAMTDAAALNILA, AMTDAAALNILAL,MTDAAALNILALS,AALNILALSPPAQ,ALNILALSPPAQN,LNILALSPPAQNL, NILALSPPAQNLL,LALSPPAQNLLLK,ALSPPAQNLLLKS,PAQNLLLKSYFSE,AQNLLLKSYFSEE, LOQNLLLKSYFSEEG,NLLLKSYFSEEGI,LLLKSYFSEEGIG,KSYFSEEGIGYNI,SYFSEEGIGYNII, FSEEGIGYNIIRV,EGIGYNIIRVPMA,GIGYNIIRVPMAS,IGYNIIRVPMASC,YNIIRVPMASCDF, NIIRVPMASCDFS,IIRVPMASCDFSI,IRVPMASCDFSIR,VPMASCDFSIRTY,PMASCDFSIRTYT, SCDFSIRTYTYAD,CDFSIRTYTYADT,FSIRTYTYADTPD,RTYTYADTPDDFQ,TYTYADTPDDFQL, YTYADTPDDFQLH,ADTPDDFQLHNFS,PDDFQLHNFSLPE,DDFQLHNFSLPEE,FQLHNFSLPEEDT, 15HNFSLPEEDTKLK,FSLPEEDTKLKIP,SLPEEDTKLKIPL,EEDTKLKIPLIHR,TKLKIPLIHRALQ, KLKIPLIHRALQL,LKIPLIHRALQLA,IPLIHRALQLAQR,PLIHRALQLAQRP,HRALQLAQRPVSL, RALQLAQRPVSLL,ALQLAQRPVSLLA,LQLAQRPVSLLAS,RPVSLLASPWTSP,PVSLLASPWTSPT, VSLLASPWTSPTW,SLLASPWTSPTWL,SPWTSPTWLKTNG,TSPTWLKTNGAVN,PTWLKTNGAVNGK, TWLKTNGAVNGKG,GAWGKGSLKGQP,GSLKGQPGDIYHQ,GDIYHQTWARYFV,DIYHQTWARYFVK, 20QTWARYFVKFLDA,WARYFVKFLDAYA,ARYFVKFLDAYAE,RYFVKFLDAYAEH,YFVKFLDAYAEHK, FVKFLDAYAEHKL,VKFLDAYAEHKLQ,KFLDAYAEHKLQF,DAYAEHKLQFWAV,YAEHKLQFWAVTA, HKLQFWAVTAENE,LQFWAVTAENEPS,QFWAVTAENEPSA,FWAVTAENEPSAG,WAVTAENEPSAGL, VTAENEPSAGLLS,PSAGLLSGYPFQC,AGLLSGYPFQCLG,GLLSGYPFQCLGF,SGYPFQCLGFTPE, YPFQCLGFTPEHQ,QCLGFTPEHQRDF,LGFTPEHQRDFIA,FTPEHQRDFIARD,RDFIARDLGPTLA, 25DFIARDLGPTLAN,RDLGPTLANSTHH,LGPTLANSTHHNV,PTLANSTHHNVRL,HNVRLLMLDDQRL, VRLLMLDDQRLLL,RLLMLDDQRLLLP,LLMLDDQRLLLPH,LMLDDQRLLLPHW,DDQRLLLPHWAKV, DQRLLLPHWAKW,QRLLLPHWAKVVL,RLLLPHWAKVVLT,LLLPHWAKVVLTD,PHWAKWLTDPEA, WAKWLTDPEAAK,AKWLTDPEAAKY,KWLTDPEAAKW, WLTDPEAAKYVH,EAAKYVHGIAVHW, AKWHGIAVHWL, KYVHGIAVHWYLD,YVHGIAVHWLDF,HGIAVHWLDFLA,IAVHWLDFLAPA, 30VHWLDFLAPAKA,HWYLDFLAPAKAT,WYLDFLAPAKATL,LDFLAPAKATLGE,DFLAPAKATLGET, AKATLGETHRLFP,ATLGETHRLFPNT,GETHRLFPNTMLF,ETHRLFPNTMLFA,THRLFPNTMLFAS, HRLFPNTMLFASE,RLFPNTMLFASEA,FPNTMLFASEACV,NTMLFASEACVGS,TMLFASEACVGSK, MLFASEACVGSKF,ACVGSKFWEQSVR,GSKFWEQSVRLGS,SKFWEQSVRLGSW,KFWEQSVRLGSWD, QSVRLGSWDRGMQ,VRLGSWDRGMQYS,RLGSWDRGMQYSH,GSWDRGMQYSHSI,WDRGMQYSHSIIT, 35RGMQYSHSIITNL,MQYSHSIITNLLY,QYSHSIITNLLYH,YSHSIITNLLYHV,HSIITNLLYHWG, SIITNLLYHWGW,TNLLYHWGWTDW,NLLYHWGWTDWN,LLYHWGWTDWNL,YHWGWTDWNLAL, HWGWTDWNLALN,WGWTDWNLALNP,VGWTDWNLALNPE,TDWNLALNPEGGP,WNLALNPEGGPNW, LALNPEGGPNWR,PNWRNFVDSPII,NWRNFVDSPIIV,RNFVDSPIIVDIT,NFVDSPIIVDITK, SPIIVDITKDTFY,PIIVDITKDTFYK,IIVDITKDTFYKQ,VDITKDTFYKQPM,DTFYKQPMFYHLG, 40TFYKQPMFYHLGH,QPMFYHLGHFSKF,PMFYHLGHFSKFI,MFYHLGHFSKFIP,YHLGHFSKFIPEG, GHFSKFIPEGSQR, SKFIPEGSQRVGL, KFIPEGSQRVGLV, IPEGSQRVGLVAS, QRVGLVASQKNDL, VGLVASQKNDLDA, GLVASQKNDLDAV, SQKNDLDAVALMH, NDLDAVALMHPDG, DAVALMHPDGSAV, VALMHPDGSAVW, ALMHPDGSAVVW, SAVVVVLNRSSKD, AVVWLNRSSKDV, VVVVLNRSSKDVP, VVVLNRSSKDVPL, VVLNRSSKDVPLT, KDVPLTIKDPAVG, VPLTIKDPAVGFL, PLTIKDPAVGFLE, LTIKDPAVGFLET, PAVGFLETISPGY, VGFLETISPGYSI, GFLETISPGYSIH, FLETISPGYSIHT, ETISPGYSIHTYL, PGYSIHTYLWHRQ, PGYSIHTYLWRRQ
EXAMPLE 11: De-immacnized forms o Fc-IL2 Non-deimmunized Fc-IL2 was described e.g. in WO 96/08570. Specific de-immunized Fc-1o IL2 forms: Fcyl- II? , Fcy2- IL,2 , both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 12: De-immccnized forms Fc-IL12 Non-deimmunized Fc- IL12 was described e.g. in WO 99/29732. Specific de-immunized Fc-IL12 forms: Fcyl- IL.12 , Fcy2- IL12, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 13: De-immccnized forms of Fc-TNFa Non-deimmunized Fc- TNFa was described e.g. in WO 99/43713. Specific de-immunized Fc-TNFa forms: Fc~yl- TNFa , Fc~y2- TNFa , both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
SAMPLE 14: De-immccnized forms of Fc-GM-CSF
Non-deimmunized Fc- GM-CSF was described e.g. in WO 99/43713 and WO 01/07081.
Specific de-immunized Fc- GM-CSF forms: Fc~yl- GM-CSF , Fcy2- GM-CSF , both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 15: De-immccnized forms of Fc-subtilisin Specific de-immunized Fc- subtilisin forms: Fc~yl- subtilisin , Fc~y2-subtilisin, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 16: De-immuni .zed forms of Fc-instcli.n Specific de-immunized Fc- insulin forms: Fcyl- insulin , Fcy2- insulin, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 17: De-immunized forms of Fc-PSMA
Non-deimmunized Fc- PSMA was described e.g. in WO 96/08570 and WO 01/0708.
Specific de-immunized Fc- PSMA forms: Fcyl- PSMA , Fcy2- PSMA, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
io EXAMPLE 18:
De-immunized fusion proteins comprising anti-EGFR antibodies fused to a cytokine Humanized and murine monoclonal antibody 425 (hMAb 425, US 5,558,864; EP 0531 472), murine and chimeric monoclonal antibody 225 (cMAb 225, US 4,943,533 and EP
0359 282) and murine and humanized MAb 4D5 (hMab 4D5 = Herceptin~) have been de-immunized according to the invention and fused to a de-immunized IL2 or a non-modified IL-2.
Fusions of antibodies to cytokines represent a situation where the need to reduce immunogenicity is particularly great. Normally, therapeutic antibodies can induce anti-idiotype antibodies that neutralize the effectiveness of a therapeutic antibody. This is particularly true when a therapeutic antibody is administered at low or medium levels, as opposed to very high levels where tolerance can be induced. For example, the therapeutic antibodies Herceptin and Rituxan are generally given in high doses of a few hundred milligrams. In contrast, antibody-cytokine fusions are generally given in a lower dose on the order of a few milligrams. Thus, the dose of an antibody-cytokine fusion is in the range that tends to promote formation of anti-idiotype antibodies. The presence of the linked cytokine tends to exaggerate the immunogenicity of the already immunogenic antibodies.
Antibody 425 is a non-human antibody which is directed to antigen EGF-R and reacts with colon cancer cells. This antibody has been fused to IL-2, as described in Example 13. The presence of IL-2 or another cytokine enhances the immunogenicity of the antibody, in particular the V regions.
In the following paragraphs the invention is described in more detail for the monoclonal anti-EGFR antibody 425- IL2 construct which was shown to have a high therapeutic value.
However, the invention is not limited to this antibody and said construct and its several existing forms, but can be extended to other anti-EGFR antibodies and their fusion constructs, preferably cytokine fusion immunoglobulins, above all chimeric antibody 225 (c225 - Il-2), which has very similar properties. In prinicipal, non-human, chimeric or humanized versions of the anti-EGFR antibodies can be used to synthesize said IL-2 fusion molecules Unless stated otherwise all amino acids in the variable heavy and light chains are numbered as in Kabat et al, 1991 (Sequences of Proteins of Immunological Interest, US
Department of Health and Human Services). Potential T-cell epitopes are numbered with the linear number of the first amino acid of an epitope, counting from the first amino acid of the heavy and light chains.
1. Comparison with Mouse Subgroup Frameworks The amino acid sequences of murine 425 VH (heavy chain) and VK (light chain) were compared to consensus sequences for the Kabat murine heavy and light chain subgroups. 425 VH can be assigned to mouse heavy chains subgroup IIB. The comparison with the consensus sequence for this subgroup shows that the serine at position 94 in 425 VH is unusual. The most common residue at this position is arginine. 425 VK can be assigned to mouse kappa chains subgroup Vl. The comparison with the consensus sequence for this subgroup shows that the residues at positions 45-47, 60 and 100 in 425 VK are unusual for this subgroup.
Amino acid residue numbering is as per Kabat.
2. Comparison with Human Frameworks The amino acid sequences of murine 425 VH (variable heavy chain) and VK
(variable kappa light chain) were compared to the sequences of the directory of human germline VH
(Tomlinson, LM et al., (1992) J. Mol.Biol. 227: 776-798) and VK (Cox, J.P.L.
et al., (1994) Eur. J. Immunol. 24:827-836) sequences and also to human germline J region sequences (Routledge, E.G. et al., in, Protein Engineering of Antibody Molecules for Prophylactic and Therapeutic Applications in Man, Clark, M. ed. Academic Titles, Nottingham, UK, ppl3-44, 1991). The murine 425 sequence of the heavy and light chain can be taken, for example, from EP 0531 472.
The reference human framework selected for 425 VH was VH1GRR with human JH6.
The sequence of VH1GRR in the directory ends at residue 88. Therefore there is no corresponding residue for the unusual serine at position 94 of the murine sequence. This germline sequence has been found in a rearranged mature antibody gene with 4 amino acid changes.
The reference human framework selected for 425 VK was L6/vg with human JK2. This germline sequence has been found in a rearranged mature antibody heavy chain with no amino acid changes.
3. Design of "veneered" sequences Following identification of the reference human framework sequences, certain non-identical amino acid residues within the 425 VH and VK frameworks were changed to the corresponding amino acid in the human reference framework sequence. Residues which are considered to be critical for antibody structure and binding were excluded from this process and not altered: The murine residues that were retained at this stage are largely non-surface, buried residues, apart from residues at the N-terminus for instance, which are close to the CDRs in the final antibody (1 - 8, preferably 1 - 5 amino acid residues). This process produces a sequence that is broadly similar to a "veneered" antibody as the surface residues are mainly to human and the buried residues are as in the original murine sequence.
4. Peptide Threading Analysis The murine and veneered 425 VH and VK sequences were analyzed using the method according of the invention. The amino acid sequences are divided into all possible l3mers.
The lamer peptides are sequentially presented to the models of the binding groove of the HLA-DR allotypes and a binding score assigned to each peptide for each allele.
A
conformational score is calculated for each pocket-bound side chain of the peptide. This score is based on stetic overlap, potential hydrogen bonds between peptide and residues in the binding groove, electrostatic interactions and favorable contacts between peptide and pocket residues. The conformation of each side chain is then altered and the score recalculated.
Having determined the highest conformational score, the binding score is then calculated based on the groove-bound hydrophobic residues, the non-groove hydrophilic residues and the number of residues that fit into the binding groove. Peptides which are known binders to human MHC Class II achieve a high binding score with almost no false negatives. Thus peptides that achieve a significant binding score in the current analysis are considered to be potential T-cell epitopes. The results of the peptide threading analysis are shown in Table 1 for 425 VH and 425 VK. Potential T Cell epitopes are referred to by the linear number of the first residue of the lamer.
Table 1: Potential T-cell epitopes in murine and veneered 425 sequences Sequence Number of potentialNumber of first residue of lamer with number of T-cell epitopesbonding alleles in brackets Murine 425 8 31(7), 35(17), 43(7), 46(8), 58(10), VH 62(12), 81(11), 84(16) Veneered 425 7 31(7), 43(7), 46(8), 58(10), 62(11), VH 81(11), 84(16) Sequence Number of potentialNumber of first residue of lamer with number of T-cell epitopesbonding alleles in brackets Murine 425 9 1(8), 2(5), 17(5), 27(5), 43(16), VK 72(18), 75(10), 92(10), 93(17) Veneered 425 4 27(5), 43(16), 92(8), 93(17) VK
5. Removal of Potential T Cell Epitopes The numbering of amino acid residues for substitution is as per Kabat.
Potential T Cell epitopes are referred to by the linear number of the first residue of the lamer.
The amino acid substitutions required to remove the potential T-cell epitopes from the veneered 425 heavy chain variable region were as follows:
~ Substitution of proline for alanine at residue 41 (Kabat number 41) removes the potential epitope at residue number 31.
~ Substitution of proline for leucine at residue 45 (Kabat number 45) removes the potential epitope at residue number 43. A proline at position 45 is found in a human germline VH sequence, DP52.
~ Substitution of alanine for isoleucine at residue 48 (Kabat number 48) removes the potential epitope at residue number 46.
~ Substitution of valine for alanine at residue 68 (Kabat number 67) removes the potential epitope at residue number 58.
~ Substitution of isoleucine for leucine at residue 70 (Kabat number 69) removes the potential epitope at residue number 62.
~ Substitution of threonine for serine at residue 91 (Kabat number 87) removes the potential epitopes at residue numbers 81 and 84.
2o The amino acid substitutions required to remove the potential T-cell epitopes from the veneered 425 light chain variable region were as follows:
~ Substitution of histidine for tyrosine at residue 35 (Kabat number 36) removes the potential epitope at residue number 27 ~ Substitution of alanine for threonine at residue SO (Kabat number 51) removes the potential epitope at residue number 43. This residue is within CDR2. Alanine is commonly found at this position in both human and murine antibodies. An alternative substitution to eliminate this epitope is alanine for leucine at position 45 (Kabat number 46). There is no conservative substitution that will eliminate the potential epitope. Alanine is found at this position in some antibodies.
~ Substitution of proline for isoleucine at residue 94 (Kabat number 95) removes the potential epitope at residue number 92. Kabat residue 95 is within CDRL3.
Proline is common at this position in mouse antibody sequences and there is no change outwith the CDR that eliminates the potential epitope.
~ Substitution of valine for leucine at residue 103 (Kabat number 104) removes the potential epitope at residue number 93.
6. Design of de-immur2ized Sequences 1o De-immunized heavy and light chain variable region sequences were designed with reference to the changes required to remove potential T-cell epitopes and consideration of framework residues that might be critical for antibody structure and binding. In addition to the De-immunized sequences based on the veneered sequence. an additional sequence was designed for each of VH and VK based on the murine sequence, termed the Mouse Peptide Threaded (Mo PT) version. For this version, changes were made directly to the murine sequence in order to eliminate T-cell epitopes, but only changes out with the CDRs that are not considered to be detrimental to binding are made. No attempt to remove surface (B-cell) epitopes has been made in this version of the de-immunized sequence.
The primary de-immunized VH includes substitutions 1 to 6 in Section 5 above and includes 2o no potential T-cell epitopes. A further 4 de-immunized VH sequences were designed in order to test the effect of the various substitutions required on antibody binding.
The cumulative alterations made to the primary de-immunized sequence (425 VH1GRR-VH-vl) and the potential T-cell epitopes remaining are detailed in Table 2. The mouse threaded version is included for comparison.
Table 2: Amino acid changes and potential epitopes in de-immunized 425 VH
Variant Cumulative Residue Potential T Cell Epitopes Changes 425 VH1GRR-VH-vl None None 425 VH1GRR-VH-v2 48A ~ I 46(8) 425 VH1GRR-VH-v3 45P ~ L 43(7), 46(8) 425 VH1GRR-VH-v4 67V ~ A, 69I ~ L 43(7). 46(8), 58(10), 62(11) 425 VH1GRR-VH-v5 41P ~ A 31(7), 43(7), 46(8), 58(10), 62(11) 425 VH-MoPT NA 43(7), 46(8) The primary de-immunized VK includes substitutions 1 to 4 in Section 5 above and includes no potential T-cell epitopes. A further 4 de-immunized VK sequences were designed in order to test the effect of the various substitutions required on antibody binding.
Version 2 is an alternative to Version 1 in which an alternative substitution has been used to remove the same potential T-cell epitope. The cumulative alterations made to the primary de-immunized sequence (425 L6-vg-VK-vl) and the potential T-cell epitopes remaining are detailed in Table 3. The mouse threaded version is included for comparison.
Table 3: Amino acid changes and potential epitopes in de-immunized 425 VK
Variant Cumulative Residue Changes Potential T-cell Epitopes 425 L6-vg-VK-vl None None 425 L6-vg-VK-vl 51 A ~ T, 46L ~ A None 425 L6-vg-VK-vl 46 A ~ L 43(16) 425 L6-vg-VK-vl 95 P ~ I 43(16), 92(8) 425 L6-vg-VK-vl 36 H ~ Y 27(5), 43(16), 92(8) 425VK-MoPT NA 27(5), 43(16), 92(8) Table 4: original and "veneered" sequences of VH and VK of murine MAb 425 425 VH mouse QVQLQQPGAELVKPGASVKLSCKASGYTFTSHWMHWVKQRAGQGLEWIGEFNPSNGRTNYNEKFKSKAT
LTVDKSSSTAYMQLSSLTSEDSAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 VK mouse IS QIVLTQSPAIMSASPGEKVTMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTS
YSLTISRMEAEDAATYYCQQWSSHIFTFGSGTKLEIK
425 VH veneered:
QVQLVQSGAELVKPGRSVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYNEKFKSRAT
LTVDKSTSTAYMQLSSLTSEDSAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 VK veneered:
QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKLEIK
Table S: De-immunized sequences of variable heavy and light chain of MAb 425 425 de-immtcnized VHI
QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWAGEFNPSNGRTNYNEKFKSRVT
ITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYTiJGQGTTLTVSS
425 de-immunized VK1 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDASNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK
425 de-immunized VH2 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWIGEFNPSNGRTNYNEKFKSRVT
ITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VK2 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRALIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK
425 de-immunized VH3 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYNEKFKSRVT
ITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VK3 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK
425 de-immunized VH4 QVQLVQSGAELVKPGASVKLSCKASGYTFTSH4iiMHWVKQAPGQGLEWIGEFNPSNGRTNYNEKFKSRAT
LTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VK4 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK
425 de-immunized VHS
QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYNEKFKSRAT
LTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VKS
QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK
425 VH mouse, peptide threaded (Mo PT) QVQLQQPGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYNEKFKSRVT
ITVDKSSSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 VK mouse, peptide threaded (Mo PT) QIVLTQSPATLSASPGEKATMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTS
YSLTISRLEAEDAATYYCQQWSSHIFTFGQGTKVEIK
As already mentioned, the modified anti-EGFR antibody - cytokine constructs according to the invention, preferably MAb 425 - I12, can be used in pharmaceutical compositions and pharmaceutical kits preferably for the treatment of cancer. "Cancer" and "tumor" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. By means of the pharmaceutical compositions according of the present invention tumors can be treated such as tumors of the breast, heart, lung, small intestine, colon, spleen, kidney, bladder, head and neck, ovary, prostate, brain, pancreas, skin, bone, bone marrow, blood, thymus, uterus, testicles, cervix, and liver.
In analogy to antibody 425 similar fusion constructs can be obtained using monoclaonal antibody 225 in murine, chimeric or humanized forms.
EXAMPLE 19: De-immasnized forms of 14.18 antibody - IL2 and KS- 1/4 - IL2 .
to The cytokine interleukin 2 (IL-2) has been fused to specific monoclonal antibodies KS-1/4 and ch 14.18 directed to the tumor associated antigens epithelial cell adhesion molecule (Ep-CAM, KSA, KS 1/4 antigen) and the disialoganglioside GD, respectively, to form the fusion proteins ch14.18-IL-2 and KS1/4-IL-2, respectively, (US 5,650,150, EP 0 338 767).
Theses antibodies have been de-immunized according to the invention and fused to a immunogenicly modified IL2 or a non-modified IL-2.
Anti-EpCAM antibody KS 1/4 The monoclonal antibody KS 1/4 is a murine antibody that specifically binds to the 40,000 dalton cell surface antigen EpCAM (epithelial cell adhesion molecule) found in high density on adenocarcinoma cells and also found at much lower levels on certain normal epithelial 2o cells. This antibody has been shown to be effective for the detection of disease.
A variety of fusions of KS-1/4 to single and combined cytokines such as IL-2 and IL-12, have been described (W098/25978, WO01/58957A, and WO 01/10912). These fusion proteins are effective in animal models of cancer. However, due to the presence of cytokines, these fusion proteins are particularly immunogenic. There is a need for altered KS antibody molecules with a reduced propensity to elicit an immune response on administration to the human host.
Modified sequences in Mab KS 1/4 providing a modified KS antibody according to the invention are shown below. A mutated form of the KS-1/4 in which the T-cell epitopes in the V regions were completely removed by mutation, as defined by the criteria given above in the section on computer algorithms, was efficiently expressed in mammalian cells and bound to the EpCAM antigen with only about an 8-fold reduction of affinity. This molecule was termed VHvI/VKvI. A second antibody, VHv2/VKvI, had only about a 3-fold reduction in affinity and differed from VHvI/VKvI by a single amino acid substitution.
These two antibodies have been expressed in mammalian cells as KS-IL2 fusion proteins.
The KS(VHvI/VKvI)-IL2 and KS(VHv2/VKvI) are the most preferred embodiments of the invention with respect to treatment of a broad spectrum of human cancers by immune therapy.
1 Comparison with Mouse Subgroup Frameworks The amino acid sequences of murine KS VH and VK were compared to consensus sequences for the Kabat murine heavy and light chain subgroups (Kabat et al., 1991).
Murine KS VH
cannot be assigned to any one Subgroup, but is closest to Subgroup II(A) and V(A). Unusual residues are found at position 2 which is normally valine, 46 which is normally glutamic acid, and 68 which is normally threonine. Residue 69 is more commonly leucine or iso-leucine. At 82b, serine is most often found. Murine KS VK can be assigned to Sub~rou~ VI ( ' Figure 2).
1o Unusual residues are found at 46 and 47 which are commonly both leucine.
Residue 58 is unusual with either leucine or valine normally found at this position.
2 Comparison with Human Frameworks The amino acid sequences of murine KS VH and VK were compared to the sequences of the directory of human germline VH (Tomlinson et al., 1992) and VK (COX et al.
1994) sequences and also to human germline J region sequences (Routledge et al., 1993). The reference human framework selected for KS VH was DP10 with human JH6. This germline sequence has been found in a rearranged mature antibody gene with no amino acid changes.
The reference human framework selected for KS VK was B 1. For framework- 2 the sequence of the mature human antibody >ZVVIEV was used (in Kabat et al 1991). This sequence is identical to the murine sequence immediately adjacent to CDR2. The J region sequence was human JK4. This germline sequence has not been found as rearranged mature antibody light chain.
3 Design of Veneered Sequences Following identification of the reference human framework sequences, certain non-identical amino acid residues within the 425 VH and VK frameworks were changed to the corresponding amino acid in the human reference sequence. Residues which are considered to be critical for antibody structure and bindin2 were excluded from this process and not altered.
The murine residues that were retained at this stage are largely non-surface, buried residues, apart from residues at the N-terminus for instance, which are close to the CDRs in the final antibody. This process produces a sequence that is broadly similar to a "veneered" antibody as the surface residues are mainly human and the buried residues are as in the original murine sequence.
4 Peptide Threading Analysis The murine and veneered KS VH and VK sequences were analyzed using the method according to the invention. The amino acid sequences are divided into all possible l3imers.
The 13-mer peptides are sequentially presented to the models of the binding groove of the HLA-DR allotypes and a binding score assigned to each peptide for each allele.
A
conformational score is calculated for each pocket-bound side chain of the peptide. This score is based on steric overlap, potential hydrogen bonds between peptide and residues in the binding groove, electrostatic interactions and favorable contacts between peptide and pocket residues. The conformation of each side chain is then altered and the score recalculated.
Having determined the highest conformational score, the binding score is then calculated 1o based on the (groove-bound hydrophobic residues, the non-groove hydrophilic residues and the number of residues that fit into the binding groove. Known binders to MHC
class II
achieve a significant binding score with almost no false negatives. Thus peptides achieving, a significant binding score from the current analysis are considered to be potential T-cell epitopes. The results of the peptide threading analysis for the murine and veneered sequences are shown in Table 1.
Table 1: Potential T-cell epitopes in murine and veneered KS sequences Sequence Number of potentialLocation of potential epitopes T- (no. of potential cell epitopes MHC binders) Murine KS VH 6 35(11), 62(17), 78(12), 81(12), 89(6), 98(15) Murine KS VH 5 30(7), 62(15), 78(11), 89(6), 98(15) Murine KS VK 6 1(14), 2(5), 17(5), 27(5), 51(13), 72(18) Veneered KS VK 3 1(17), 27(5), 51(13) S Removal of Potential T Cell Epitopes Potential T-cell epitopes are removed by making amino acid substitutions in the particular peptide that constitutes the epitope. Substitutions were made by inserting amino acids of similar physicochemical properties if possible. However in order to remove some potential epitopes, amino acids of different size, charge or hydrophobicity may need to be substituted. if changes have to made within CDRs which might have an effect on binding, there is then a need to make a variant with and without the particular amino acid substitution. Numbering of amino acid residues for substitution is as per Kabat. Potential T Cell epitopes are referred to by the linear number of the first residue of the lamer.
The amino acid changes required to remove T-cell epitopes from the veneered KS
heavy chain variable region were as follows: -1. Substitution of arginine for lysine at residue 38 (Kabat number 38) removes the potential epitope at residue no 30.
2. Substitution of alanine for leucine at residue 72 (Kabat number 71) and isoleucine for phenylalanine at residue 70 (Kabat number 69) removes the potential epitope at residue 62. An isoleucine at Kabat number 69 and alanine at Kabat number 71 is found in a human germline VH sequence, DP10.
3. Substitution of leucine for alanine at residue 79 (Kabat number 78) removes the t0 potential epitope at residue number 78.
4. Substitution of threonine for methionine at residue 91 (Kabat number 87), removes the potential epitope at residue number 89.
5. Substitution of methionine for at isoleucine residue 100 (Kabat number 96) in CDRH3 removes the potential epitope at residue 98. There is no change out with CDRH3 which removes this potential epitope.
The amino acid substitutions required to remove the potential T-cell epitopes from the veneered KS light chain variable region were as follows:
1 . Substitution of isoleucine for methionine at residue 32 (Kabat number 33) removes the potential epitope at residue number 27. This residue is within CDR2.
Isoleucine is commonly found at this position in human antibodies.
2. The potential epitope at position 1 is removed by substituting valine for leucine at residue (Kabat number 3).
3. Substitution of serine for alanine at residue 59 (Kabat number 60) removes the potential epitope at residue number 51.
6 Design of de-immunized Seqccences De-immunized heavy and light chain sequences were designed with reference to the changes required to remove potential T-cell epitopes and consideration of framework residues that might be critical for antibody structure and binding. In addition to the de-immunized sequences based on the veneered sequence, an additional sequence was designed for each VH, 3o and VK based on the murine sequence, termed the Mouse Peptide Threaded (MoPT) version.
For this version, changes. were made directly to the murine sequence in order to eliminate T-cell epitopes, but only changes outside the CDRs that are not considered to be detrimental to binding are made. No attempt to remove surface (B cell) epitopes has been made in this version of the de-immunized sequence. The primary de-immunized VH includes substitutions 1 to 5 in Section 5 above and one extra change at residue 43 (Kabat number 43). Lysine found in the murine sequence was substituted for the glutamine from the human framework. Lysine is positively charged and therefore significantly different to glutamine; this region may be involved in VH/VL contacts. The primary de-immunized VH includes no potential T-cell epitopes. A further 4 de-immunized VHs were designed in order to test the effect of the various substitutions required on antibody binding. The cumulative alterations made to the primary de-immunized sequence (KSDIVHvl) and the potential T-cell epitopes remaining are detailed in Table 2.
Table 2: Amino acid changes and potential epitopes in de-immunized KS VH
Variant Cumulative residuePotential epitopes (no. of potential changes MHC binders from 18 tested) KSDIVHvl None none KSDIVHv2 96M -~ I 98(15) KSDIVHv3 71A ~ L, 78L ~ 62(16), 78(11), 98(15) A
KSDIVHv4 38 R ~ K 30(7), 62(16), 78(11), 98(15) KSDIVHv5 68T ~.e A, 69I 30(7), 62(17), 78(11), 98(15) -~ F
KSMoPTVH NA 98(15), 78(12) The primary de-immunized VK includes substitutions 1 to 3 in Section 5 above.
A further 3 de-immunized VKs were designed in order to test the effect of the various substitutions required on antibody binding. The cumulative alterations made to the primary de-immunized sequence (KSDIVKvI) and the potential T-cell epitopes remaining are detailed in Table 3.
Table 3: Amino acid changes and potential epitopes in de-immunized KS VK
Variant Cumulative residuePotential epitopes (no. of potential changes MHC binders from 18 tested) KSDIVKvl None none KSDIVKv2 33I ~ M 27(5) KSDIVKv3 3V ~ L 1(17), 27(5) KSDIVKv4 60 S ~ A 1(17), 27(5), 5(13) KSMoPTVK NA none Seaccences of versions of modified epitopes:
KS VH veneered:
QIQLVQSGPELKKPGSSVKiSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYADDFKGRFT
fTIETSTSTAYLQLNNLRsEDmATYfCVRFISKGDYWGQGTTVTVSS
KS VK veneered:
QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPARFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH1 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITAETSTSTLYLQLNNLRSEDTATYFCVRFMSKGDYWGQGTTVTVSS
KS de-immunized VK1 QIVLTQSPASLAVSPGQRATITCSASSSVSYILWYQQKPGQPPKPWIFDTSNLASGFPSRFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH2 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITAETSTSTLYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK2 QIVLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPSRFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH3 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITLETSTSTAYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK3 QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPSRFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH4 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITLETSTSTAYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK4 QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPARFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH5 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFA
FTLETSTSTAYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK5 QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGSSPKPWIYDTSNLASGFPARFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS VH mouse, peptide threaded (Mo PT) QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFV
FSLETSASTAFLQLNNLRSEDTATYFCVRFISKGDYWGQGTSVTVSS
KS VK mouse, peptide threaded (Mo PT) QIVLTQSPATLSASPGERVTITCSASSSVSYMLWYLQKPGSSPKPWIFDTSNLASGFPSRFSGSGSGTT
YSLIISSLEAEDAATYYCHQRSGYPYTFGGGTKLEIK
KS VH mouse QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQTPGKGLKWMGWINTYTGEPTYADDFKGRFA
FSLETSASTAFLQINNLRNEDMATYFCVRFISKGDYWGQGTSVTVSS
KS VK mouse QILLTQSPAIMSASPGEKVTMTCSASSSVSYMLWYQQKPGSSPKPWIFDTSNLASGFPARFSGSGSGTS
YSLIISSMEAEDAATYYCHQRSGYPYTFGGGTKLEIK
MAb 14.18 - IL-2 In analogy, monoclonal antibody 14.18 was fused to IL-2 and deimmunized according to the invention.
Potential T-cell epitopes in murine and veneered 14.18 sequences are:
Sequence Number of Location of potential epitopes potential T-cell Murine 14,18 11 3(17), 9(15), 30(5), 35(17), 39(15), VH
43(9), 58(12), 62(11), 81(11), 84(16), 101(7) Veneered 14. 5 43(9), 58(12), 62(11), 81(11), 84(16) VH
Murine 14.18 7 7(7), 13(11), 27(15), 49(11), 86(17), VK
97(11), 100(4) Veneered 14. 5 27(I5), 49(11), 86(17), 97(11), 18 100(17) VK
Amino acid changes and potential epitopes in de-immunized 14.18 VH are:
Variant Cumulative residue Potential epitopes (no. of changes potential MHC
binders from 18 tested) 14.18DIVH1 none none 14.18DIVH2 41I -~ P, 45L ~ T, none 50L -~
A
_ 77 _ 14.18DIVH3 65S -~ G 58(8) 14.18DIVH4 71A ~ V 58(8), 62(4) 14.18DIVH5 45T ~ L, 41P ~ 1 43(9) 58(8) 62(4) 14.18MoPTVH NA 43(9) 58(12) 62(11) Amino acid changes and potential epitopes in de-immunized 14.18 VK are:
Variant Cumulative residue Potential epitopes' (no. of changes* potential MHC
binders from 18 tested) 14.18DIVKI None none 14.18DIVK2 46L~ M, 49Y -~ H none 14.18DIVK3 96P ~ T, 100Q ~ G 97(5) 14.18DIVK4 96T -~ L 97(11) 14.18DIVK5 27e S ~ R 27(15), 97(11) 14.18DIVK6 46M ~ L 27(15), 49 (11), 97(11) 14.18MoPTVK NA 27(15), 49 (11), 97(11), 100(4) Sequences of versions of modified epitopes are:
14.18 VH veneered:
EVQLLQSGPELKKPGASVKISCKASGSSFTGYNNINWVRQAPGQRLEWIGAIDPYYGGTSYNQKFKGRAT
LSVDKSSSQAYMHLKSLTSEDSAVYYCVSGMEYWGQGTTVTVSS
14.18 VK veneered:
DVVMTQSPGTLPVSLGERATISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDLAVYFCSQSTHVPPLTFGQGTKLEIK
14.18 de-immunized VH1 EVQLLQSGPELKKPGASVKISCKASGSSFTGYNMNWVRQAIGQRLEWIGLIDPYYGGTSYNQKFKSRVT
ITADKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK1 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPPTFGQGTKVEIK
14.18 de-immunized VH2 EVQLLQSGPELKKPGASVKISCKASGSSFTGY'NNIN4JVRQAPGQRTEWIGAIDPYYGGTSYNQKFKSRVT
ITADKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK2 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPPTFGQGTKVEIK
_ 78 _ 14.18 de-immunized VH3 EVQLLQSGPELKKPGASVKISCKASGSSFTGYNMNWVRQAPGQRTEWIGAIDPYYGGTSYNQKFKGRVT
ITADKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK3 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPTTFGGGTKVEIK
14.18 de-immunized VH4 EVQLLQSGPELKKPGASVKISCKASGSSFTG~ZJMNWVRQAPGQRTEWIGAIDPYYGGTSYNQKFKGRVT
ITVDKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK4 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPLTFGGGTKVEIK
14.18 de-immunized VH5 EVQLLQSGPELKKPGASVKISCKASGSSFTGYNMNWVRQAIGQRLEWIGAIDPYYGGTSYNQKFKGRVT
ITVDKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK5 DVVMTQSPGTLPVSLGERATISCRSSQSLVHRNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPLTFGGGTKVEIK
14.18 VH mouse, peptide threaded (Mo PT) EVQLVQSGPEVEKPSASVKISCKASGSSFTGYNNINWVRQAIGKSLEWIGAIDPYYGGTSYNQKFKGRAT
LTVDKSSSTAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 VK mouse, peptide threaded (Mo PT) DVVMTQTPGSLPVSAGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSG
SGSGTDFTLKISRVEAEDSGVYFCSQSTHVPPLTFGAGTKLELK
14.18 VH mouse EVQLLQSGPELEKPSASVMISCKASGSSFTGY~NMNWVRQNIGKSLEWIGAIDPYYGGTSYNQKFKGRAT
LTVDKSSSTAYMHLKSLTSEDSAVYYCVSGMEYWGQGTSVTVSS
14.18 VK mouse DVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSG
SGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELK
The foregoing description and the examples are intended as illustrative, and are not to be taken as limiting. Still other variants within the spirit and scope of this invention are possible and will readily present themselves to those skilled in the art.
The Fc region is considered non- or weakly immunogenic if the immunoglobulin heavy chain constant region fails to generate a detectable antibody response.
Furthermore, it is contemplated that substitution or deletion of amino acids within the immunoglobulin heavy chain constant regions may be useful in the practice of the invention. One example may include introducing amino acid substitutions in the upper CH2 region to create a Fc variant with reduced affinity for Fc receptors (Cole et al. (1997) J.
Immuno1.159:3613). An antibody-based fusion protein with an enhanced in vivo circulating half-life can be obtained by constructing a fusion protein having reduced binding affinity for a Fc receptor, and avoiding the use of sequences from antibody isotypes that bind to Fc receptors (WO 99/43713). For example, of the four known IgG isotypes, IgGI
(Cyl) and IaG3 (Cy3) are known to bind FcR~yl with high affinity, whereas IgG4 has a 10-fold lower binding affinity, and IgG2 (Cy2) does not bind to FcRyl. Thus, an antibody-based fusion protein with reduced binding affinity for a Fc receptor could be obtained by constructing a fusion protein with a C~y2 constant region (Fc region) or a C~y4 Fc region, and avoiding constructs with a Cyl Fc region or a Cy3 Fc region. An antibody-based fusion protein with an enhanced in vivo circulating half-life can be obtained by modifying sequences necessary for binding. to Fc receptors in isotypes that have binding affinity for an Fc receptor, in order to reduce or eliminate binding.
The important sequences for FcyR binding are Leu-Leu-Gly-Gly (residues 234 through 237 in C~yl), located in the CH2 domain adjacent to the hinge (Canfield and Morrison, J. Exp. Med.
173: 1483-1491 (1991)). Another important structural component necessary for effective FcR
binding is the presence of an N-linked carbohydrate chain covalently bound to Asnz9~.
Enzymatic removal of this structure or mutation of the Asn residue effectively abolish, or at least dramatically reduce, binding to all classes of Fc~yR.
The resulting antibody-based fusion proteins have a longer ire vivo circulating half-life than the unlinked second non-immunoglobulin protein. Dimerization of a ligand can increase the apparent binding affinity between the ligand and its receptor. For instance, if one X moiety of an Fc-X fusion protein can bind to a receptor on a cell with a certain affinity, the second X
moiety of the same Fc-Interferon-alpha fusion protein may bind to a second receptor on the same cell with a much higher avidity (apparent affinity). This may occur because of the physical proximity of the second X moiety to the receptor after the first X
moiety already is bound. In the case of an antibody binding to an antigen, the apparent affinity may be increased by at least ten thousand-fold. Each protein subunit, i.e., "X," has its own independent function so that in a multivalent molecule, the functions of the protein subunits may be additive or synergistic. Thus, fusion of the normally dimeric Fc molecule or another antibody fragment to a polypeptide X may increase the activity of X.
Nucleic acid sequences encoding, and amino acid sequences defining a human immunoglobulin Fc region, especially a Fc~yl, Fcy2 and Fcy3, useful in the practice of the invention are set forth in in the prior, such as disclosed in (WO
00/40615, WO 00/69913, WO 00/24782) or in the Genbank and/or EMBL databases, for example, AF045536.1 (Macaca fuscicularis), AF045537.1 (Macaca mulatta), AB016710 (Felix catus), (Oryctolagus cuniculus), U03780 (Sus scrofa), 248947 (Camelus dromedarius), X62916 (Bos taurLCS), L07789 (Mustela vison), X69797 (Ovis aries), U17 166 (Cricetulus migratorius), X07189 (Rattus rattus), AF57619.1 (Trichosurus vulpecccla), or AF035195 (Monodelphis domestica).
Thus, vectors reported earlier (Lo et al. (1998) Protein Engeneering 11:495-500) were modified by replacing the human IgGI Fc sequence with sequences from cDNA
encoding the mouse IgG2a Fc (US 5,726,044).
The invention encompasses mutations in the immunoglobulin component which eliminate undesirable properties of the native immunoglobulin, such as Fc receptor binding and/or introduce desirable properties such as stability. For example, Angal S., King D.J., Bodmer M.W., Turner A., Lawson A.D.G., Roberts G., Pedley B. and Adair R., Molecular Immunology,130, pp105-108, 1993, describe an IgG4 molecule where residue 241 (Kabat numbering) is altered from serine to proline. This change increases the serum half-life of the IgG4 molecule. Canfield S.M. and Morrison S.L., Journal of Experimental Medicine vo1173pp1483-149 1, describe the alteration of residue 248 (Kabat numbering) from leucine to glutamate in IgG3 and from glutamate to leucine in mouse IgG2b. Substitution of leucine for glutamate in the former decreases the affinity of the immunoglobulin molecule concerned for the FcyRl receptor, and substitution of glutamate for leucine in the latter increases the affinity. EP 0307 434 discloses various mutations including an L
to E mutation at residue 248 (Kabat numbering) in IgG. The constant domains) or fragment thereof is 3o preferably the whole or a substantial part of the constant region of the heavy chain of human IgG. The IgG component suitably comprises the CH2 and CH3 domains and the hinge region including cysteine residues contributing to inter-heavy chain disulphide bonding. For example when the IgG component is derived from IgG4 it includes cysteine residues 8 and 11 of the IaG4 hinge region (Pinck J.R. and Milstein C., Nature, 121, 6pp941-942, 1967).
The process of the invention may be performed by conventional recombinant techniques such as described in Maniatis et. al. ( Molecular Cloning - A Laboratory Manual;
Cold Spring Harbor, 1982) and DNA Cloning Vols I, II and III (D.M. Glover ed., IRL Press Ltd) or Sambrook et al. (1989, Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY, USA).
1o In particular, the process may comprise the steps of:
(i) preparing a replicable expression vector capable, in a host cell, of expressing a DNA
polymer comprising a nucleotide sequence that encodes said compound;
(ii) transforming a host cell with said vector;
(iii) culturing said transformed host cell under conditions permitting expression of said DNA
polymer to produce said compound; and (iv) recovering said compound.
The invention also provides a process for preparing the DNA polymer by the condensation of appropriate mono-, di- or oligomeric nucleotide units. The preparation may be carned out chemically, enzymatically, or by a combination of the two methods, in virro or in vivo as appropriate. Thus, the DNA polymer may be prepared by the enzymatic ligation of appropriate DNA fragments, by conventional methods such as those described by D. M.
Roberts et al in Biochemistry 1985, 24, 5090-5098. The DNA fragments may be obtained by digestion of DNA containing the required sequences of nucleotides with appropriate restriction enzymes, by chemical synthesis, by enzymatic polymerisation on DNA or RNA templates, or by a combination of these methods. Digestion with restriction enzymes may be performed in an appropriate buffer at a temperature of 20°=70°C with 0.1- 10~g DNA. Enzymatic polymerisation of DNA may be carried out in vitro using a DNA polymerase such as DNA
polymerase I (Klenow fragment) in an appropriate buffer containing the nucleoside uiphosphates dATP, dCTP, dGTP and dITP as required at a temperature of 10°-37°C, generally in a volume of 501 or less. Enzymatic ligation of DNA fragments may be carned out using a DNA lipase such as T4 DNA lipase in an appropriate buffer at a temperature of 40°C to ambient, generally in a volume of 501 or less.
The chemical synthesis of the DNA polymer or fragments may be carned out by conventional phosphotriester, phosphite or phosphoramidite chemistry, using solid phase techniques such as those described in "Chemical and Enzymatic Synthesis of Gene Fragments - A
Laboratory Manual" (ed. H.G. Gassen and A. Lang), Verlag Chemie, Weinheim (1982),or in other scientific publications, for example M.J. Gait, H.W.D. Matthes, M. Singh, B.S.
Sproat, and R.C. Titmas, Nucleic Acids Research, 1982,10, 6243; B.S. Sproat and W.
Bannwarth, Tetrahedron Letters, 1983,24,5771; M.D. Matteucci and M.H Caruthers, Tetrahedron Letters, 1980,21,719; M.D. Matteucci and M.H. Caruthers, Journal of the American Chemical Society, to 1981,103, 3185; S.P. Adams et al., Journal of the American Chemical Society,1983, 105, 661;
N.D. Sinha, J. Biemat, J. McMannus, and H. Koester, Nucleic Acids Research, 1984, 12,4539;
and H.W.D. Matthes et al., EMBO Journal, 1984,3,801. Preferably an automated DNA synthesizer is employed.
The DNA molecules may be obtained by the digestion with suitable restriction enzymes of vectors carrying the required coding sequences or by use of polymerise chain reaction technology. The precise structure of the DNA molecules and the way in which they are obtained depends upon the structure of the desired product. The design of a suitable strategy for the construction of the DNA molecule coding for the compound is a routine matter for the skilled worker in the art.
The expression of the DNA polymer encoding the compound in a recombinant host cell may be carned out by means of a replicable expression vector capable, in the host cell, of expressing the DNA polymer. The expression vector is novel and also forms part of the invention. The replicable expression vector may be prepared in accordance with the invention, by cleaving a vector compatible with the host cell to provide a linear DNA
segment having an intact replicon, and combining said linear segment with one or more DNA
molecules which, together with said linear segment, encode the compound, under ligating conditions. The ligation of the linear segment and more than one DNA molecule may be carried out 3o simultaneously or sequentially as desired. Thus, the DNA polymer may be preformed or formed during the construction of the vector, as desired. A useful expression vector is described at Lo et al. (1988) Protein Engineeering 11:495, in which the transcription of the Fc-X gene utilizes the enhancer/promoter of the human cytomegalovirus and the polyadenylation signal. Suitable vectors include plasmids, bacteriophages, cosmids and recombinant viruses derived from, for example, baculoviruses, vaccinia or Semliki Forest virus. Thus, vectors reported earlier (Lo et al. (1998) Protein Engeneering 11:495-500) were modified by replacing the human IgGI Fc sequence with sequences from cDNA
encoding the mouse IgG2a Fc (US 5,726,044).
The choice of vector will be determined in part by the host cell, which may be prokaryotic, such as E. coli, or eukaryotic, such as mouse C 127, mouse myeloma, Chinese hamster ovary, COS or Hela cells, fungi e.g. filamentous fungi or unicellular yeast or an insect cell such as Drosophila. Currently preferred host cells for use in the invention include immortal hybridoma cells, NS/0 myeloma cells, 293 cells, Chinese hamster ovary cells, HELA cells, and COS cells.
The host cell may also be a transgenic animal.
Polymerisation and ligation may be performed as described above for the preparation of the DNA polymer. Digestion with restriction enzymes may be performed in an appropriate buffer at a temperature of 20°- 70°C with 0.1 -10~g DNA. The recombinant host cell is prepared, in accordance with the invention, by transforming a host cell with a replicable expression vector of the invention under transforming conditions. Suitable transforming conditions are conventional and are described in, for example, Maniatis et al., cited above, or "DNA
2o Cloning" Vol. II, D.M. Glover ed., IRL Press Ltd, 1985. The choice of transforming conditions is determined by the host cell. Thus, a bacterial host such as E.
coli may be treated with a solution of CaCIZ (Cohen er al, Proc. Nat. Acad. Sci., 1973,69,2110) or with a solution comprising a mixture of RbCI, MnCl2, potassium acetate and glycerol, and then with 3-[N-morpholinol-propane- sulphonic acid, RbCI and glycerol. Mammalian cells in culture may .
be transformed by calcium co-precipitation of the vector DNA onto the cells.
The invention also extends to a host cell transformed or transfected with a replicable expression vector of the invention. Culturing the transformed host cell under conditions permitting expression of the DNA polymer is carned out conventionally, as described in, for example, Maniatis et al. and "DNA Cloning" cited above. Thus, preferably the cell is supplied with nutrient 3o and cultured at a temperature below 45°C. The expression product is recovered by conventional methods according to the host cell. Thus, where the host cell is bacterial, such as E. coli it may be lysed physically, chemically or enzymatically and the protein product isolated from the resulting lysate. If the product is to be secreted from the bacterial cell it may be recovered from the periplasmic space or the nutrient medium. Where the host cell is mammalian, the product may generally be isolated from the nutrient medium.
The DNA
polymer may be assembled into vectors designed for isolation of stable transformed mammalian cell lines expressing the product: e.g. bovine papillomavirus vectors or amplified vectors in Chinese hamster ovary cells (DNA cloning Vol.l 1 D.M. Glover ed.
IRL Press 1985;
Kaufman, R.J., Molecular and Cellular Biology 5, 1750-1759, 1985; Pavlakis G.N. and Hamer, D.H., Proceedings of the National Academy of Sciences (USA) 80,397-401,1983;
Goeddel, D.V. et al., and EP 0 093 619,1983).
The immunoconjugates of the invention may comprise linker molecules. The linker is preferably made up of amino acids linked together by peptide bonds. Thus, in preferred embodiments, the linker is made up of from 1 to 20 amino acids linked by peptide bonds, wherein the amino acids are selected from the 20 naturally occurring amino acids. Some of these amino acids may be glycosylated, as is well understood by those in the art. In a more preferred embodiment, the 1 to 20 amino acids are selected from glycine, alanine, proline, asparagine, glutamine, and lysine. Even more preferably, a linker is made up of a majority of amino acids that are sterically unhindered, such as glycine and alanine. Thus, preferred linkers are polyglycines such as polyGly (particularly (Gly)2 - (Gly)~), 2o poly(Gly-Ala), polyAla .
Other specific examples of suitable linkers are:
(Gly)3Lys(Gly)a (Gly)3AsnGlySer(Gly)Z
(Gly)3Cys(Gly)4 and GlyProAsnGlyGly Combinations of Gly and Ala are also preferred. The linkers shown here are exemplary;
linkers within the scope of this invention may be much longer and may include other residues. Non-peptide linkers are also possible. The peptide linkers may be altered to form derivatives in the same manner as described above.
Preferred linkers of the invention are not or less immunogenic. Most of the above-cited linker peptides are at least less immunogenic. However it is possible that creating the linkage between an antibody or a sFv, Fab, Fab' or F(ab')2 or a Fc domain and the target protein via a linker peptide molecule as mentioned above, new immunogenic epitopes may be newly created within the linkage region resulting in an immunoconjugate which has an increased immunogenicity compared to the immunogenicity of the single (de-immunized) components.
This situation can also be extended to fusion protein having no linker molecule. Therefore, the invention also relates to de-immunized regions of a fusion protein according to the invention, the so-called fusion or junction regions. When fusing a first protein molecule with a second protein molecule (which also can be a linker molecule) via the C- and N-terminals a sequence region is created that is artificial and, thus, was usually not yet seen by the immune system.
This region is deemed is be immunogenic. The region of amino acid residues comprise according to the invention approximately 10 residues of each protein terminal (N- or C-terminal). The complete fusion region comprises, therefore, about 20 amino acid residues, preferably 2 - 16, more preferably 2 - 10 (which is 1 - 8 and 1 - 5 amino acid residues, respectively, of each fusion partner).
The invention includes also further Fc variants. Such further Fc variants, one may remove one or more sites of a native Fc that provide structural features or functional activity not required by the fusion molecules of this invention. One may remove these sites by, for example, substituting or deleting residues, inserting residues into the site, or truncating portions containing the site. The inserted or substituted residues may also be altered amino acids, such as peptidomimetics or D- amino acids. For example, one or more glycosylation sites may be removed. Residues that are typically glycosylated (e.g., asparagine) may confer cytolytic response. Such residues may be deleted or substituted with unglycosylated residues (e.g., alanine). ADCC site as well as sites involved in interaction with complement, such as the Clq binding site, may also be removed if there is a specific need.
The invention includes also derivatives of the target polypeptide (X) of the invention. Such derivatives may further improve the solubility, absorption, biological half life, and the like of (X). The modified (X) may alternatively eliminate or attenuate any undesirable side-effect and the like. Exemplary derivatives include also compounds in which (X) or some portion thereof is cyclic. For example, the peptide portion may be modified to contain two or more Cys residues (e.g., in the linker), which could cyclize by disulfide bond formation. The compound is cross-linked or is rendered capable of cross-linking between molecules. For example, the peptide portion may be modified to contain one Cys residue and thereby be able to form an intermolecular disulfide bond with a like molecule.
In a final aspect the present invention relates to pharmaceutical compositions comprising said biologically active proteins obtainable by the methods disclosed in the present invention, and methods for therapeutic treatment of humans using the modified molecules and pharmaceutical compositions.
Therapeutic compositions of the present invention contain a physiologically tolerable Garner together with the relevant agent as described herein, dissolved or dispersed therein as an active 1o ingredient. As used herein. the terms "pharmaceutically acceptable", "physiologically tolerable" and grammatical variations thereof, as they refer to compositions, carriers, diluents and reagents, are used interchangeably and represent that the materials are capable of administration to or upon a mammal without the production of undesirable physiological effects such as nausea, dizziness, gastric upset and the like. The preparation of a t5 pharmacological composition that contains active ingredients dissolved or dispersed therein is well understood in the art and need not be limited based on formulation.
Typically, such compositions are prepared as injectables either as liquid solutions or suspensions, however, solid forms suitable for solution, or suspensions, in liquid prior to use can also be prepared.
The preparation can also be emulsified. The active ingredient can be mixed with excipients 20 which are pharmaceutically acceptable and compatible with the active ingredient and in amounts suitable for use in the therapeutic methods described herein. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol or the like and combinations thereof. In addition, if desired, the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents and the like which enhance the 25 effectiveness of the active ingredient.
The therapeutic composition of the present invention can include pharmaceutically acceptable salts of the components therein. Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the polypeptide) that are formed with inorganic acids such as. for example, hydrochloric or phosphoric acids, or such organic acids as acetic, 30 tartaric, mandelic and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine and the like. Particularly preferred is the HCI salt when used in the preparation of cyclic polypeptide av antagonists. Physiologically tolerable earners are well known in the art. Exemplary of liquid earners are sterile aqueous solutions that contain no materials in addition to the active ingredients and water, or contain a buffer such as sodium phosphate at physiological pH value, physiological saline or both, such as phosphate-buffered saline. Still further, aqueous earners can contain more than one buffer salt, as well as salts such as sodium and potassium chlorides, dextrose, polyethylene glycol and other solutes.
Liquid compositions can also contain liquid phases in addition to and to the exclusion of water. Exemplary of such additional liquid phases are glycerin. vegetable oils such as cottonseed oil, and water-oil emulsions.
Typically, a therapeutically effective amount of a modified immunoglobulin in the form of an modified antibody or antibody fragment according to the invention is an amount such that when administered in physiologically tolerable composition is sufficient to achieve a plasma concentration of from about 0.01 microgram (pg) per milliliter (ml) to about 100 ~g/ml, preferably from about 1 p,g/ml to about 5 ~g/ml and usually about 5 ~g/ml.
Stated differently.
the dosage can vary from about 0.1 mg/kg to about 300 mg/kg, preferably from about 0.2 mg/kg to about 200 mg/kg, most preferably from about 0.5 mg/kg to about 20 mg/kg, in one or more dose administrations daily for one or several days. Where the immunotherapeutic agent is in the form of a fragment of a monoclonal antibody or a conjugate, the amount can readily be adjusted based on the mass of the fragment / conjugate relative to the mass of the whole antibody. A preferred plasma concentration in molarity is from about 2 micromolar (~M) to about 5 millimolar (mM) and preferably, about 100 p,M to 1 mM antibody antagonist.
A therapeutically effective amount of an agent according of this invention which is a non-immunotherapeutic peptide or a protein is typically an amount of such a molecule such that when administered in a physiologically tolerable composition is sufficient to achieve a plasma concentration of from about 0.1 microgram (p,g) per milliliter (ml) to about 200 ~g/ml, preferably from about 1 ~g/ml to about 150 p,g/ml. Based on a protein having a mass of about 500 grams per mole, the preferred plasma concentration in molarity is from about 2 micromolar (~M) to about 5 millimolar (mM) and preferably about 100 ~M to 1 mM
polypeptide antagonist.
The pharmaceutical compositions of the invention can comprise phrase encompasses treatment of a subject with agents that reduce or avoid side effects associated with the combination therapy of the present invention ("adjunctive therapy"), including, but not limited to, those agents, for example, that reduce the toxic effect of anticancer drugs. Said adjunctive agents prevent or reduce the incidence of nausea and vomiting associated with chemotherapy, radiotherapy or operation, or reduce the incidence of infection associated with the administration of myelosuppressive anticancer drugs. Adjunctive agents are well known in the art. The modified proteins according to the invention can additionally administered with adjuvants like BCG and immune system stimulators.
Furthermore, the compositions may include immunotherapeutic agents, chemotherapeutic agents and anti-neoplastic agents which may contain cytotoxic effective radio labeled isotopes, or other cytotoxic agents, such as a cytotoxic peptides (e.g.
cytokines) or cytotoxic drugs and the like. The typical dosage of an active agent, which is a preferably a chemical antagonist or a (chemical) chemotherapeutic agent according to the invention (neither an immunotherapeutic agent nor a non-immunotherapeutic peptide/protein) is 10 mg to 1000 mg, preferably about 20 to 200 mg, and more preferably 50 to 100 mg per kilogram body weight t5 per day.
The following examples describe the in invention in more detail. However, this listing does not limit the invention.
2o EXAMPLE 1:
The following example describes in detail a preferred method for identification of immunogenic sequence regions (T-cell epitopes) within the sequences of the fusion proteins as disclosed in this invention. However, it should be pointed out, that said molecules can be obtained by other known methods.
The identification of T-cell epitopes of the molecules which were modified in order to obtain the immunoconjugates according to the present invention can be achieved by different methods which are described in the prior art (WO 92/10755 and WO 96/40792 (Novo Nordisk), EP 0519 596 (Merck & Co.), EP 0699 755(Centro de Immunologia Moelcular), WO
98/52976 and WO 98/59244 (Biovation Ltd.) or related methods.
Advantageous immunoconjugates, however, can be obtained if the identification of said epitopes is realized by the following new method which is described herewith in detail:
There are a number of factors that play important roles in determining the total structure of a protein, polypeptide or immunoglobulin. First, the peptide bond, i.e., that bond which joins the amino acids in the chain together, is a covalent bond. This bond is planar in structure, essentially a substituted amide. An "amide" is any of a group of organic compounds containing the grouping -CONH-.
The planar peptide bond linking Ca of adjacent amino acids may be represented as depicted below:
Ca -_______________.H
0________________~ \
Because the O=C and the C-N atoms lie in a relatively rigid plane, free rotation does not occur t0 about these axes. Hence, a plane schematically depicted by the interrupted line is sometimes referred to as an "amide" or "peptide plane" plane wherein lie the oxygen (O), carbon (C), nitrogen (N), and hydrogen (H) atoms of the peptide backbone. At opposite corners of this amide plane are located the Ca atoms. Since there is substantially no rotation about the O=C
and C-N atoms in the peptide or amide plane, a polypeptide chain thus comprises a series of planar peptide linkages joining the Ca atoms.
A second factor that plays an important role in defining the total structure or conformation of a polypeptide or protein is the angle of rotation of each amide plane about the common Ca linkage. The terms "angle of rotation" and "torsion angle" are hereinafter regarded as equivalent terms. Assuming that the O, C, N, and H atoms remain in the amide plane (which is usually a valid assumption, although there may be some slight deviations from planarity of these atoms for some conformations), these angles of rotation define the N and R
polypeptide's backbone conformation, i.e., the structure as it exists between adjacent residues.
These two angles are known as ~ and W. A set of the angles ~1, W1, where the subscript i represents a particular residue of a polypeptide chain, thus effectively defines the polypeptide secondary structure. The conventions used in defining the ~, W angles, i.e., the reference points at which the amide planes form a zero degree angle, and the definition of which angle is ~, and which angle is W, for a given polypeptide, are defined in the literature. See, e.g"
Ramachandran et al. Adv. Prot. Chem. 23:283-437 (1968), at pages 285-94, which pages are incorporated herein by reference.
The present method can be applied to any protein, and is based in part upon the discovery that in humans the primary Pocket 1 anchor position of MHC Class II molecule binding grooves has a well designed specificity for particular amino acid side chains. The specificity of this pocket is determined by the identity of the amino acid at position 86 of the beta chain of the MHC Class II molecule. This site is located at the bottom of Pocket 1 and determines the size of the side chain that can be accommodated by this pocket. Marshall, K.W., J.
Immunol., 152:4946-4956 (1994). If this residue is a glycine, then all hydrophobic aliphatic and aromatic 1o amino acids (hydrophobic aliphatics being: valine, leucine, isoleucine, methionine and aromatics being: phenylalanine, tyrosine and tryptophan) can be accommodated in the pocket, a preference being for the aromatic side chains. If this pocket residue is a valine, then the side chain of this amino acid protrudes into the pocket and restricts the size of peptide side chains that can be accommodated such that only hydrophobic aliphatic side chains can be accommodated. Therefore, in an amino acid residue sequence, wherever an amino acid with a hydrophobic aliphatic or aromatic side chain is found, there is the potential for a MHC Class II
restricted T-cell epitope to be present. If the side-chain is hydrophobic aliphatic, however, it is approximately twice as likely to be associated with a T-cell epitope than an aromatic side chain (assuming an approximately even distribution of Pocket 1 types throughout the global 2o population).
A computational method embodying the present invention profiles the likelihood of peptide regions to contain T-cell epitopes as follows:
(1) The primary sequence of a peptide segment of predetermined length is scanned, and all hydrophobic aliphatic and aromatic side chains present are identified. (2)The hydrophobic aliphatic side chains are assigned a value greater than that for the aromatic side chains;
preferably about twice the value assigned to the aromatic side chains, e.g., a value of 2 for a hydrophobic aliphatic side chain and a value of 1 for an aromatic side chain.
(3) The values determined to be present are summed for each overlapping amino acid residue segment (window) of predetermined uniform length within the peptide, and the total value for a 3o particular segment (window) is assigned to a single amino acid residue at an intermediate position of the segment (window), preferably to a residue at about the midpoint of the sampled segment (window). This procedure is repeated for each sampled overlapping amino acid residue segment (window). Thus, each amino acid residue of the peptide is assigned a value that relates to the likelihood of a T-cell epitope being present in that particular segment (window). (4) The values calculated and assigned as described in Step 3, above, can be plotted against the amino acid coordinates of the entire amino acid residue sequence being assessed.
(5) All portions of the sequence which have a score of a predetermined value, e.g., a value of 1, are deemed likely to contain a T-cell epitope and can be modified, if desired.
This particular aspect of the present invention provides a general method by which the regions of peptides likely to contain T-cell epitopes can be described. Modifications to the peptide in these regions have the potential to modify the MHC Class II binding characteristics.
According to another aspect of the present invention, T-cell epitopes can be predicted with 1o greater accuracy by the use of a more sophisticated computational method which takes into account the interactions of peptides with models of MHC Class II alleles.
The computational prediction of T-cell epitopes present within a peptide according to this particular aspect contemplates the construction of models of at least 42 MHC
Class II alleles based upon the structures of all known MHC Class II molecules and a method for the use of 15 these models in the computational identification of T-cell epitopes, the construction of libraries of peptide backbones for each model in order to allow for the known variability in relative peptide backbone alpha carbon (Ccc) positions, the construction of libraries of amino-acid side chain conformations for each backbone dock with each model for each of the 20 amino-acid alternatives at positions critical for the interaction between peptide and MHC
2o Class II molecule, and the use of these libraries of backbones and side-chain conformations in conjunction with a scoring function to select the optimum backbone and side-chain conformation for a particular peptide docked with a particular MHC Class II
molecule and the derivation of a binding score from this interaction.
Models of MHC Class II molecules can be derived via homology modeling from a number of 25 similar structures found in the Brookhaven Protein Data Bank ("PDB"). These may be made by the use of semi-automatic homology modeling software (Modeller, Sali A. &
Blundell TL., 1993. J. Mol Biol 234:779-815) which incorporates a simulated annealing function, in conjunction with the CHARMm force-field for energy minimisation (available from Molecular Simulations Inc., San Diego, Ca.). Alternative modeling methods can be utilized as 3o well.
The present method differs significantly from other computational methods which use libraries of experimentally derived binding data of each amino-acid alternative at each position in the binding groove for a small set of MHC Class II molecules (Marshall, K.W., et al., Biomed.
Pept. Proteins Nucleic Acids, 1(3):157-162) (1995) or yet other computational methods which use similar experimental binding data in order to define the binding characteristics of particular types of binding pockets within the groove, again using a relatively small subset of MHC Class II molecules, and then 'mixing and matching' pocket types from this pocket library to artificially create further 'virtual' MHC Class II molecules (Sturniolo T., et al., Nat.
Biotech, 17(6): 555-561 (1999). Both prior methods suffer the major disadvantage that, due to the complexity of the assays and the need to synthesize large numbers of peptide variants, only a small number of MHC Class II molecules can be experimentally scanned.
Therefore the first prior method can only make predictions for a small number of MHC Class II
molecules. The second prior method also makes the assumption that a pocket lined with similar amino-acids in one molecule will have the same binding characteristics when in the context of a different Class II allele and suffers further disadvantages in that only those MHC Class II molecules can be 'virtually' created which contain pockets contained within the pocket library. Using the modeling approach described herein, the structure of any number and type of MHC Class II
molecules can be deduced, therefore alleles can be specifically selected to be representative of the global population. In addition, the number of MHC Class II molecules scanned can be increased by making further models further than having to generate additional data via complex experimentation.
The use of a backbone library allows for variation in the positions of the Ca atoms of the 2o various peptides being scanned when docked with particular MHC Class II
molecules. This is again in contrast to the alternative prior computational methods described above which rely on the use of simplified peptide backbones for scanning amino-acid binding in particular pockets.
These simplified backbones are not likely to be representative of backbone conformations found in 'real' peptides leading to inaccuracies in prediction of peptide binding. The present backbone library is created by superposing the backbones of all peptides bound to MHC Class II molecules found within the Protein Data Bank and noting the root mean square (RMS) deviation between the Ca atoms of each of the eleven amino-acids located within the binding groove. While this library can be derived from a small number of suitable available mouse and human structures (currently 13), in order to allow for the possibility of even greater variability, the RMS figure for each C"-a position is increased by 50%. The average Ca position of each amino-acid is then determined and a sphere drawn around this point whose radius equals the RMS deviation at that position plus 50%. This sphere represents all allowed Ca positions.
Working from the Ca with the least RMS deviation (that of the amino-acid in Pocket 1 as mentioned above, equivalent to Position 2 of~the 11 residues in the binding groove), the sphere is three-dimensionally gridded, and each vertex within the grid is then used as a possible location for a Ca of that amino-acid. The subsequent amide plane, corresponding to the peptide bond to the subsequent amino-acid is grafted onto each of these Cas and the ~ and ~r angles are rotated step-wise at set intervals in order to position the subsequent Ca. If the subsequent Ca falls within the 'sphere of allowed positions' for this Ca than the orientation of the dipeptide is accepted, whereas if it falls outside the sphere then the dipeptide is rejected.
This process is then repeated for each of the subsequent Ca positions, such that the peptide grows from the Pocket 1 Ca 'seed', until all nine subsequent Cas have been positioned from all possible permutations of the preceding Cas. The process is then repeated once more for the single Ca preceding pocket 1 to create a library of backbone Ca positions located within the binding groove.
The number of backbones generated is dependent upon several factors: The size of the ~ 'spheres of allowed positions'; the fineness of the gridding of the 'primary sphere' at the Pocket 1 position; the fineness of the step-wise rotation of the ~ and ~
angles used to position.
subsequent Cas. Using this process, a large library of backbones can be created. The larger the backbone library, the more likely it will be that the optimum fit will be found for a particular peptide within the binding groove of an MHC Class II molecule.
Inasmuch as all backbones will not be suitable for docking with all the models of MHC Class II
molecules due to clashes with amino-acids of the binding domains, for each allele a subset of the library is created comprising backbones which can be accommodated by that allele. The use of the backbone library, in conjunction with the models of MHC Class II molecules creates an exhaustive database consisting of allowed side chain conformations for each amino-acid in each position of the binding groove for each MHC Class II molecule docked with each allowed backbone. This data set is generated using a simple steric overlap function where a MHC Class II molecule is docked with a backbone and an amino-acid side chain is grafted onto the backbone at the desired position. Each of the rotatable bonds of the side chain is rotated step-wise at set intervals and the resultant positions of the atoms dependent upon that bond noted. The interaction of the atom with atoms of side-chains of the binding groove is noted and positions are either accepted or rejected according to the following criteria: The sum total of the overlap of all atoms so far positioned must not exceed a pre-determined value.
Thus the stringency of the conformational search is a function of the interval used in the step-wise rotation of the bond and the pre-determined limit for the total overlap.
This latter value can be small if it is known that a particular pocket is rigid, however the stringency can be relaxed if the positions of pocket side-chains are known to be relatively flexible. Thus allowances can be made to imitate variations in flexibility within pockets of the binding groove. This conformational search is then repeated for every amino-acid at every position of each backbone when docked with each of the MHC Class II molecules to create the exhaustive database of side-chain conformations.
A suitable mathematical expression is used to estimate the energy of binding between models of MHC Class II molecules in conjunction with peptide ligand conformations which have to be empirically derived by scanning the large database of backbone/side-chain conformations described above. Thus a protein is scanned for potential T-cell epitopes by subjecting each possible peptide of length varying between 9 and 20 amino-acids (although the length is kept constant for each scan) to the following computations: An MHC Class II
molecule is selected together with a peptide backbone allowed for that molecule and the side-chains corresponding to the desired peptide sequence are grafted on. Atom identity and interatomic..distance data relating to a particular side-chain at a particular position on the backbone are collected for each allowed conformation of that amino-acid (obtained from the database described above).
This is repeated for each side-chain along the backbone and peptide scores derived using a scoring function. The best score for that backbone is retained and the process repeated for each allowed backbone for the selected model. The scores from all allowed backbones are compared and the highest score is deemed to be the peptide score for the desired peptide in that MHC Class II model. This process is then repeated for each model with every possible peptide derived from the protein being scanned, and the scores for peptides versus models are displayed.
In the context of the present invention, each ligand presented for the binding affinity calculation is an amino-acid segment selected from a peptide or protein as discussed above.
Thus, the ligand is a selected stretch of amino acids about 9 to 20 amino acids in length derived from a peptide, polypeptide or protein of known sequence. The terms "amino acids"
and "residues" are hereinafter regarded as equivalent terms. The ligand, in the form of the consecutive amino acids of the peptide to be examined grafted onto a backbone from the backbone library, is positioned in the binding cleft of an MHC Class II
molecule from the MHC Class II molecule model library via the coordinates of the C"-a atoms of the peptide backbone and an allowed conformation for each side-chain is selected from the database of allowed conformations. The relevant atom identities and interatomic distances are also retrieved from this database and used to calculate the peptide binding score.
Ligands with a high binding affinity for the MHC Class II binding pocket are flagged as candidates for site-s directed mutagenesis. Amino-acid substitutions are made in the flagged ligand (and hence in the protein of interest) which is then retested using the scoring function in order to determine changes which reduce the binding affinity below a predetermined threshold value. These changes can then be incorporated into the protein of interest to remove T-cell epitopes.
Binding between the peptide ligand and the binding groove of MHC Class II
molecules involves non-covalent interactions including, but not limited to: hydrogen bonds, electrostatic interactions, hydrophobic (lipophilic) interactions and Van der Walls interactions. These are included in the peptide scoring function as described in detail below. It should be understood that a hydrogen bond is a non-covalent bond which can be formed between polar or charged groups and consists of a hydrogen atom shared by two other atoms. The hydrogen of the hydrogen donor has a positive charge where the hydrogen acceptor has a partial negative charge. For the purposes of peptide/protein interactions, hydrogen bond donors may be either nitrogens with hydrogen attached or hydrogens attached to oxygen or nitrogen.
Hydrogen bond acceptor atoms may be oxygens not attached to hydrogen, nitrogens with no hydrogens attached and one or two connections, or sulphurs with only one connection.
Certain atoms, 2o such as oxygens attached to hydrogens or imine nitrogens (e.g. C=NH) may be both hydrogen acceptors or donors. Hydrogen bond energies range from 3 to 7 Kcal/mol and are much stronger than Van der Waal's bonds, but weaker than covalent bonds. Hydrogen bonds are also highly directional and are at their strongest when the donor atom, hydrogen atom and acceptor atom are co-linear. Electrostatic bonds are formed between oppositely charged ion pairs and the strength of the interaction is inversely proportional to the square of the distance between the atoms according to Coulomb's law. The optimal distance between ion pairs is about 2.8A. In protein/peptide interactions, electrostatic bonds may be formed between arginine, histidine or lysine and aspartate or glutamate. The strength of the bond will depend upon the pKa of the ionizing group and the dielectric constant of the medium although they 3o are approximately similar in strength to hydrogen bonds.
Lipophilic interactions are favorable hydrophobic-hydrophobic contacts that occur between he protein and peptide ligand. Usually, these will occur between hydrophobic amino acid side chains of the peptide buried within the pockets of the binding groove such that they are not exposed to solvent. Exposure of the hydrophobic residues to solvent is highly unfavorable since the surrounding solvent molecules are forced to hydrogen bond with each other forming cage-like clathrate structures. The resultant decrease in entropy is highly unfavorable.
Lipophilic atoms may be sulphurs which are neither polar nor hydrogen acceptors and carbon atoms which are not polar.
Van der Waal's bonds are non-specific forces found between atoms which are 3-4A apart.
They are weaker and less specific than hydrogen and electrostatic bonds. The distribution of electronic charge around an atom changes with time and, at any instant, the charge distribution is not symmetric. This transient asymmetry in electronic charge induces a similar asymmetry 1o in neighboring atoms. The resultant attractive forces between atoms reaches a maximum at the Van der Waal's contact distance but diminishes very rapidly at about 1A to about 2A.
Conversely, as atoms become separated by less than the contact distance, increasingly strong repulsive forces become dominant as the outer electron clouds of the atoms overlap. Although the attractive forces are relatively weak compared to electrostatic and hydrogen bonds (about ~5 0.6 Kcal/mol), the repulsive forces in particular may be very important in determining whether a peptide ligand may bind successfully to a protein.
In one embodiment, the Bohm scoring function (SCORE1 approach) is used to estimate the binding constant. (Bohm, H.J., J. Comput Aided Mol. Des., 8(3):243-256 (1994) which is hereby incorporated in its entirety). In another embodiment, the scoring function (SCORE2 2o approach) is used to estimate the binding affinities as an indicator of a ligand containing a T-cell epitope (Bohm, H.J., J. Compcct Aided Mol. Des., 12(4):309-323 (1998) which is hereby incorporated in its entirety). However, the Bohm scoring functions as described in the above references are used to estimate the binding affinity of a ligand to a protein where it is already known that the ligand successfully binds to the protein and the proteinlligand complex has had 25 its structure solved, the solved structure being present in the Protein Data Bank ("PDB").
Therefore, the scoring function has been developed with the benefit of known positive binding data. In order to allow for discrimination between positive and negative binders, a repulsion term must be added to the equation. In addition, a more satisfactory estimate of binding energy is achieved by computing the lipophilic interactions in a pairwise manner rather than 30 using the area based energy term of the above Bohm functions. Therefore, in a preferred embodiment, the binding energy is estimated using a modified Bohm scoring function. In the modified Bohm scoring function, the binding energy between protein and ligand (OGb;"d) is estimated considering the following parameters: The reduction of binding energy due to the overall loss of translational and rotational entropy of the ligand (OGo);
contributions from ideal hydrogen bonds (~G,,b) where at least one partner is neutral; contributions from unperturbed ionic interactions (OG;°n~~); lipophilic interactions between lipophilic ligand atoms and lipophilic acceptor atoms (OG,;P°); the loss of binding energy due to the freezing of internal degrees of freedom in the ligand, i.e., the freedom of rotation about each C-C
bond is reduced (OG~°~); the energy of the interaction between the protein and ligand (Evdw). Consideration of these terms gives eduation 1:
(~Gbind) _ ( OGp) + ( OGhbXNhb) + ( ~C,ionicXNionic) + ( OGlipoXNlipo) + ( OGrot+Nrot) + ( E vdW) Where N is the number of qualifying interactions for a specific term and, in one embodiment, ~Go, OGhb, OG;°".c, ~Gi,P° and OG~°~ are constants which are given the values: 5.4, -4.7, -4.7, -0.17, and 1.4, respectively.
The term Nhb is calculated according to eguation 2:
Nhb = Lh-bonds f ( ~R , ~a ) X f ( Nneighb ) x f p~s f(~R, Via) is a penalty function which accounts for large deviations of hydrogen bonds from ideality and is calculated according to eguation 3:
f (OR, ~-a> - fl (OR) x f2 (0a) Where: f1 (0R) - 1 if 0R <= TOL
or = 1 - ( 0R - TOL ) / 0 . 4 i f 0R < = 0 . 4 + TOL
or = 0 if 0R >0.4 + TOL
And: f2 (0a) - 1 if 0a <30°
or = 1- ( ~a - 30) /50 if 0a <=80°
or = 0 if Da >80°
a TOL is the tolerated deviation in hydrogen bond length = 0.25A
~R is the deviation of the H-O/N hydrogen bond length from the ideal value =
1.9~
Da is the deviation of the hydrogen bond angle L rvio-H..omr from its idealized value of 180°
f(Nneighb) distinguishes between concave and convex parts of a protein surface and therefore assigns greater weight to polar interactions found in pockets rather than those found at the protein surface. This function is calculated according to e~c uation 4 below:
f (Nneighb) - (Nneighb/Nneighb.0) a where a = 0.5 N"e;ahb is the number of non-hydrogen protein atoms that are closer than SA to any given protein atom.
N~e~dnb,o is a constant = 25 fP~s is a function which allows for the polar contact surface area per hydrogen bond and therefore distinguishes between strong and W eak hydrogen bonds and its value is determined according to the following criteria:
fpcs- ~ when Apolar/NHB < 10 Az or fps= 1 when Apolar/NHB > 10 Az Apoiar is the size of the polar protein-ligand contact surface NHB is the number of hydrogen bonds f3 is a constant whose value = 1.2 For the implementation of the modified Bohm scoring function, the contributions from ionic to interactions, ~G;on;~, are computed in a similar fashion to those from hydrogen bonds described above since the same geometry dependency is assumed.
The term N,;Po is calculated according to eguation 5 below:
Niipo - W Lf (rrL) f(r,~) is calculated for all lipophilic ligand atoms, l, and all lipophilic protein atoms, L, 15 according to the following criteria:
f ( r1L ) =1 when r1L <= R1 f ( r1L ) _ ( ric - R1 ) / ( R2 -R1 ) when R2 <r1L
> Rl f (r1L) =0 when rl~ >= R2 Where: R1 = rl"aW + rL"a'" + 0.5 and R2 = R1 + 3.0 2o and r,~dW is the Van der Waal's radius of atom 1 and r~°aW is the Van der Waal's radius of atom L
The term N~o~ is the number of rotable bonds of the amino acid side chain and is taken to be the number of acyclic spa - spa and spa - spz bonds. Rotations of terminal -CH3 or -NH3 are not taken into account.
25 The final term, Evdw, is calculated according to eguation 6 below:
Evaw = ~i~z ( ( rl°aW +rz~aw) iz / riz - ( r ~aW +r ~aW s s z ) / r ) , where:
E, and ~2 are constants dependant upon atom identity r,"d'" +r2"dW are the Van der Waal's atomic radii r is the distance between a pair of atoms.
30 With regard to Equation 6, in one embodiment, the constants ~~ and s2 are given the atom values: C: 0.245, N: 0.283, O: 0.316, S: 0.316, respectively (i.e. for atoms of Carbon, Nitrogen, Oxygen and Sulphur, respectively). With regards to equations 5 and 6, the Van der Waal's radii are given the atom values C: 1.85, N: 1.75, O: 1.60, S: 2.00A.
It should be understood that all predetermined values and constants given in the equations above are determined within the constraints of current understandings of protein ligand interactions with particular regard to the type of computation being undertaken herein.
Therefore, it is possible that, as this scoring function is refined further, these values and constants may change hence any suitable numerical value which gives the desired results in terms of estimating the binding energy of a protein to a ligand may be used and hence fall within the scope of the present invention.
As described above, the scoring function is applied to data extracted from the database of side-chain conformations, atom identities, and interatomic distances. For the purposes of the t0 present description, the number of MHC Class II molecules included in this database is 42 models plus four solved structures. It should be apparent from the above descriptions that the modular nature of the construction of the computational method of the present invention means that new models can simply be added and scanned with the peptide backbone library and side-chain conformational search function to create additional data sets which can be processed by the peptide scoring function as described above. This allows for the repertoire of scanned MHC Class II molecules to easily be increased, or structures and associated data to be replaced if data are available to create more accurate models of the existing alleles.
The present prediction method can be calibrated against a data set comprising a large number of peptides whose affinity for various MHC Class II molecules has previously been experimentally determined. By comparison of calculated versus experimental data, a cut of value can be determined above which it is known that all experimentally determined T-cell epitopes are correctly predicted.
It should be understood that, although the above scoring function is relatively simple compared to some sophisticated methodologies that are available, the calculations are performed extremely rapidly. It should also be understood that the objective is not to calculate the true binding energy per se for each peptide docked in the binding groove of a selected MHC Class II protein. The underlying objective is to obtain comparative binding energy data as an aid to predicting the location of T-cell epitopes based on the primary structure (i.e.
amino acid sequence) of a selected protein. A relatively high binding energy or a binding energy above a selected threshold value would suggest the presence of a T-cell epitope in the ligand. The ligand may then be subjected to at least one round of amino-acid substitution and the binding energy recalculated. Due to the rapid nature of the calculations, these manipulations of the peptide sequence can be performed interactively within the program's user interface on cost-effectively available computer hardware. Major investment in computer hardware is thus not required.
It would be apparent to one skilled in the art that other available software could be used for the same purposes. In particular, more sophisticated software which is capable of docking ligands into protein binding-sites may be used in conjunction with energy minimization. Examples of docking software are: DOCK (Kuntz et al., J. Mol. Biol., 161:269-288 (1982)), LUDI (Bohm, H.J., J. ComputAided Mol. Des., 8:623-632 (1994)) and FLEXX (Rarey M., et al., ISMB, 3:300-308 (1995)). Examples of molecular modeling and manipulation software include:
AMBER (Tripos) and CHARMm (Molecular Simulations Inc.). The use of these to computational methods would severely limit the throughput of the method of this invention due to the lengths of processing time required to make the necessary calculations. However, it is feasible that such methods could be used as a 'secondary screen' to obtain more accurate calculations of binding energy for peptides which are found to be 'positive binders' via the method of the present invention. The limitation of processing time for sophisticated molecular mechanic or molecular dynamic calculations is one which is defined both by the design of the software which makes these calculations and the current technology limitations of computer hardware. It may be anticipated that, in the future, with the writing of more efficient code and the continuing increases in speed of computer processors, it may become feasible to make such calculations within a more manageable time-frame. Further information on energy functions applied to macromolecules and consideration of the various interactions that take place within a folded protein structure can be found in: Brooks, B.R., et al., J. Comput. Chem., 4:187-217 (1983) and further information concerning general protein-ligand interactions can be found in: Dauber-Osguthorpe et al., Proteins4(1):31-47(1988), which are incorporated herein by reference in their entirety. Useful background information can also be found, for example, in Fasman, G.D., ed., Prediction of Protein Structure and the Principles of Protein Conformation, Plenum Press, New York, ISBN: 0-306 4313-9.
EXAMPLE 2: De-immunized forms of Fc-Leptin Leptin is a secreted signaling 146 amino acid residue protein involved in the homeostatic 3o mechanisms maintaining adipose mass (e.g. WO 00/40615, WO 98/28427, WO
96/05309).
The protein (and its antagonists) offers significant therapeutic potential for the treatment of diabetes, high blood pressure and cholesterol metabolism.
Fc-leptin is a fusion protein for which the serum half-life is profoundly improved compared to leptin itself (WO 0040615). However, certain forms of Fc-leptin, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection. In a Phase I clinical trial, leptin alone was found to be at least somewhat immunogenic. The invention discloses sequences identified within the leptin primary sequence that are potential T-cell epitopes by virtue of MHC class II binding potential. This disclosure specifically pertains to the human leptin moiety containing about 146 amino acid residues.
Others have provided modified leptin (US, 5,900,404; W096/05309) but these approaches 1o have been directed towards improvements in the commercial production of leptin, for example improved in vitro stability. Such teachings do not recognize the importance of T-cell epitopes to the immunogenic properties of the protein nor have been conceived to directly influence said properties in a specific and controlled way according to the scheme of the present invention. Specific Fc-leptin forms: Fcyl-leptin, Fc~y2-leptin, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Sequences to be modified in leptin are shown below:
An amino acid sequence which is part of the sequence of an immunogenically non-modified human obesity protein (1e tin and has a potential MHC class II binding activity is selected from the following group identified according to the method of the invention:
Peptide sequences in human leptin with potential human MHC class 11 binding activity.
VPIQKVQDDTKTL, QKVQDDTKTLIKT, KTLIKTIVTRIND, TLIKTIVTRINDI, KTIVTRINDISHT, TIVTRINDISHTQ, TRINDISHTQSVS, NDISHTQSVSSKQ, QSVSSKQKVTGLD, SSKQKVTGLDFIP, QKVTGLDFIPGLH, TGLDFIPGLHPIL, LDFIPGLHPILTL, DFIPGLHPILTLS, PGLHPILTLSKMD, GLHPILTLSKMDQ, HPILTLSKMDQTL, PILTLSKMDQTLA, LTLSKMDQTLAW, SKMDQTLAWQQI, QTLAWQQILTSM, LAWQQILTSMPS, AWQQILTSMPSR, QQILTSMPSRNVI, QILTSMPSRNVIQ, TSMPSRNVIQISN, SRNVIQISNDLEN, RNVIQISNDLENL, NVIQISNDLENLR, IQISNDLENLRDL, NDLENLRDLLHVL, LENLRDLLHVLAF, ENLRDLLHVLAFS, RDLLHVLAFSKSC, DLLHVLAFSKSCH, LHVLAFSKSCHLP, HVLAFSKSCHLPW, LAFSKSCHLPWAS, CHLPWASGLETLD, SGLETLDSLGGVL, DSLGGVLEASGYS, SLGGVLEASGYST, GGVLEASGYSTEV, SGYSTEWALSRL, TEWALSRLQGSL, EWALSRLQGSLQ, VALSRLQGSLQDM, SRLQGSLQDMLWQ, QGSLQDMLWQLDL, GSLQDMLWQLDLS, QDMLWQLDLSPGC
Substitutions leading to the elimination of potential T-cell epitopes of human leptin (WT =
wild type).
ResidueWT Substitutions # residue T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
110 L A C D E G H K ' P Q R S
N T
T
T
T
T
T
T
T
T
T
Any of the above-cited peptide sequences can be used for modifying by exchanging one or more amino acids to obtain a sequence having a reduced or no immunogenicity .
EXAMPLE 3: De-immunized forms of Fc-IL-1 Ra The present invention provides for modified forms of an interleukin-1 receptor antagonist (IL-1Ra) with one or more T-cell epitopes removed. IL-1 is an important inflammatory and immune modulating cytokine with pleiotropic effects on a variety of tissues but may contribute to the pathology associated with rheumatoid arthritis and other diseases associated with local tissue damage. An IL-1 receptor antagonist able to inhibit the action of IL-1 has been purified and the gene cloned [Eisenburg S.P. et al (1990) Nature, 343:
341-346; Carter, D.B. et al (1990) Nature, 344: 633-637]. Others have provided IL-1Ra molecules (e.g. US
5,075,222]. Recombinant forms of this protein have therapeutic potential in disease settings 1o where the effects of IL-1 are deleterious. However, there remains a continued need for IL-1Ra analogues with enhanced properties. Desired enhancements include alternative schemes and modalities for the expression and purification of the said therapeutic, but also and especially, improvements in the biological properties of the protein. There is a particular need for enhancement of the in vivo characteristics when administered to the human subject. In this regard, it is highly desired to provide IL-1Ra with reduced or absent potential to induce an immune response in the human subject. Such proteins would expect to display an increased circulation time within the human subject and would be of particular benefit in chronic or recurring disease settings such as is the case for a number of indications for IL-lRa. The present invention provides for modified forms of IL-1Ra proteins that are expected to display 2o enhanced properties in vivo. This disclosure specifically pertains a human IL-1Ra protein being of 152 amino acid residues (Eisenburg, S.P. et al (1991) Proc. Natl.
Acad. Sci. U.S.A.
88: 5232-5236).
Specific Fc- IL-1Ra forms: Fcyl- IL-lRa, Fcy2- IL-lRa, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human interleukin-1 receptor antagonist (IL-1RA) with potential human MHC class II binding activity.
RKSSKMQAFRIWD, SKMQAFRIWDVNQ, QAFRIWDVNQKTF, FRIWDVNQKTFYL, RIWDVNQKTFYLR, IWDVNQKTFYLRN, WDVNQKTFYLRNN, KTFYLRNNQLVAG, TFYLRNNQLVAGY, FYLRNNQLVAGYL, LRNNQLVAGYLQG, RNNQLVAGYLQGP, NQLVAGYLQGPNV, QLVAGYLQGPNVN, LVAGYLQGPNVNL, AGYLQGPNVNLEE, GYLQGPNVNLEEK, PNVNLEEKIDWP, VNLEEKIDWPIE, EKIDWPIEPHAL, IDWPIEPHALFL, DWPIEPHALFLG, VPIEPHALFLGIH, HALFLGIHGGKMC, ALFLGIHGGKMCL, LFLGIHGGKMCLS, LGIHGGKMCLSCV, GKMCLSCVKSGDE, MCLSCVKSGDETR, SCVKSGDETRLQL, ETRLQLEAVNITD, TRLQLEAVNITDL, LQLEAVNITDLSE, EAVNITDLSENRK, VNITDLSENRKQD, TDLSENRKQDKRF, ENRKQDKRFAFIR, KRFAFIRSDSGPT, FAFIRSDSGPTTS, AFIRSDSGPTTSF, TSFESAACPGWFL, SFESAACPGWFLC, PGWFLCTAMEADQ, WFLCTAMEADQPV, TAMEADQPVSLTN, QPVSLTNMPDEGV, VSLTNMPDEGVMV, TNMPDEGVMVTKF, PDEGVMVTKFYFQ, EGVMVTKFYFQED, GVMVTKFYFQEDE
Substitutions leading to the elimination of potential T-cell epitopes of human interleukin-1 receptor antagonist (IL-1 RA) ( WT = wild type).
Residue WT
# Residue Substitution M A C D E G H K N P Q R S T
I A C D E G H K N P Q R S T
L A C D E G H K N P Q R S T
L A C D E G H K N P Q R S T
L A C D E G H K N P Q R S T
V A C D E G H K N P Q R S T
EXAMPLE 4: De-immm2ized~'orms of Fc-BNDF
The present invention provides for modified forms of human brain-derived neurotrophic factor (BNDF) with one or more T-cell epitopes removed. BNDF is glycoprotein of the nerve growth factor family of proteins. The mature 119 amino acid glycoprotein is processed from a larger pre-cursor to yield a neutrophic factor that promotes the survival of neuronal cell populations [Jones K.R. & Reichardt, L.F. (1990) Proc. Natl. Acad. Sci U.S.A.
87: 8060-8064]. Others have provided modified BNDF molecules [US, 5,770,577] and approaches towards the commercial production of recombinant BNDF molecules [US, 5,986,070]. Such neuronal cells are all located either in the central nervous system or directly connected to it.
Recombinant preparations of BNDF have enabled the therapeutic potential of the protein to be explored for the promotion of nerve regeneration and degenerative disease therapy.
Specific Fc- BNDF forms: Fcyl- BNDF, Fc~y2- BNDF, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human brain-derived neutrophic factor (BDNF) with potential human MHC class II binding activity.
GELSVCDSISEWV, LSVCDSISEWVTA, DSISEWVTAADKK, SEWVTAADKKTAV, EWVTAADKKTRVD, WVTAADKKTAVDM, KTAVDMSGGTVTV, TAVDMSGGTVTVL, VDMSGGTVTVLEK, GTVTVLEKVPVSK,VTVLEKVPVSKGQ, TVLEKVPVSKGQL, EKVPVSKGQLKQY, VPVSKGQLKQYFY,GQLKQYFYETKCN, KQYFYETKCNPMG, QYFYETKCNPMGY,YFYETKCNPMGYT,NPMGYTKEGCRGI, MGYTKEGCRGIDK, RGIDKRHWNSQCR, RHWNSQCRTTQSY,HWNSQCRTTQSYV, QSYVRALTMDSKK, SYVRALTMDSKKR, RALTMDSKKRIGW,LTMDSKKRIGWRF, KRIGWRFIRIDTS, IGWRFIRIDTSCV, GWRFIRIDTSCVC, WRFIRIDTSCVCT, RFIRIDTSCVCTL, IRIDTSCVCTLTI, IDTSCVCTLTIKR
Substitutions leading to the elimination of potential T-cell epitopes of human brain-derived neutrophic factor (BDNF) (WT = wild type).
ResidueWT
Substitution # Residue ~
ResidueWT
Substitution # Residue .
EXAMPLE 5: De-immunized forms o~f Fc-EPO
The present invention provides for modified forms of human erythropioetin (EPO) with one or more T-cell epitopes removed. EPO is a 165 amino acid residues glycoprotein hormone involved in the maturation of erythroid progenitor cells into erythrocytes.
Naturally occurring EPO is produced by the liver during foetal life and by the kidney of adults and circulates in the blood to stimulate production of red blood cells in bone marrow. Anaemia is almost invariably a consequence of renal failure due to decreased production of EPO
from the kidney.
Recombinant EPO is used as an effective treatment of anaemia resulting from chronic renal failure.
Recombinant EPO (expressed in mammalian cells) having the amino acid sequence 1-165 of human erythropoietin [Jacobs, K. et al (1985) Nature, 313: 806-810; Lin, F.-K.
et al (1985) Proc. Natl. Acad. Sci. U.S.A. 82:7580-7585] contains three N-linked and one O-linked oligosaccharide chains each containing terminal sialic acid residues. The latter are significant in enabling EPO to evade rapid clearance from the circulation by the hepatic asialoglycoprotein binding protein.
Non-de-immunized Fc-EPO is known e.g. from WO 99/58662, WO 99/02709.
Specific Fc- EPO forms: Fcyl- EPO, Fc~y2- EPO, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors. The EPO may be glycosylated, partially glycosylated or has a modified glycosylation pattern.
Peptide sequences in human erythropoietin (EPO) with potential human MHC class II binding activity.
PRLICDSRVLERY, RLICDSRVLERYL, ICDSRVLERYLLE, CDSRVLERYLLEA, SRVLERYLLEAKE, RVLERYLLEAKEA, LERYLLEAKEAEN, ERYLLEAKEAENI, RYLLEAKEAENIT, YLLEAKEAENITT, LEAKEAENITTGC, KEAENITTGCAEH, ENITTGCAEHCSL, CSLNENITVPDTK, NENITVPDTKVNF, ENITVPDTKVNFY, NITVPDTKVNFYA, ITVPDTKVNFYAW, TKVNFYAWKRMEV, VNFYAWKRMEVGQ, NFYAWKRMEVGQQ, YAWKRMEVGQQAV, KRMEVGQQAVEVW, RMEVGQQAVEVWQ, MEVGQQAVEVWQG, QAVEVWQGLALLS, AVEVWQGLALLSE, VEVWQGLALLSEA, EVWQGLALLSEAV, VWQGLALLSEAVL, WQGLALLSEAVLR, QGLALLSEAVLRG, LALLSEAVLRGQA, ALLSEAVLRGQAL, LSEAVLRGQALLV, SEAVLRGQALLVN, EAVLRGQALLVNS, AVLRGQALLVNSS, QALLVNSSQPWEP, ALLVNSSQPWEPL, LLVNSSQPWEPLQ, QPWEPLQLHVDKA, EPLQLHVDKAVSG, LQLHVDKAVSGLR, LHVDKAVSGLRSL, KAVSGLRSLTTLL, SGLRSLTTLLRAL, RSLTTLLRALGAQ, SLTTLLRALGAQK, TTLLRALGAQKEA, TLLRALGAQKEAI, RALGAQKEAISPP, AQKEAISPPDAAS, EAISPPDAASAAP, SPPDAASAAPLRT, ASAAPLRTITADT, APLRTITADTFRK, RTITADTFRKLFR, TITADTFRKLFRV, DTFRKLFRVYSNF, RKLFRVYSNFLRG, KLFRVYSNFLRGK, FRVYSNFLRGKLK, RVYSNFLRGKLKL, YSNFLRGKLKLYT, SNFLRGKLKLYTG, NFLRGKLKLYTGE, RGKLKLYTGEACR, GKLKLYTGEACRT, LKLYTGEACRTGD, KLYTGEACRTGDR
Substitutions leading to the elimination of potential T-cell epitopes of human erythropoietin 2o (EPO) (WT = wild type).
ResidueWT Substitutions # residue T
T
T
T
T
T
T
I A C D E G H K N P Q R S
T
L A C D E G H K N P Q R S
T
T
T
T
T
T
T
T
T
T
T
T
T
T
T
ResidueWT
Substit utions # residue -EXAMPLE 6: De-immunized forms of G-CSF
The present invention provides for modified forms of human granulocyte colony stimulating factor (G-CSF) with one or more T-cell epitopes removed. G-CSF is an important haemopoietic cytokine currently used in treatment of indications where an increase in blood neutrophils will provide benefits. These include cancer therapy, various infectious diseases and related conditions such as sepsis. G-CSF is also used alone, or in combination with other compounds and cytokines in the ex vivo expansion of haemopoeitic cells for bone marrow transplantation.
Two forms of human G-CSF are commonly recognized for this cytokine. One is a protein of 177 amino acids, the other a protein of 174 amino acids [Nagata et al. (1986), EMBO J. 5:
575-581], the 174 amino acid form has been found to have the greatest specific in vivo biological activity. Recombinant DNA techniques have enabled the production of commercial scale quantities of G-CSF exploiting both eukaryotic and prokaryotic host cell expression systems. This disclosure specifically pertains to both recognized forms of the human G-CSF
protein being the 177 amino acid species and the 174 amino acid species.
Other polypeptide analogues and peptide fragments of G-CSF have been previously disclosed, including forms modified by site-specific amino acid substitutions and or by modification by chemical adducts. Thus US 4,810,643 discloses analogues with the particular Cys residues replaced with another amino acid, and G-CSF with an Ala residue in the first (N-terminal) position. EP 0 335 423 discloses the modification of at least one amino group in a polypeptide having G-CSF activity. EP 0 272 703 discloses G-CSF derivatives having amino acid substituted or deleted near the N-terminus. EP 0 459 630 discloses G-CSF
derivatives in which Cys 17 and Asp 27 are replaced by Ser residues. EP 0 243 153 discloses G-CSF
modified by inactivating at least one yeast KEX2 protease processing site for increased yield in recombinant production and US 4,904,584 discloses lysine altered proteins.
discloses further Cys altered variants and Australian patent document AU
10948/92 discloses the addition of amino acids to either terminus of a G-CSF molecule for the purpose of aiding in the folding of the molecule after prokaryotic expression. A further Australian document;
AU 76380/91, discloses G-CSF variants at positions 50-56 of the G-CSF 174 amino acid form, and positions 53-59 of the 177 amino acid form. Additional changes at particular His residues were also disclosed.
Non-deimmunized Fc-G-CSF is known e.g. from WO 99/58662. Specific Fc- G-CSF
forms:
Fcyl- G-CSF, Fc~y2- G-CSF, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human granulocyte colony stimulating factor (G-CSF) with potential human. MHC class II binding activity.
TPLGPASSLPQSF, SSLPQSFLLKCLE, QSFLLKCLEQVRK, SFLLKCLEQVRKI, FLLKCLEQVRKIQ, KCLEQVRKIQGDG, EQVRKIQGDGAAL, RKIQGDGAALQEK, AALQEKLVSECAT, EKLVSECATYKLC, KLVSECATYKLCH, AALQEKLCATYKL, EKLCATYKLCHPE, ATYKLCHPEELVL, YKLCHPEELVLLG,EELVLLGHSLGIP, ELVLLGHSLGIPW, HSLGIPWAPLSSC, IPWAPLSSCPSQA, APLSSCPSQALQL, QALQLAGCLSQLH, GCLSQLHSGLFLY, SQLHSGLFLYQGL, SGLFLYQGLLQAL, GLFLYQGLLQALE, LFLYQGLLQALEG, FLYQGLLQALEGI, QGLLQALEGISPE, GLLQALEGISPEL, QALEGISPELGPT, EGISPELGPTLDT, PTLDTLQLDVADF, DTLQLDVADFATT, LQLDVADFATTIW, LDVADFATTIWQQ, TTIWQQMEELGMA, TIWQQMEELGMAP, QQMEELGMAPALQ, EELGMAPALQPTQ, LGMAPALQPTQGA, PALQPTQGAMPAF, GAMPAFASAFQRR, PAFASAFQRRAGG, SAFQRRAGGVLVA, GGVLVASHLQSFL, GVLVASHLQSFLE, VLVASHLQSFLEV, SHLQSFLEVSYRV, QSFLEVSYRVLRH, SFLEVSYRVLRHL, LEVSYRVLRHLAQ
- SS -Substitutions leading to the elimination of potential T-cell epitopes of human granulocyte colony stimulating factor (G-CSF) (WT = wild type).
ResidueWT Substitution # Residue EXAMPLE 7: De-immacrzized forms of KGF
The present invention provides for modified forms of human keratinocyte growth factor (KGF) with one or more T-cell epitopes removed. KGF is a member of the fibroblast growth factor (FGF) / heparin-binding growth factor family of proteins. It is a secreted glycoprotein expressed predominantly in the lung, promoting wound healing by stimulating the growth of keratinocytes and other epithelial cells [Finch et al (1989), Science 24: 752-755; Rubin et al (1989), Proc. Natl. Acad. Sci. U.S.A. 86: 802-806]. The mature (processed) form of the glycoprotein comprises 163 amino acid residues and may be isolated from conditioned media following culture of particular cell lines [Rubin et al, (1989) ibid.), or produced using recombinant techniques [Ron et al (1993) J. Biol. Chem. 268: 2984-2988]. The protein is of therapeutic value for the stimulation of epithelial cell growth in a number of significant disease and injury repair settings. This disclosure specifically pertains the human KGF protein being the mature (processed) form of 163 amino acid residues. Others have also provided KGF molecules [e.g. US, 6,008,328; W090/08771;J including modified KGF [Ron et al (1993) ibid; W09501434] but Specific Fc- KGF forms: Fcyl- KGF, Fc~y2- KGF, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
Peptide sequences in human keratinocyte growth factor (KGF) with potential human MHC
class II binding activity.
NDMTPEQMATNVN, DMTPEQMATNVNC, EQMATNVNCSSPE, TNVNCSSPERHTR, RSYDYMEGGDIRV, YDYMEGGDIRVRR, DYMEGGDIRVRRL, GDIRVRRLFCRTQ, IRVRRLFCRTQWY, RRLFCRTQWYLRI, RLFCRTQWYLRID, TQWYLRIDKRGKV, QWYLRIDKRGKVK, WYLRIDKRGKVKG, LRIDKRGKVKGTQ, GKVKGTQEMKNNY, QEMKNNYNIMEIR, NNYNIMEIRTVAV, YNIMEIRTVAVGI, NIMEIRTVAVGIV, MEIRTVAVGIVAI, RTVAVGIVAIKGV, VAVGIVAIKGVES, VGIVAIKGVESEF, VAIKGVESEFYLA, KGVESEFYLAMNK, SEFYLAMNKEGKL, EFYLAMNKEGKLY, FYLAMNKEGKLYA, LAMNKEGKLYAKK, GKLYAKKECNEDC, KLYAKKECNEDCN, CNFKELILENHYN, KELILENHYNTYA, ELILENHYNTYAS, LILENHYNTYASA, NHYNTYASAKWTH, NTYASAKWTHNGG, AKWTHNGGEMFVA, GEMFVALNQKGIP, EMFVALNQKGIPV, FVALNQKGIPVRG, VALNQKGIPVRGK, KGIPVRGKKTKKE, IPVRGKKTKKEQK, KTKKEQKTAHFLP
Substitutions leading to the elimination of potential T-cell epitopes of human keratinocyte growth factor (KGF) (WT = wild type).
ResidueWT Substitution # residue M A C D E G H K N P Q R S T
M A C D E G H K N P Q R S T
EXAMPLE 8: De-immunized sTNF-R(1) and sTNF Inhibitor within corresponding Fc ficsions 5 Fc-sTNF-R(I) and Fc-sTNF Inhibitor are fusion proteins in which the serum half-life is extended compared to sTNF-R(I) and sTNF Inhibitor itself. However, certain forms of Fc-TNF-RI, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection. The present invention provides for modified forms of a soluble tumor necrosis factor receptor type I (sTNF-RI) with one or more T-cell epitopes removed.
The sTNF-RI (soluble tumor necrosis factor receptor type I) is a derivative of the human tumor necrosis factor receptor described previously [Gray, P.W. et al (1990) Proc. Nat. Acad.
Sci. U.S.A. 87: 7380-7384; Loetschere, H. et al, (1990) Cell 61: 351-359;
Schall, T.J. et al (1990) Cell 61: 361-370], comprising the extracellular domain of the intact receptor and exhibiting an approximate molecular weight of 30KDa. Additional soluble TNF
inhibitors and in particular a 40KDa form are also known [US 6,143,866]. The soluble forms are able to bind tumor necrosis factor alpha with high affinity and inhibit the cytotoxic activity of the cytokine in vitro. Recombinant preparations of sTNF-RI are of significant therapeutic value for the treatment of diseases where an excess level of tumor necrosis factor is causing a pathogenic effect. Indications such as cachexia, sepsis and autoimmune disorders including, and in particular, rheumatoid arthritis and others may be targeted by such therapeutic ~5 preparations of sTNF-RI. Others including Brewer et al., US, 6,143,866, have provided modified sTNF-RI molecules Peptide sequences in a human 30KDa sTNF-RI with potential human MHC class II
binding activity:
DSVCPQGKYIHPQ, KYIHPQNNSICCT, NSICCTKCHKGTY, TYLYNDCPGPGQD, YLYNDCPGPGQDT, NHLRHCLSCSKCR, HCLSCSKCRKEMG, KEMGQVEISSCTV, GQVEISSCTVDRD, VEISSCTVDRDTV, CTVDRDTVCGCRK, DTVCGCRKNQYRH, NQYRHYWSENLFQ, RHYWSENLFQCFN, HYWSENLFQCFNC, ENLFQCFNCSLCL, NLFQCFNCSLCLN, QCFNCSLCLNGTV, CSLCLNGTVHLSC, LCLNGTVHLSCQE, GTVHLSCQEKQNT, VHLSCQEKQNTVC, EKQNTVCTCHAGF, NTVCTCHAGFFLR, GFFLRENECVSCS, FFLRENECVSCSN, ECVSCSNCKKSLE, KSLECTKLCLPQI, TKLCLPQIENVKG, LCLPQIENVKGTE, PQIENVKGTEDSG, SGTTVLLPLVIFF
Peptide sequences in a human 40KDa sTNF inhibitor with potential human MHC
class II
binding activity.
TPYAPEPGSTCRL, CRLREYYDQTAQM, REYYDQTAQMCCS, EYYDQTAQMCCSK, AQMCCSKCSPGQH, KCSPGQHAKVFCT, AKVFCTKTSDTVC, KVFCTKTSDTVCD, STYTQLWNWVPEC, TQLWNWVPECLSC, QLWNWVPECLSCG, NWPECLSCGSRC, ECLSCGSRCSSDQ, SRCSSDQEVTQAC, QEVTQACTREQNR, QNRICTCRPGWYC, NRICTCRPGWCA, PGWYCALSKQEGC, GWCALSKQEGCR, CALSKQEGCRLCA, APLRKCRPGFGVA, PGFGVARPGTETS, FGVARPGTETSDV, SDWCKPCAPGTF, GTFSNTTSSTDIC, TDICRPHQICNW, HQICNWAIPGNA, ICNWAIPGNASR, CNWAIPGNASRD, NWAIPGNASRDA, VAIPGNASRDAVC, DAVCTSTTTPTRS, _ 59 _ TRSMAPGAVHLPQ, RSMAPGAVHLPQP, VHLPQPVSTRSQH, QPVSTRSQHTQPT, PEPSTAPSTSFLL, SFLLPMGPSPPAE, FLLPMGPSPPAEG
EXAMPLE 9 (soluble TNF-R2):
Fc-sTNF-R2 is a fusion proteins in which the serum half-life is extended compared to sTNF-R2 itself. However, certain forms of Fc-TNF-R2, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection.
Soluble tumor necrosis factor receptor 2 (sTNF-R2) is a derivative of the human tumor necrosis factor receptor 2 described previously [Smith, C.A. et al (1990) Science 248: 1019-1023; Kohno, T. et al (1990) Proc. Nat. Acad. Sci. U.S.A. 87: 8331-8335;
Beltinger, C.P. et al (1996) Genomics 35:94-100] comprising the extracellular domain of the intact receptor. The soluble forms are able to bind tumour necrosis factor with high affinity and inhibit the cytotoxic activity of the cytokine in vitro. Recombinant preparations of sTNF-R2 are of significant therapeutic value for the treatment of diseases where an excess level of tumour necrosis factor is causing a pathogenic effect. A particular recombinant preparation termed ethanercept has gained clinical approval for the treatment of rheumatoid arthritis and this and other similar agents may be of value in the treatment of other indications such as cachexia, sepsis and autoimmune disorders. Ethanercept is a dimeric fusion protein comprising the 2o extracellular domain of the human TNFR2 molecule in combination with the Fc domain of the human IgGI molecule. The dimeric molecule comprises 934 amino acids [US,5,395,760;
US,5,605,690; US,5,945,397].
Peptide sequences in the TNF binding domain of the human TNFR2 protein with potential human MHC class II binding activity are:
TPYAPEPGSTCRL,CRLREYYDQTAQM,REYYDQTAQMCCS,EYYDQTAQMCCSK, AQMCCSKCSPGQH, KCSPGQHAKVFCT,AKVFCTKTSDTVC,KVFCTKTSDTVCD, STYTQLWNWVPEC, TQLWNWVPECLSC,QLWNWVPECLSCG,NWPECLSCGSRC, ECLSCGSRCSSDQ, SRCSSDQEVTQAC,QEVTQACTREQNR,QNRICTCRPGWC, NRICTCRPGWYCA, PGWCALSKQEGC,GWYCALSKQEGCR,CALSKQEGCRLCA, APLRKCRPGFGVA,PGFGVARPGTETS,FGVARPGTETSDV,SDWCKPCAPGTF, GTFSNTTSSTDIC, TDICRPHQICNW,HQICNWAIPGNA, ICNWAIPGNASR, CNWAIPGNASRD, NWAIPGNASRDA,VAIPGNASRDAVC,DAVCTSTTTPTRS, TRSMAPGAVHLPQ, RSMAPGAVHLPQP,VHLPQPVSTRSQH,QPVSTRSQHTQPT, PEPSTAPSTSFLL, SFLLPMGPSPPAE,FLLPMGPSPPAEG
EXAMPLE 10: non-natural orms of Beta-Glucocerebrosidase (/3-GCR) Fc - a-GCR is a fusion proteins in which the serum half-life is extended compared to the a-GCR itself. However, certain forms of Fc - ~i-GCR, such as when the Fc is derived from human IgGI or human IgG3, have the potential to show enhanced immunogenicity under certain circumstances, such as administration by subcutaneous injection. The present invention provides for modified forms of human GCR, preferably Fc-f3-GCR, with one or more T-cell epitopes removed.
Beta-Glucocerebrosidase (b-D-glucosyl-N-acylsphingosine glucohydrolase, E.C.
3.2.1.45) is a monomeric glycoprotein of 497 amino acid residues. The enzyme catalyses the hydrolysis of to the glycolipid glucocerebroside to glucose and ceramide. Deficiency in GCR
activity results in a lysosomal storage disease referred to as Gaucher disease. The disease is characterised by the accumulation of glucocerebroside engorged tissue macrophages that accumulate in the liver, spleen, bone marrow and other organs. The disease has varying degrees of severity from type 1 disease with haematologic problems but no neuronal involvement, to type 2 disease manifesting early after birth with extensive neuronal involvement and is universally progressive and fatal within 2 years of age. Type 3 disease is also recognised in some classifications and also shows neurologic involvement. Previously the only useful therapy for Gaucher disease has been administration of GCR derived from human placenta (known as alglucerase) but more recently pharmaceutical preparations of recombinant GCR
("Ceredase"
and "Cerezyme") have shown efficacy in the treatment of type I disease [Niederau, C. et al (1998) Eur. J. Med. Res. 3: 25-30].
According to the invention, the particular commercial forms of glucocerebrosidase are examined at predicted to be particularly immunogenic because these forms are engineered to have a high mannose oligosaccharide. Upon administration of such a protein, such as Ceredase or Cerezyme, the non-natural protein is preferentially bound by mannose receptors on antigen-presenting cells such as macrophages or dendritic cells. The non-natural protein is then taken up, a portion is degraded into peptides, and the peptides presented through MHC
Class II to the T-cell receptor. By mutating the glucocerebrosidase sequence such that derived peptides cannot bind to MHC Class II, immunogenicity is reduced.
Others have provided GCR molecules including modified GCR [US,5,236,838 ] but this teaching does not recognize the importance of T-cell epitopes to the immunogenic properties of the protein.
Peptide sequences in human f3-GCR with potential human MHC class II binding activity are:
PCIPKSFGYSSW,KSFGYSSWCVCN,FGYSSVVCVCNAT,SSWCVCNATYCD,SWCVCNATYCDS, VCVCNATYCDSFD,ATYCDSFDPPTFP,DSFDPPTFPALGT,PTFPALGTFSRYE,PALGTFSRYESTR, GTFSRYESTRSGR,SRYESTRSGRRME,GRRMELSMGPIQA,RRMELSMGPIQAN,RMELSMGPIQANH, MELSMGPIQANHT,LSMGPIQANHTGT,MGPIQANHTGTGL,GPIQANHTGTGLL,TGLLLTLQPEQKF, GLLLTLQPEQKFQ,LLLTLQPEQKFQK,LTLQPEQKFQKVK,TLQPEQKFQKVKG,PEQKFQKVKGFGG, QKFQKVKGFGGAM,QKVKGFGGAMTDA,KGFGGAMTDAAAL,GFGGAMTDAAALN,GAMTDAAALNILA, AMTDAAALNILAL,MTDAAALNILALS,AALNILALSPPAQ,ALNILALSPPAQN,LNILALSPPAQNL, NILALSPPAQNLL,LALSPPAQNLLLK,ALSPPAQNLLLKS,PAQNLLLKSYFSE,AQNLLLKSYFSEE, LOQNLLLKSYFSEEG,NLLLKSYFSEEGI,LLLKSYFSEEGIG,KSYFSEEGIGYNI,SYFSEEGIGYNII, FSEEGIGYNIIRV,EGIGYNIIRVPMA,GIGYNIIRVPMAS,IGYNIIRVPMASC,YNIIRVPMASCDF, NIIRVPMASCDFS,IIRVPMASCDFSI,IRVPMASCDFSIR,VPMASCDFSIRTY,PMASCDFSIRTYT, SCDFSIRTYTYAD,CDFSIRTYTYADT,FSIRTYTYADTPD,RTYTYADTPDDFQ,TYTYADTPDDFQL, YTYADTPDDFQLH,ADTPDDFQLHNFS,PDDFQLHNFSLPE,DDFQLHNFSLPEE,FQLHNFSLPEEDT, 15HNFSLPEEDTKLK,FSLPEEDTKLKIP,SLPEEDTKLKIPL,EEDTKLKIPLIHR,TKLKIPLIHRALQ, KLKIPLIHRALQL,LKIPLIHRALQLA,IPLIHRALQLAQR,PLIHRALQLAQRP,HRALQLAQRPVSL, RALQLAQRPVSLL,ALQLAQRPVSLLA,LQLAQRPVSLLAS,RPVSLLASPWTSP,PVSLLASPWTSPT, VSLLASPWTSPTW,SLLASPWTSPTWL,SPWTSPTWLKTNG,TSPTWLKTNGAVN,PTWLKTNGAVNGK, TWLKTNGAVNGKG,GAWGKGSLKGQP,GSLKGQPGDIYHQ,GDIYHQTWARYFV,DIYHQTWARYFVK, 20QTWARYFVKFLDA,WARYFVKFLDAYA,ARYFVKFLDAYAE,RYFVKFLDAYAEH,YFVKFLDAYAEHK, FVKFLDAYAEHKL,VKFLDAYAEHKLQ,KFLDAYAEHKLQF,DAYAEHKLQFWAV,YAEHKLQFWAVTA, HKLQFWAVTAENE,LQFWAVTAENEPS,QFWAVTAENEPSA,FWAVTAENEPSAG,WAVTAENEPSAGL, VTAENEPSAGLLS,PSAGLLSGYPFQC,AGLLSGYPFQCLG,GLLSGYPFQCLGF,SGYPFQCLGFTPE, YPFQCLGFTPEHQ,QCLGFTPEHQRDF,LGFTPEHQRDFIA,FTPEHQRDFIARD,RDFIARDLGPTLA, 25DFIARDLGPTLAN,RDLGPTLANSTHH,LGPTLANSTHHNV,PTLANSTHHNVRL,HNVRLLMLDDQRL, VRLLMLDDQRLLL,RLLMLDDQRLLLP,LLMLDDQRLLLPH,LMLDDQRLLLPHW,DDQRLLLPHWAKV, DQRLLLPHWAKW,QRLLLPHWAKVVL,RLLLPHWAKVVLT,LLLPHWAKVVLTD,PHWAKWLTDPEA, WAKWLTDPEAAK,AKWLTDPEAAKY,KWLTDPEAAKW, WLTDPEAAKYVH,EAAKYVHGIAVHW, AKWHGIAVHWL, KYVHGIAVHWYLD,YVHGIAVHWLDF,HGIAVHWLDFLA,IAVHWLDFLAPA, 30VHWLDFLAPAKA,HWYLDFLAPAKAT,WYLDFLAPAKATL,LDFLAPAKATLGE,DFLAPAKATLGET, AKATLGETHRLFP,ATLGETHRLFPNT,GETHRLFPNTMLF,ETHRLFPNTMLFA,THRLFPNTMLFAS, HRLFPNTMLFASE,RLFPNTMLFASEA,FPNTMLFASEACV,NTMLFASEACVGS,TMLFASEACVGSK, MLFASEACVGSKF,ACVGSKFWEQSVR,GSKFWEQSVRLGS,SKFWEQSVRLGSW,KFWEQSVRLGSWD, QSVRLGSWDRGMQ,VRLGSWDRGMQYS,RLGSWDRGMQYSH,GSWDRGMQYSHSI,WDRGMQYSHSIIT, 35RGMQYSHSIITNL,MQYSHSIITNLLY,QYSHSIITNLLYH,YSHSIITNLLYHV,HSIITNLLYHWG, SIITNLLYHWGW,TNLLYHWGWTDW,NLLYHWGWTDWN,LLYHWGWTDWNL,YHWGWTDWNLAL, HWGWTDWNLALN,WGWTDWNLALNP,VGWTDWNLALNPE,TDWNLALNPEGGP,WNLALNPEGGPNW, LALNPEGGPNWR,PNWRNFVDSPII,NWRNFVDSPIIV,RNFVDSPIIVDIT,NFVDSPIIVDITK, SPIIVDITKDTFY,PIIVDITKDTFYK,IIVDITKDTFYKQ,VDITKDTFYKQPM,DTFYKQPMFYHLG, 40TFYKQPMFYHLGH,QPMFYHLGHFSKF,PMFYHLGHFSKFI,MFYHLGHFSKFIP,YHLGHFSKFIPEG, GHFSKFIPEGSQR, SKFIPEGSQRVGL, KFIPEGSQRVGLV, IPEGSQRVGLVAS, QRVGLVASQKNDL, VGLVASQKNDLDA, GLVASQKNDLDAV, SQKNDLDAVALMH, NDLDAVALMHPDG, DAVALMHPDGSAV, VALMHPDGSAVW, ALMHPDGSAVVW, SAVVVVLNRSSKD, AVVWLNRSSKDV, VVVVLNRSSKDVP, VVVLNRSSKDVPL, VVLNRSSKDVPLT, KDVPLTIKDPAVG, VPLTIKDPAVGFL, PLTIKDPAVGFLE, LTIKDPAVGFLET, PAVGFLETISPGY, VGFLETISPGYSI, GFLETISPGYSIH, FLETISPGYSIHT, ETISPGYSIHTYL, PGYSIHTYLWHRQ, PGYSIHTYLWRRQ
EXAMPLE 11: De-immacnized forms o Fc-IL2 Non-deimmunized Fc-IL2 was described e.g. in WO 96/08570. Specific de-immunized Fc-1o IL2 forms: Fcyl- II? , Fcy2- IL,2 , both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 12: De-immccnized forms Fc-IL12 Non-deimmunized Fc- IL12 was described e.g. in WO 99/29732. Specific de-immunized Fc-IL12 forms: Fcyl- IL.12 , Fcy2- IL12, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 13: De-immccnized forms of Fc-TNFa Non-deimmunized Fc- TNFa was described e.g. in WO 99/43713. Specific de-immunized Fc-TNFa forms: Fc~yl- TNFa , Fc~y2- TNFa , both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
SAMPLE 14: De-immccnized forms of Fc-GM-CSF
Non-deimmunized Fc- GM-CSF was described e.g. in WO 99/43713 and WO 01/07081.
Specific de-immunized Fc- GM-CSF forms: Fc~yl- GM-CSF , Fcy2- GM-CSF , both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 15: De-immccnized forms of Fc-subtilisin Specific de-immunized Fc- subtilisin forms: Fc~yl- subtilisin , Fc~y2-subtilisin, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 16: De-immuni .zed forms of Fc-instcli.n Specific de-immunized Fc- insulin forms: Fcyl- insulin , Fcy2- insulin, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
EXAMPLE 17: De-immunized forms of Fc-PSMA
Non-deimmunized Fc- PSMA was described e.g. in WO 96/08570 and WO 01/0708.
Specific de-immunized Fc- PSMA forms: Fcyl- PSMA , Fcy2- PSMA, both forms, preferably with linker peptide and optionally modified Fc domain having reduced affinity to Fc-receptors.
io EXAMPLE 18:
De-immunized fusion proteins comprising anti-EGFR antibodies fused to a cytokine Humanized and murine monoclonal antibody 425 (hMAb 425, US 5,558,864; EP 0531 472), murine and chimeric monoclonal antibody 225 (cMAb 225, US 4,943,533 and EP
0359 282) and murine and humanized MAb 4D5 (hMab 4D5 = Herceptin~) have been de-immunized according to the invention and fused to a de-immunized IL2 or a non-modified IL-2.
Fusions of antibodies to cytokines represent a situation where the need to reduce immunogenicity is particularly great. Normally, therapeutic antibodies can induce anti-idiotype antibodies that neutralize the effectiveness of a therapeutic antibody. This is particularly true when a therapeutic antibody is administered at low or medium levels, as opposed to very high levels where tolerance can be induced. For example, the therapeutic antibodies Herceptin and Rituxan are generally given in high doses of a few hundred milligrams. In contrast, antibody-cytokine fusions are generally given in a lower dose on the order of a few milligrams. Thus, the dose of an antibody-cytokine fusion is in the range that tends to promote formation of anti-idiotype antibodies. The presence of the linked cytokine tends to exaggerate the immunogenicity of the already immunogenic antibodies.
Antibody 425 is a non-human antibody which is directed to antigen EGF-R and reacts with colon cancer cells. This antibody has been fused to IL-2, as described in Example 13. The presence of IL-2 or another cytokine enhances the immunogenicity of the antibody, in particular the V regions.
In the following paragraphs the invention is described in more detail for the monoclonal anti-EGFR antibody 425- IL2 construct which was shown to have a high therapeutic value.
However, the invention is not limited to this antibody and said construct and its several existing forms, but can be extended to other anti-EGFR antibodies and their fusion constructs, preferably cytokine fusion immunoglobulins, above all chimeric antibody 225 (c225 - Il-2), which has very similar properties. In prinicipal, non-human, chimeric or humanized versions of the anti-EGFR antibodies can be used to synthesize said IL-2 fusion molecules Unless stated otherwise all amino acids in the variable heavy and light chains are numbered as in Kabat et al, 1991 (Sequences of Proteins of Immunological Interest, US
Department of Health and Human Services). Potential T-cell epitopes are numbered with the linear number of the first amino acid of an epitope, counting from the first amino acid of the heavy and light chains.
1. Comparison with Mouse Subgroup Frameworks The amino acid sequences of murine 425 VH (heavy chain) and VK (light chain) were compared to consensus sequences for the Kabat murine heavy and light chain subgroups. 425 VH can be assigned to mouse heavy chains subgroup IIB. The comparison with the consensus sequence for this subgroup shows that the serine at position 94 in 425 VH is unusual. The most common residue at this position is arginine. 425 VK can be assigned to mouse kappa chains subgroup Vl. The comparison with the consensus sequence for this subgroup shows that the residues at positions 45-47, 60 and 100 in 425 VK are unusual for this subgroup.
Amino acid residue numbering is as per Kabat.
2. Comparison with Human Frameworks The amino acid sequences of murine 425 VH (variable heavy chain) and VK
(variable kappa light chain) were compared to the sequences of the directory of human germline VH
(Tomlinson, LM et al., (1992) J. Mol.Biol. 227: 776-798) and VK (Cox, J.P.L.
et al., (1994) Eur. J. Immunol. 24:827-836) sequences and also to human germline J region sequences (Routledge, E.G. et al., in, Protein Engineering of Antibody Molecules for Prophylactic and Therapeutic Applications in Man, Clark, M. ed. Academic Titles, Nottingham, UK, ppl3-44, 1991). The murine 425 sequence of the heavy and light chain can be taken, for example, from EP 0531 472.
The reference human framework selected for 425 VH was VH1GRR with human JH6.
The sequence of VH1GRR in the directory ends at residue 88. Therefore there is no corresponding residue for the unusual serine at position 94 of the murine sequence. This germline sequence has been found in a rearranged mature antibody gene with 4 amino acid changes.
The reference human framework selected for 425 VK was L6/vg with human JK2. This germline sequence has been found in a rearranged mature antibody heavy chain with no amino acid changes.
3. Design of "veneered" sequences Following identification of the reference human framework sequences, certain non-identical amino acid residues within the 425 VH and VK frameworks were changed to the corresponding amino acid in the human reference framework sequence. Residues which are considered to be critical for antibody structure and binding were excluded from this process and not altered: The murine residues that were retained at this stage are largely non-surface, buried residues, apart from residues at the N-terminus for instance, which are close to the CDRs in the final antibody (1 - 8, preferably 1 - 5 amino acid residues). This process produces a sequence that is broadly similar to a "veneered" antibody as the surface residues are mainly to human and the buried residues are as in the original murine sequence.
4. Peptide Threading Analysis The murine and veneered 425 VH and VK sequences were analyzed using the method according of the invention. The amino acid sequences are divided into all possible l3mers.
The lamer peptides are sequentially presented to the models of the binding groove of the HLA-DR allotypes and a binding score assigned to each peptide for each allele.
A
conformational score is calculated for each pocket-bound side chain of the peptide. This score is based on stetic overlap, potential hydrogen bonds between peptide and residues in the binding groove, electrostatic interactions and favorable contacts between peptide and pocket residues. The conformation of each side chain is then altered and the score recalculated.
Having determined the highest conformational score, the binding score is then calculated based on the groove-bound hydrophobic residues, the non-groove hydrophilic residues and the number of residues that fit into the binding groove. Peptides which are known binders to human MHC Class II achieve a high binding score with almost no false negatives. Thus peptides that achieve a significant binding score in the current analysis are considered to be potential T-cell epitopes. The results of the peptide threading analysis are shown in Table 1 for 425 VH and 425 VK. Potential T Cell epitopes are referred to by the linear number of the first residue of the lamer.
Table 1: Potential T-cell epitopes in murine and veneered 425 sequences Sequence Number of potentialNumber of first residue of lamer with number of T-cell epitopesbonding alleles in brackets Murine 425 8 31(7), 35(17), 43(7), 46(8), 58(10), VH 62(12), 81(11), 84(16) Veneered 425 7 31(7), 43(7), 46(8), 58(10), 62(11), VH 81(11), 84(16) Sequence Number of potentialNumber of first residue of lamer with number of T-cell epitopesbonding alleles in brackets Murine 425 9 1(8), 2(5), 17(5), 27(5), 43(16), VK 72(18), 75(10), 92(10), 93(17) Veneered 425 4 27(5), 43(16), 92(8), 93(17) VK
5. Removal of Potential T Cell Epitopes The numbering of amino acid residues for substitution is as per Kabat.
Potential T Cell epitopes are referred to by the linear number of the first residue of the lamer.
The amino acid substitutions required to remove the potential T-cell epitopes from the veneered 425 heavy chain variable region were as follows:
~ Substitution of proline for alanine at residue 41 (Kabat number 41) removes the potential epitope at residue number 31.
~ Substitution of proline for leucine at residue 45 (Kabat number 45) removes the potential epitope at residue number 43. A proline at position 45 is found in a human germline VH sequence, DP52.
~ Substitution of alanine for isoleucine at residue 48 (Kabat number 48) removes the potential epitope at residue number 46.
~ Substitution of valine for alanine at residue 68 (Kabat number 67) removes the potential epitope at residue number 58.
~ Substitution of isoleucine for leucine at residue 70 (Kabat number 69) removes the potential epitope at residue number 62.
~ Substitution of threonine for serine at residue 91 (Kabat number 87) removes the potential epitopes at residue numbers 81 and 84.
2o The amino acid substitutions required to remove the potential T-cell epitopes from the veneered 425 light chain variable region were as follows:
~ Substitution of histidine for tyrosine at residue 35 (Kabat number 36) removes the potential epitope at residue number 27 ~ Substitution of alanine for threonine at residue SO (Kabat number 51) removes the potential epitope at residue number 43. This residue is within CDR2. Alanine is commonly found at this position in both human and murine antibodies. An alternative substitution to eliminate this epitope is alanine for leucine at position 45 (Kabat number 46). There is no conservative substitution that will eliminate the potential epitope. Alanine is found at this position in some antibodies.
~ Substitution of proline for isoleucine at residue 94 (Kabat number 95) removes the potential epitope at residue number 92. Kabat residue 95 is within CDRL3.
Proline is common at this position in mouse antibody sequences and there is no change outwith the CDR that eliminates the potential epitope.
~ Substitution of valine for leucine at residue 103 (Kabat number 104) removes the potential epitope at residue number 93.
6. Design of de-immur2ized Sequences 1o De-immunized heavy and light chain variable region sequences were designed with reference to the changes required to remove potential T-cell epitopes and consideration of framework residues that might be critical for antibody structure and binding. In addition to the De-immunized sequences based on the veneered sequence. an additional sequence was designed for each of VH and VK based on the murine sequence, termed the Mouse Peptide Threaded (Mo PT) version. For this version, changes were made directly to the murine sequence in order to eliminate T-cell epitopes, but only changes out with the CDRs that are not considered to be detrimental to binding are made. No attempt to remove surface (B-cell) epitopes has been made in this version of the de-immunized sequence.
The primary de-immunized VH includes substitutions 1 to 6 in Section 5 above and includes 2o no potential T-cell epitopes. A further 4 de-immunized VH sequences were designed in order to test the effect of the various substitutions required on antibody binding.
The cumulative alterations made to the primary de-immunized sequence (425 VH1GRR-VH-vl) and the potential T-cell epitopes remaining are detailed in Table 2. The mouse threaded version is included for comparison.
Table 2: Amino acid changes and potential epitopes in de-immunized 425 VH
Variant Cumulative Residue Potential T Cell Epitopes Changes 425 VH1GRR-VH-vl None None 425 VH1GRR-VH-v2 48A ~ I 46(8) 425 VH1GRR-VH-v3 45P ~ L 43(7), 46(8) 425 VH1GRR-VH-v4 67V ~ A, 69I ~ L 43(7). 46(8), 58(10), 62(11) 425 VH1GRR-VH-v5 41P ~ A 31(7), 43(7), 46(8), 58(10), 62(11) 425 VH-MoPT NA 43(7), 46(8) The primary de-immunized VK includes substitutions 1 to 4 in Section 5 above and includes no potential T-cell epitopes. A further 4 de-immunized VK sequences were designed in order to test the effect of the various substitutions required on antibody binding.
Version 2 is an alternative to Version 1 in which an alternative substitution has been used to remove the same potential T-cell epitope. The cumulative alterations made to the primary de-immunized sequence (425 L6-vg-VK-vl) and the potential T-cell epitopes remaining are detailed in Table 3. The mouse threaded version is included for comparison.
Table 3: Amino acid changes and potential epitopes in de-immunized 425 VK
Variant Cumulative Residue Changes Potential T-cell Epitopes 425 L6-vg-VK-vl None None 425 L6-vg-VK-vl 51 A ~ T, 46L ~ A None 425 L6-vg-VK-vl 46 A ~ L 43(16) 425 L6-vg-VK-vl 95 P ~ I 43(16), 92(8) 425 L6-vg-VK-vl 36 H ~ Y 27(5), 43(16), 92(8) 425VK-MoPT NA 27(5), 43(16), 92(8) Table 4: original and "veneered" sequences of VH and VK of murine MAb 425 425 VH mouse QVQLQQPGAELVKPGASVKLSCKASGYTFTSHWMHWVKQRAGQGLEWIGEFNPSNGRTNYNEKFKSKAT
LTVDKSSSTAYMQLSSLTSEDSAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 VK mouse IS QIVLTQSPAIMSASPGEKVTMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTS
YSLTISRMEAEDAATYYCQQWSSHIFTFGSGTKLEIK
425 VH veneered:
QVQLVQSGAELVKPGRSVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYNEKFKSRAT
LTVDKSTSTAYMQLSSLTSEDSAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 VK veneered:
QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKLEIK
Table S: De-immunized sequences of variable heavy and light chain of MAb 425 425 de-immtcnized VHI
QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWAGEFNPSNGRTNYNEKFKSRVT
ITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYTiJGQGTTLTVSS
425 de-immunized VK1 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDASNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK
425 de-immunized VH2 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGPEWIGEFNPSNGRTNYNEKFKSRVT
ITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VK2 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRALIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK
425 de-immunized VH3 QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYNEKFKSRVT
ITVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VK3 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHPFTFGQGTKVEIK
425 de-immunized VH4 QVQLVQSGAELVKPGASVKLSCKASGYTFTSH4iiMHWVKQAPGQGLEWIGEFNPSNGRTNYNEKFKSRAT
LTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VK4 QIVLTQSPATLSASPGERATMSCSASSSVTYMYWHQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK
425 de-immunized VHS
QVQLVQSGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAAGQGLEWIGEFNPSNGRTNYNEKFKSRAT
LTVDKSTSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 de-immunized VKS
QIVLTQSPATLSASPGERATMSCSASSSVTYMYWYQQKPGQSPRLLIYDTSNLASGVPARFSGSGSGTS
YTLTISSLEAEDAATYYCQQWSSHIFTFGQGTKVEIK
425 VH mouse, peptide threaded (Mo PT) QVQLQQPGAELVKPGASVKLSCKASGYTFTSHWMHWVKQAPGQGLEWIGEFNPSNGRTNYNEKFKSRVT
ITVDKSSSTAYMQLSSLTSEDTAVYYCASRDYDYDGRYFDYWGQGTTLTVSS
425 VK mouse, peptide threaded (Mo PT) QIVLTQSPATLSASPGEKATMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTS
YSLTISRLEAEDAATYYCQQWSSHIFTFGQGTKVEIK
As already mentioned, the modified anti-EGFR antibody - cytokine constructs according to the invention, preferably MAb 425 - I12, can be used in pharmaceutical compositions and pharmaceutical kits preferably for the treatment of cancer. "Cancer" and "tumor" refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. By means of the pharmaceutical compositions according of the present invention tumors can be treated such as tumors of the breast, heart, lung, small intestine, colon, spleen, kidney, bladder, head and neck, ovary, prostate, brain, pancreas, skin, bone, bone marrow, blood, thymus, uterus, testicles, cervix, and liver.
In analogy to antibody 425 similar fusion constructs can be obtained using monoclaonal antibody 225 in murine, chimeric or humanized forms.
EXAMPLE 19: De-immasnized forms of 14.18 antibody - IL2 and KS- 1/4 - IL2 .
to The cytokine interleukin 2 (IL-2) has been fused to specific monoclonal antibodies KS-1/4 and ch 14.18 directed to the tumor associated antigens epithelial cell adhesion molecule (Ep-CAM, KSA, KS 1/4 antigen) and the disialoganglioside GD, respectively, to form the fusion proteins ch14.18-IL-2 and KS1/4-IL-2, respectively, (US 5,650,150, EP 0 338 767).
Theses antibodies have been de-immunized according to the invention and fused to a immunogenicly modified IL2 or a non-modified IL-2.
Anti-EpCAM antibody KS 1/4 The monoclonal antibody KS 1/4 is a murine antibody that specifically binds to the 40,000 dalton cell surface antigen EpCAM (epithelial cell adhesion molecule) found in high density on adenocarcinoma cells and also found at much lower levels on certain normal epithelial 2o cells. This antibody has been shown to be effective for the detection of disease.
A variety of fusions of KS-1/4 to single and combined cytokines such as IL-2 and IL-12, have been described (W098/25978, WO01/58957A, and WO 01/10912). These fusion proteins are effective in animal models of cancer. However, due to the presence of cytokines, these fusion proteins are particularly immunogenic. There is a need for altered KS antibody molecules with a reduced propensity to elicit an immune response on administration to the human host.
Modified sequences in Mab KS 1/4 providing a modified KS antibody according to the invention are shown below. A mutated form of the KS-1/4 in which the T-cell epitopes in the V regions were completely removed by mutation, as defined by the criteria given above in the section on computer algorithms, was efficiently expressed in mammalian cells and bound to the EpCAM antigen with only about an 8-fold reduction of affinity. This molecule was termed VHvI/VKvI. A second antibody, VHv2/VKvI, had only about a 3-fold reduction in affinity and differed from VHvI/VKvI by a single amino acid substitution.
These two antibodies have been expressed in mammalian cells as KS-IL2 fusion proteins.
The KS(VHvI/VKvI)-IL2 and KS(VHv2/VKvI) are the most preferred embodiments of the invention with respect to treatment of a broad spectrum of human cancers by immune therapy.
1 Comparison with Mouse Subgroup Frameworks The amino acid sequences of murine KS VH and VK were compared to consensus sequences for the Kabat murine heavy and light chain subgroups (Kabat et al., 1991).
Murine KS VH
cannot be assigned to any one Subgroup, but is closest to Subgroup II(A) and V(A). Unusual residues are found at position 2 which is normally valine, 46 which is normally glutamic acid, and 68 which is normally threonine. Residue 69 is more commonly leucine or iso-leucine. At 82b, serine is most often found. Murine KS VK can be assigned to Sub~rou~ VI ( ' Figure 2).
1o Unusual residues are found at 46 and 47 which are commonly both leucine.
Residue 58 is unusual with either leucine or valine normally found at this position.
2 Comparison with Human Frameworks The amino acid sequences of murine KS VH and VK were compared to the sequences of the directory of human germline VH (Tomlinson et al., 1992) and VK (COX et al.
1994) sequences and also to human germline J region sequences (Routledge et al., 1993). The reference human framework selected for KS VH was DP10 with human JH6. This germline sequence has been found in a rearranged mature antibody gene with no amino acid changes.
The reference human framework selected for KS VK was B 1. For framework- 2 the sequence of the mature human antibody >ZVVIEV was used (in Kabat et al 1991). This sequence is identical to the murine sequence immediately adjacent to CDR2. The J region sequence was human JK4. This germline sequence has not been found as rearranged mature antibody light chain.
3 Design of Veneered Sequences Following identification of the reference human framework sequences, certain non-identical amino acid residues within the 425 VH and VK frameworks were changed to the corresponding amino acid in the human reference sequence. Residues which are considered to be critical for antibody structure and bindin2 were excluded from this process and not altered.
The murine residues that were retained at this stage are largely non-surface, buried residues, apart from residues at the N-terminus for instance, which are close to the CDRs in the final antibody. This process produces a sequence that is broadly similar to a "veneered" antibody as the surface residues are mainly human and the buried residues are as in the original murine sequence.
4 Peptide Threading Analysis The murine and veneered KS VH and VK sequences were analyzed using the method according to the invention. The amino acid sequences are divided into all possible l3imers.
The 13-mer peptides are sequentially presented to the models of the binding groove of the HLA-DR allotypes and a binding score assigned to each peptide for each allele.
A
conformational score is calculated for each pocket-bound side chain of the peptide. This score is based on steric overlap, potential hydrogen bonds between peptide and residues in the binding groove, electrostatic interactions and favorable contacts between peptide and pocket residues. The conformation of each side chain is then altered and the score recalculated.
Having determined the highest conformational score, the binding score is then calculated 1o based on the (groove-bound hydrophobic residues, the non-groove hydrophilic residues and the number of residues that fit into the binding groove. Known binders to MHC
class II
achieve a significant binding score with almost no false negatives. Thus peptides achieving, a significant binding score from the current analysis are considered to be potential T-cell epitopes. The results of the peptide threading analysis for the murine and veneered sequences are shown in Table 1.
Table 1: Potential T-cell epitopes in murine and veneered KS sequences Sequence Number of potentialLocation of potential epitopes T- (no. of potential cell epitopes MHC binders) Murine KS VH 6 35(11), 62(17), 78(12), 81(12), 89(6), 98(15) Murine KS VH 5 30(7), 62(15), 78(11), 89(6), 98(15) Murine KS VK 6 1(14), 2(5), 17(5), 27(5), 51(13), 72(18) Veneered KS VK 3 1(17), 27(5), 51(13) S Removal of Potential T Cell Epitopes Potential T-cell epitopes are removed by making amino acid substitutions in the particular peptide that constitutes the epitope. Substitutions were made by inserting amino acids of similar physicochemical properties if possible. However in order to remove some potential epitopes, amino acids of different size, charge or hydrophobicity may need to be substituted. if changes have to made within CDRs which might have an effect on binding, there is then a need to make a variant with and without the particular amino acid substitution. Numbering of amino acid residues for substitution is as per Kabat. Potential T Cell epitopes are referred to by the linear number of the first residue of the lamer.
The amino acid changes required to remove T-cell epitopes from the veneered KS
heavy chain variable region were as follows: -1. Substitution of arginine for lysine at residue 38 (Kabat number 38) removes the potential epitope at residue no 30.
2. Substitution of alanine for leucine at residue 72 (Kabat number 71) and isoleucine for phenylalanine at residue 70 (Kabat number 69) removes the potential epitope at residue 62. An isoleucine at Kabat number 69 and alanine at Kabat number 71 is found in a human germline VH sequence, DP10.
3. Substitution of leucine for alanine at residue 79 (Kabat number 78) removes the t0 potential epitope at residue number 78.
4. Substitution of threonine for methionine at residue 91 (Kabat number 87), removes the potential epitope at residue number 89.
5. Substitution of methionine for at isoleucine residue 100 (Kabat number 96) in CDRH3 removes the potential epitope at residue 98. There is no change out with CDRH3 which removes this potential epitope.
The amino acid substitutions required to remove the potential T-cell epitopes from the veneered KS light chain variable region were as follows:
1 . Substitution of isoleucine for methionine at residue 32 (Kabat number 33) removes the potential epitope at residue number 27. This residue is within CDR2.
Isoleucine is commonly found at this position in human antibodies.
2. The potential epitope at position 1 is removed by substituting valine for leucine at residue (Kabat number 3).
3. Substitution of serine for alanine at residue 59 (Kabat number 60) removes the potential epitope at residue number 51.
6 Design of de-immunized Seqccences De-immunized heavy and light chain sequences were designed with reference to the changes required to remove potential T-cell epitopes and consideration of framework residues that might be critical for antibody structure and binding. In addition to the de-immunized sequences based on the veneered sequence, an additional sequence was designed for each VH, 3o and VK based on the murine sequence, termed the Mouse Peptide Threaded (MoPT) version.
For this version, changes. were made directly to the murine sequence in order to eliminate T-cell epitopes, but only changes outside the CDRs that are not considered to be detrimental to binding are made. No attempt to remove surface (B cell) epitopes has been made in this version of the de-immunized sequence. The primary de-immunized VH includes substitutions 1 to 5 in Section 5 above and one extra change at residue 43 (Kabat number 43). Lysine found in the murine sequence was substituted for the glutamine from the human framework. Lysine is positively charged and therefore significantly different to glutamine; this region may be involved in VH/VL contacts. The primary de-immunized VH includes no potential T-cell epitopes. A further 4 de-immunized VHs were designed in order to test the effect of the various substitutions required on antibody binding. The cumulative alterations made to the primary de-immunized sequence (KSDIVHvl) and the potential T-cell epitopes remaining are detailed in Table 2.
Table 2: Amino acid changes and potential epitopes in de-immunized KS VH
Variant Cumulative residuePotential epitopes (no. of potential changes MHC binders from 18 tested) KSDIVHvl None none KSDIVHv2 96M -~ I 98(15) KSDIVHv3 71A ~ L, 78L ~ 62(16), 78(11), 98(15) A
KSDIVHv4 38 R ~ K 30(7), 62(16), 78(11), 98(15) KSDIVHv5 68T ~.e A, 69I 30(7), 62(17), 78(11), 98(15) -~ F
KSMoPTVH NA 98(15), 78(12) The primary de-immunized VK includes substitutions 1 to 3 in Section 5 above.
A further 3 de-immunized VKs were designed in order to test the effect of the various substitutions required on antibody binding. The cumulative alterations made to the primary de-immunized sequence (KSDIVKvI) and the potential T-cell epitopes remaining are detailed in Table 3.
Table 3: Amino acid changes and potential epitopes in de-immunized KS VK
Variant Cumulative residuePotential epitopes (no. of potential changes MHC binders from 18 tested) KSDIVKvl None none KSDIVKv2 33I ~ M 27(5) KSDIVKv3 3V ~ L 1(17), 27(5) KSDIVKv4 60 S ~ A 1(17), 27(5), 5(13) KSMoPTVK NA none Seaccences of versions of modified epitopes:
KS VH veneered:
QIQLVQSGPELKKPGSSVKiSCKASGYTFTNYGMNWVKQAPGQGLKWMGWINTYTGEPTYADDFKGRFT
fTIETSTSTAYLQLNNLRsEDmATYfCVRFISKGDYWGQGTTVTVSS
KS VK veneered:
QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPARFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH1 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITAETSTSTLYLQLNNLRSEDTATYFCVRFMSKGDYWGQGTTVTVSS
KS de-immunized VK1 QIVLTQSPASLAVSPGQRATITCSASSSVSYILWYQQKPGQPPKPWIFDTSNLASGFPSRFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH2 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITAETSTSTLYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK2 QIVLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPSRFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH3 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITLETSTSTAYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK3 QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPSRFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH4 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFT
ITLETSTSTAYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK4 QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGQPPKPWIFDTSNLASGFPARFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS de-immunized VH5 QIQLVQSGPELKKPGSSVKISCKASGYTFTNYGMNWVKQAPGKGLKWMGWINTYTGEPTYADDFKGRFA
FTLETSTSTAYLQLNNLRSEDTATYFCVRFISKGDYWGQGTTVTVSS
KS de-immunized VK5 QILLTQSPASLAVSPGQRATITCSASSSVSYMLWYQQKPGSSPKPWIYDTSNLASGFPARFSGSGSGTS
YTLTINSLEAEDAATYYCHQRSGYPYTFGGGTKVEIK
KS VH mouse, peptide threaded (Mo PT) QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVRQAPGKGLKWMGWINTYTGEPTYADDFKGRFV
FSLETSASTAFLQLNNLRSEDTATYFCVRFISKGDYWGQGTSVTVSS
KS VK mouse, peptide threaded (Mo PT) QIVLTQSPATLSASPGERVTITCSASSSVSYMLWYLQKPGSSPKPWIFDTSNLASGFPSRFSGSGSGTT
YSLIISSLEAEDAATYYCHQRSGYPYTFGGGTKLEIK
KS VH mouse QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQTPGKGLKWMGWINTYTGEPTYADDFKGRFA
FSLETSASTAFLQINNLRNEDMATYFCVRFISKGDYWGQGTSVTVSS
KS VK mouse QILLTQSPAIMSASPGEKVTMTCSASSSVSYMLWYQQKPGSSPKPWIFDTSNLASGFPARFSGSGSGTS
YSLIISSMEAEDAATYYCHQRSGYPYTFGGGTKLEIK
MAb 14.18 - IL-2 In analogy, monoclonal antibody 14.18 was fused to IL-2 and deimmunized according to the invention.
Potential T-cell epitopes in murine and veneered 14.18 sequences are:
Sequence Number of Location of potential epitopes potential T-cell Murine 14,18 11 3(17), 9(15), 30(5), 35(17), 39(15), VH
43(9), 58(12), 62(11), 81(11), 84(16), 101(7) Veneered 14. 5 43(9), 58(12), 62(11), 81(11), 84(16) VH
Murine 14.18 7 7(7), 13(11), 27(15), 49(11), 86(17), VK
97(11), 100(4) Veneered 14. 5 27(I5), 49(11), 86(17), 97(11), 18 100(17) VK
Amino acid changes and potential epitopes in de-immunized 14.18 VH are:
Variant Cumulative residue Potential epitopes (no. of changes potential MHC
binders from 18 tested) 14.18DIVH1 none none 14.18DIVH2 41I -~ P, 45L ~ T, none 50L -~
A
_ 77 _ 14.18DIVH3 65S -~ G 58(8) 14.18DIVH4 71A ~ V 58(8), 62(4) 14.18DIVH5 45T ~ L, 41P ~ 1 43(9) 58(8) 62(4) 14.18MoPTVH NA 43(9) 58(12) 62(11) Amino acid changes and potential epitopes in de-immunized 14.18 VK are:
Variant Cumulative residue Potential epitopes' (no. of changes* potential MHC
binders from 18 tested) 14.18DIVKI None none 14.18DIVK2 46L~ M, 49Y -~ H none 14.18DIVK3 96P ~ T, 100Q ~ G 97(5) 14.18DIVK4 96T -~ L 97(11) 14.18DIVK5 27e S ~ R 27(15), 97(11) 14.18DIVK6 46M ~ L 27(15), 49 (11), 97(11) 14.18MoPTVK NA 27(15), 49 (11), 97(11), 100(4) Sequences of versions of modified epitopes are:
14.18 VH veneered:
EVQLLQSGPELKKPGASVKISCKASGSSFTGYNNINWVRQAPGQRLEWIGAIDPYYGGTSYNQKFKGRAT
LSVDKSSSQAYMHLKSLTSEDSAVYYCVSGMEYWGQGTTVTVSS
14.18 VK veneered:
DVVMTQSPGTLPVSLGERATISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDLAVYFCSQSTHVPPLTFGQGTKLEIK
14.18 de-immunized VH1 EVQLLQSGPELKKPGASVKISCKASGSSFTGYNMNWVRQAIGQRLEWIGLIDPYYGGTSYNQKFKSRVT
ITADKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK1 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPPTFGQGTKVEIK
14.18 de-immunized VH2 EVQLLQSGPELKKPGASVKISCKASGSSFTGY'NNIN4JVRQAPGQRTEWIGAIDPYYGGTSYNQKFKSRVT
ITADKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK2 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPPTFGQGTKVEIK
_ 78 _ 14.18 de-immunized VH3 EVQLLQSGPELKKPGASVKISCKASGSSFTGYNMNWVRQAPGQRTEWIGAIDPYYGGTSYNQKFKGRVT
ITADKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK3 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPTTFGGGTKVEIK
14.18 de-immunized VH4 EVQLLQSGPELKKPGASVKISCKASGSSFTG~ZJMNWVRQAPGQRTEWIGAIDPYYGGTSYNQKFKGRVT
ITVDKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK4 DVVMTQSPGTLPVSLGERATISCRSSQSLVHSNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPLTFGGGTKVEIK
14.18 de-immunized VH5 EVQLLQSGPELKKPGASVKISCKASGSSFTGYNMNWVRQAIGQRLEWIGAIDPYYGGTSYNQKFKGRVT
ITVDKSSSQAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 de-immunized VK5 DVVMTQSPGTLPVSLGERATISCRSSQSLVHRNGNTYLHWYLQKPGQSPKMLIHKVSNRFSGVPDRFSG
SGSGTDFTLTISRLEAEDMAVYFCSQSTHVPPLTFGGGTKVEIK
14.18 VH mouse, peptide threaded (Mo PT) EVQLVQSGPEVEKPSASVKISCKASGSSFTGYNNINWVRQAIGKSLEWIGAIDPYYGGTSYNQKFKGRAT
LTVDKSSSTAYMHLKSLTSEDTAVYYCVSGMEYWGQGTTVTVSS
14.18 VK mouse, peptide threaded (Mo PT) DVVMTQTPGSLPVSAGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSG
SGSGTDFTLKISRVEAEDSGVYFCSQSTHVPPLTFGAGTKLELK
14.18 VH mouse EVQLLQSGPELEKPSASVMISCKASGSSFTGY~NMNWVRQNIGKSLEWIGAIDPYYGGTSYNQKFKGRAT
LTVDKSSSTAYMHLKSLTSEDSAVYYCVSGMEYWGQGTSVTVSS
14.18 VK mouse DVVMTQTPLSLPVSLGDQASISCRSSQSLVHRNGNTYLHWYLQKPGQSPKLLIHKVSNRFSGVPDRFSG
SGSGTDFTLKISRVEAEDLGVYFCSQSTHVPPLTFGAGTKLELK
The foregoing description and the examples are intended as illustrative, and are not to be taken as limiting. Still other variants within the spirit and scope of this invention are possible and will readily present themselves to those skilled in the art.
Claims (37)
1. An immunogenicly modified fusion protein derived from a parent fusion protein, essentially consisting of a first protein / polypeptide and a second protein /
polypeptide, wherein the first protein is an immunoglobulin molecule or a fragment thereof and the second protein / polypetide is non-immunoglobulin target polypeptide (X) each linked to the other directly or by a linker molecule; said modified fusion protein having an amino acid sequence different from that of said parent fusion protein and exhibiting reduced immunogenicity by a reduced number of T-cell epitopes within its amino acid sequence relative to the parent fusion protein when exposed to the immune system of a given species.
polypeptide, wherein the first protein is an immunoglobulin molecule or a fragment thereof and the second protein / polypetide is non-immunoglobulin target polypeptide (X) each linked to the other directly or by a linker molecule; said modified fusion protein having an amino acid sequence different from that of said parent fusion protein and exhibiting reduced immunogenicity by a reduced number of T-cell epitopes within its amino acid sequence relative to the parent fusion protein when exposed to the immune system of a given species.
2. A modified fusion protein according to claim 1, wherein said T-cell epitopes are peptide sequences able to bind to MCH class II molecule binding groups.
3. A modified fusion protein of claim 1 or 2, wherein the target polypeptide (X) is linked by its N-terminal to the C-terminal of the immunoglobulin moiety.
4. A modified fusion protein according to any of the claims 1 - 3, wherein the given species is a human.
5. A modified fusion protein according to any of the claims 1 - 3, wherein the fusion components are fused via a linker molecule L.
6. A modified fusion protein according to claim 4, wherein said linker molecule L is non-immunogenic or less immunogenic.
7. A modified fusion protein according to any of the claims 1 - 6, wherein the fusion region represented the C-terminal region of the immunoglobulin portion and the N-terminal region of the non-immunoglobulin target polypeptide (X) has no a reduced number of T-cell epitopes.
8. A modified fusion protein according to any of the claims 1 - 7, wherein the immunoglobulin portion or a fragment thereof is less immunogenic.
9. A modified fusion protein according to any of the claims 1 - 7, wherein the target polypeptide (X) portion is less immunogenic.
10. A modified fusion protein according to any of the claims 1 - 9, wherein said immunoglobulin molecule or fragment thereof is IgG1 or IgG2.
11. A modified fusion protein according to any of the claims 1 - 10 , wherein said immunoglobulin fragment is a Fc portion.
12. A modified fusion protein according to claim 11, wherein said Fc portion has a reduced affinity to Fc receptors.
13. A modified fusion protein according to claim 11 or 12 having the formula Fc - L n - X
wherein Fc is the Fc portion of an immunoglobulin molecule (antibody), X is a non-immunoglobulin target polypeptide L is a linker peptide, n = 0 or 1,and wherein X and / or L comprises amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule.
wherein Fc is the Fc portion of an immunoglobulin molecule (antibody), X is a non-immunoglobulin target polypeptide L is a linker peptide, n = 0 or 1,and wherein X and / or L comprises amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule.
14. A modified fusion protein according to claim 13, wherein at least X has no a reduced immunogenicity.
15. A modified molecule according to claim 14, wherein furthermore the fusion region between Fc and X and optionally Fc and L and / or L and X has no or a reduced number of T-cell epitopes.
16. A modified fusion protein according to any of the claims 1 - 10 having the formula A - L n - X
wherein A is a whole antibody or its sFv, Fab, Fab', F(ab')2 fragments X is a non-immunoglobulin target polypeptide L is a linker peptide, n = 0 or 1, and wherein A and / or X and / or L comprise amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule.
wherein A is a whole antibody or its sFv, Fab, Fab', F(ab')2 fragments X is a non-immunoglobulin target polypeptide L is a linker peptide, n = 0 or 1, and wherein A and / or X and / or L comprise amino acid residue modifications which elicit a reduced immunogenicity compared to the parent molecule.
17. A modified fusion protein according to claim 16, wherein at least A or X
has no or a reduced number of T-cell epitopes.
has no or a reduced number of T-cell epitopes.
18. A modified molecule according to claim 17, wherein furthermore the fusion region between A and X and optionally A and L and / or L and X has no or a reduced immunogenicity.
19. A modified fusion protein according to any of the claims 16 - 18, wherein A is selected from the group:
anti- EGF receptor (HER1) antibodies anti- HER2 antibodies anti- CDx antibodies anti- cytokine receptor antibodies anti- 17-1A antibodies, anti- KSA antibodies anti-GP IIb/IIIa antibodies anti-integrin receptor antibodies anti VEGF receptor antibodies.
anti- EGF receptor (HER1) antibodies anti- HER2 antibodies anti- CDx antibodies anti- cytokine receptor antibodies anti- 17-1A antibodies, anti- KSA antibodies anti-GP IIb/IIIa antibodies anti-integrin receptor antibodies anti VEGF receptor antibodies.
20. A modified fusion protein according to claim 19, wherein the antibody is selected from the group:
monoclonal antibody 225 and derivatives, monoclonal antibody 425 and derivatives monoclonal antibody KS 1/4 and derivatives monoclonal antibody 14.18 and derivatives monoclonal antibody 4D5 / HER2 (Herceptin®) and derivatives monoclonal antibody 17-1A and derivatives monoclonal antibody 7E3 and derivatives monoclonal antibodies LM609, PIF6 and 14D9.F8 and derivatives monoclonal antibody DC-101 and derivatives monoclonal anti-II-2R antibody (Zenapax®) and derivatives
monoclonal antibody 225 and derivatives, monoclonal antibody 425 and derivatives monoclonal antibody KS 1/4 and derivatives monoclonal antibody 14.18 and derivatives monoclonal antibody 4D5 / HER2 (Herceptin®) and derivatives monoclonal antibody 17-1A and derivatives monoclonal antibody 7E3 and derivatives monoclonal antibodies LM609, PIF6 and 14D9.F8 and derivatives monoclonal antibody DC-101 and derivatives monoclonal anti-II-2R antibody (Zenapax®) and derivatives
21. A modified fusion protein according to any of the claims 1 - 20, wherein the target polypeptide X is selected from the group:
cytokines, integrin inhibitors, soluble cytokine receptors, glycoproteins, hormones, glycoprotein hormones, leptin, growth hormones, growth factors, anti-hemophilic factors, antigens, cytokine receptor antagonists.
cytokines, integrin inhibitors, soluble cytokine receptors, glycoproteins, hormones, glycoprotein hormones, leptin, growth hormones, growth factors, anti-hemophilic factors, antigens, cytokine receptor antagonists.
22. A modified fusion protein according to claim 21, wherein the target polypeptide X is selected from the group:
IL-2, G-CSF, GM-CSF, EPO, TPO, TNF.alpha., soluble TNF receptor, IL-12, IL-8, FGF, TGF, EGF, VEGF, PMSA, IGF, insulin, hGH, RGD-peptides, endostatin, angiostatin, BDNF, CNTF, protein c, factor IX, and and biologically active fragments thereof.
IL-2, G-CSF, GM-CSF, EPO, TPO, TNF.alpha., soluble TNF receptor, IL-12, IL-8, FGF, TGF, EGF, VEGF, PMSA, IGF, insulin, hGH, RGD-peptides, endostatin, angiostatin, BDNF, CNTF, protein c, factor IX, and and biologically active fragments thereof.
23. A modified fusion protein according to any of the claims 1 - 22, selected from the group:
MAb KS 1/4 - IL2, MAb 14.18 - IL2 MAb 425 - IL2, MAb c425 - IL2, MAb h425 - IL2, MAb 425 - TNF.alpha.
MAb 225 - IL2, MAb c225 - IL2 MAb 4D5 - IL2, MAb DC101- I~2, MAb LM609 - IL2, Fc - IL2 , Fc - TNF.alpha., Fc - G-CSF, Fc - EPO, Fc - Leptin, Fc - KGF, Fc - BDNF, Fc-CNTF, FC - .beta.-Cerebrosidase, Fc - TPO, Fc - GM-CSF,
MAb KS 1/4 - IL2, MAb 14.18 - IL2 MAb 425 - IL2, MAb c425 - IL2, MAb h425 - IL2, MAb 425 - TNF.alpha.
MAb 225 - IL2, MAb c225 - IL2 MAb 4D5 - IL2, MAb DC101- I~2, MAb LM609 - IL2, Fc - IL2 , Fc - TNF.alpha., Fc - G-CSF, Fc - EPO, Fc - Leptin, Fc - KGF, Fc - BDNF, Fc-CNTF, FC - .beta.-Cerebrosidase, Fc - TPO, Fc - GM-CSF,
24. A DNA sequence encoding a fusion protein of any of the claims 1 - 23 and 36.
25. A DNA sequence of claim 24, comprising (i) a signal sequence (ii) a DNA sequence encoding all domains or a Fc, sFV, Fab, Fab' or F(ab')2 domain of an IgG1, IgG2 or IgG3 antibody, and (ii) a DNA sequence encoding the polypeptide (X), and optionally (iii) a DNA sequence encoding the linker molecule.
26. An expression vector comprising a DNA sequence of claims 24 or 25.
27. A pharmaceutical composition comprising a fusion protein according any of the claims 1 - 23 and 36, optionally together with a suitable carrier, excipient or diluent.
28. A method for preparing an immunogenicly modified fusion protein as specified in of the claims 1 - 23 comprising the steps:
(i) determining the amino acid sequence of the parent fusion protein or part thereof;
(ii) identifying one or more potential T-cell epitopes within the amino acid sequence of the fusion protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays, (iii) designing new sequence variants by alteration of at least one amino acid residue within the originally identified T-cell epitope sequences, said variants are modified in such a way to substantially reduce or eliminate the activity or number of the T-cell epitope sequences and / or the number of MHC allotypes able to bind peptides derived from said biological molecule as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays or by binding of peptide-MHC
complexes to T-cells, (iv) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties, and (v) optionally repeating steps (ii) - (iv), characterized in that the identification of T-cell epitope sequences according to step (ii) is achieved by (a) selecting a region of the peptide having a known amino acid residue sequence;
(b) sequentially sampling overlapping amino acid residue segments of predetermined uniform size and constituted by at least three amino acid residues from the selected region; (c) calculating MHC Class II molecule binding score for each said sampled segment by summing assigned values for each hydrophobic amino acid residue side chain present in said sampled amino acid residue segment; and (d) identifying at least one of said segments suitable for modification, based on the calculated MHC Class II
molecule binding score for that segment, to change overall MHC Class II binding score for the peptide without substantially the reducing therapeutic utility of the peptide.
(i) determining the amino acid sequence of the parent fusion protein or part thereof;
(ii) identifying one or more potential T-cell epitopes within the amino acid sequence of the fusion protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays, (iii) designing new sequence variants by alteration of at least one amino acid residue within the originally identified T-cell epitope sequences, said variants are modified in such a way to substantially reduce or eliminate the activity or number of the T-cell epitope sequences and / or the number of MHC allotypes able to bind peptides derived from said biological molecule as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays or by binding of peptide-MHC
complexes to T-cells, (iv) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties, and (v) optionally repeating steps (ii) - (iv), characterized in that the identification of T-cell epitope sequences according to step (ii) is achieved by (a) selecting a region of the peptide having a known amino acid residue sequence;
(b) sequentially sampling overlapping amino acid residue segments of predetermined uniform size and constituted by at least three amino acid residues from the selected region; (c) calculating MHC Class II molecule binding score for each said sampled segment by summing assigned values for each hydrophobic amino acid residue side chain present in said sampled amino acid residue segment; and (d) identifying at least one of said segments suitable for modification, based on the calculated MHC Class II
molecule binding score for that segment, to change overall MHC Class II binding score for the peptide without substantially the reducing therapeutic utility of the peptide.
29. The method according to claim 28, wherein step (c) is carried out by using a Böhm scoring function modified to include 12-6 van der Waal's ligand-protein energy repulsive term and ligand conformational energy term by (1) providing a first data base of MHC
Class II molecule models; (2) providing a second data base of allowed peptide backbones for said MHC Class II molecule models; (3) selecting a model from said first data base;
(4) selecting an allowed peptide backbone from said second data base; (5) identifying amino acid residue side chains present in each sampled segment; (6) determining the binding affinity value for all side chains present in each sampled segment;
and optionally (7) repeating steps (1) through (5) for each said model and each said backbone.
Class II molecule models; (2) providing a second data base of allowed peptide backbones for said MHC Class II molecule models; (3) selecting a model from said first data base;
(4) selecting an allowed peptide backbone from said second data base; (5) identifying amino acid residue side chains present in each sampled segment; (6) determining the binding affinity value for all side chains present in each sampled segment;
and optionally (7) repeating steps (1) through (5) for each said model and each said backbone.
30. The method of claim 28 or 29, wherein the sampled amino acid residue segment is constituted by 13 amino acid residues.
31. The method of any of the claims 28 - 30, wherein consecutive sampled amino acid residue segments overlap by one to five amino acid residues.
32. The method of any of the claims 28 - 31, wherein 1 - 9 amino acid residues in any of the originally present T-cell epitope sequences are altered.
33. The method according to claim 32, wherein one amino acid residue in any of the originally present T-cell epitope sequences is altered.
34. The method of claim 32 or 33, wherein the alteration of the amino acid residues is substitution, deletion or addition of originally present amino acid(s) residue(s) by other amino acid residue(s) at specific position(s).
35. The method of claims 34, wherein additionally further alteration by substitution, deletion or addition is conducted to restore biological activity of said biological molecule.
36. An immunogenicly modified artificial protein selected from the group:
(i) Y - (L) - X, wherein Y is a cytokine and X, (L) is a molecule as defined above, (ii) P - (L) - X, wherein P is a protein with unusual glycosylation moieties and X, (L) is a molecule as defined above, (iii) A - (L) - X, wherein A is an immunoglobulin or a fragment thereof and X
(L) is a molecule as defined above, derived from a parent artificial protein having an amino acid sequence which is different from that of said parent artificial protein and exhibits reduced immunogenicity by a reduced number of T-cell epitopes relative to the parent fusion protein when exposed to the immune system of a given species, wherein said T-cell epitopes are peptide sequences able to bind to MCH class II molecule binding groups obtainable by a method as specified in any of the claims 28 - 35.
(i) Y - (L) - X, wherein Y is a cytokine and X, (L) is a molecule as defined above, (ii) P - (L) - X, wherein P is a protein with unusual glycosylation moieties and X, (L) is a molecule as defined above, (iii) A - (L) - X, wherein A is an immunoglobulin or a fragment thereof and X
(L) is a molecule as defined above, derived from a parent artificial protein having an amino acid sequence which is different from that of said parent artificial protein and exhibits reduced immunogenicity by a reduced number of T-cell epitopes relative to the parent fusion protein when exposed to the immune system of a given species, wherein said T-cell epitopes are peptide sequences able to bind to MCH class II molecule binding groups obtainable by a method as specified in any of the claims 28 - 35.
37. An artificial protein of claim 36, wherein at least A or X or Y or P is immunogenicly modified.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP01103955 | 2001-02-19 | ||
EP01103955.9 | 2001-02-19 | ||
EP01108291 | 2001-04-05 | ||
EP01108291.4 | 2001-04-05 | ||
PCT/EP2002/001690 WO2002066514A2 (en) | 2001-02-19 | 2002-02-18 | Artificial fusion proteins with reduced immunogenicity |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2438628A1 true CA2438628A1 (en) | 2002-08-29 |
Family
ID=26076484
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002438628A Abandoned CA2438628A1 (en) | 2001-02-19 | 2002-02-18 | Artificial proteins with reduced immunogenicity |
Country Status (13)
Country | Link |
---|---|
US (2) | US7189830B2 (en) |
EP (1) | EP1361891A2 (en) |
JP (1) | JP2004532620A (en) |
KR (1) | KR20040074587A (en) |
CN (1) | CN100522242C (en) |
AU (1) | AU2002233340B2 (en) |
BR (1) | BR0207267A (en) |
CA (1) | CA2438628A1 (en) |
HU (1) | HUP0303171A2 (en) |
MX (1) | MXPA03007323A (en) |
PL (1) | PL362324A1 (en) |
RU (1) | RU2363707C2 (en) |
WO (1) | WO2002066514A2 (en) |
Families Citing this family (130)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ATE267215T1 (en) | 1997-12-08 | 2004-06-15 | Lexigen Pharm Corp | HETERODIMARY FUSION PROTEINS FOR USE FOR TARGETED IMMUNTHERAPY AND GENERAL IMMUNE EXCITATION |
US20030105294A1 (en) * | 1998-02-25 | 2003-06-05 | Stephen Gillies | Enhancing the circulating half life of antibody-based fusion proteins |
PL343462A1 (en) * | 1998-04-15 | 2001-08-13 | Lexigen Pharm Corp | Enhancement of antibody-cytokine fusion protein mediated immune responses by co-administration with angiogenesis inhibitor |
AU775422B2 (en) * | 1998-06-15 | 2004-07-29 | Gtc Biotherapeutics, Inc. | Erythropoietin analog-human serum albumin fusion |
SK782002A3 (en) | 1999-07-21 | 2003-08-05 | Lexigen Pharm Corp | FC fusion proteins for enhancing the immunogenicity of protein and peptide antigens |
WO2001010912A1 (en) * | 1999-08-09 | 2001-02-15 | Lexigen Pharmaceuticals Corp. | Multiple cytokine-antibody complexes |
US20050202538A1 (en) * | 1999-11-12 | 2005-09-15 | Merck Patent Gmbh | Fc-erythropoietin fusion protein with improved pharmacokinetics |
CA2399832C (en) | 2000-02-11 | 2011-09-20 | Stephen D. Gillies | Enhancing the circulating half-life of antibody-based fusion proteins |
ES2288967T3 (en) * | 2000-06-29 | 2008-02-01 | Merck Patent Gmbh | REINFORCEMENT OF IMMUNE ANSWERS MEDIATED BY THE ANTIBODY-CYTOKIN FUSION PROTEIN THROUGH THE TREATMENT COMBINED BY AGENTS THAT IMPROVE THE INCORPORATION OF IMMUNOCITOQUINE. |
CA2440221C (en) * | 2001-03-07 | 2013-02-05 | Merck Patent Gesellschaft Mit Beschraenkter Haftung | Expression technology for proteins containing a hybrid isotype antibody moiety |
WO2002079415A2 (en) * | 2001-03-30 | 2002-10-10 | Lexigen Pharmaceuticals Corp. | Reducing the immunogenicity of fusion proteins |
BR0209177A (en) * | 2001-05-03 | 2004-10-05 | Merck Patent Gmbh | Recombinant tumor specific antibody and use |
US20060073141A1 (en) * | 2001-06-28 | 2006-04-06 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
US20050271663A1 (en) * | 2001-06-28 | 2005-12-08 | Domantis Limited | Compositions and methods for treating inflammatory disorders |
ES2381025T3 (en) | 2001-12-04 | 2012-05-22 | Merck Patent Gmbh | Immunocytokines with modulated selectivity |
US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
US7696320B2 (en) | 2004-08-24 | 2010-04-13 | Domantis Limited | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
ES2343518T3 (en) * | 2002-09-09 | 2010-08-03 | Hanall Biopharma Co., Ltd. | ALFA INTERFERATED POLYPEPTIDES MODIFIED PROTEASAS RESISTANT. |
ES2346205T3 (en) * | 2002-12-17 | 2010-10-13 | Merck Patent Gmbh | HUMANIZED ANTIBODY (H14.18) OF ANTIBODY 14.18 OF MOUSE THAT LINKS TO GD2 AND ITS FUSION WITH IL-2. |
US20090010920A1 (en) | 2003-03-03 | 2009-01-08 | Xencor, Inc. | Fc Variants Having Decreased Affinity for FcyRIIb |
AU2004224122A1 (en) | 2003-03-26 | 2004-10-07 | Apogenix Gmbh | Improved Fc fusion proteins |
US9051373B2 (en) | 2003-05-02 | 2015-06-09 | Xencor, Inc. | Optimized Fc variants |
TWI353991B (en) * | 2003-05-06 | 2011-12-11 | Syntonix Pharmaceuticals Inc | Immunoglobulin chimeric monomer-dimer hybrids |
US8147832B2 (en) * | 2003-08-14 | 2012-04-03 | Merck Patent Gmbh | CD20-binding polypeptide compositions and methods |
CN1871259A (en) | 2003-08-22 | 2006-11-29 | 比奥根艾迪克Ma公司 | Improved antibodies having altered effector function and methods for making the same |
US20050069521A1 (en) * | 2003-08-28 | 2005-03-31 | Emd Lexigen Research Center Corp. | Enhancing the circulating half-life of interleukin-2 proteins |
US9714282B2 (en) | 2003-09-26 | 2017-07-25 | Xencor, Inc. | Optimized Fc variants and methods for their generation |
RU2401843C2 (en) | 2003-10-16 | 2010-10-20 | Микромет Аг | Multispecific deimmunising cd3-binders |
US8110665B2 (en) | 2003-11-13 | 2012-02-07 | Hanmi Holdings Co., Ltd. | Pharmaceutical composition comprising an immunoglobulin FC region as a carrier |
PT1682583E (en) | 2003-11-13 | 2012-04-13 | Hanmi Holdings Co Ltd | Protein complex using immunoglobulin fragment and method for the preparation thereof |
WO2005063820A2 (en) | 2003-12-30 | 2005-07-14 | Merck Patent Gmbh | Il-7 fusion proteins |
KR20060124656A (en) * | 2003-12-31 | 2006-12-05 | 메르크 파텐트 게엠베하 | Fc-erythropoietin fusion protein with improved pharmacokinetics |
WO2005066348A2 (en) | 2004-01-05 | 2005-07-21 | Emd Lexigen Research Center Corp. | Interleukin-12 targeted to oncofoetal fibronectin |
CA2553883C (en) | 2004-01-22 | 2013-04-02 | Merck Patent Gesellschaft Mit Beschraenkter Haftung | Anti-cancer antibodies with reduced complement fixation |
US7674464B2 (en) * | 2004-03-04 | 2010-03-09 | The University Of Tennessee Research Foundation | Intracellular interleukin-1 receptor antagonists |
US7670595B2 (en) * | 2004-06-28 | 2010-03-02 | Merck Patent Gmbh | Fc-interferon-beta fusion proteins |
US20150010550A1 (en) | 2004-07-15 | 2015-01-08 | Xencor, Inc. | OPTIMIZED Fc VARIANTS |
US7470521B2 (en) * | 2004-07-20 | 2008-12-30 | Critical Therapeutics, Inc. | RAGE protein derivatives |
WO2006033702A2 (en) | 2004-07-26 | 2006-03-30 | Biogen Idec Ma Inc. | Anti-cd154 antibodies |
US20060078562A1 (en) * | 2004-08-03 | 2006-04-13 | Mjalli Adnan M | RAGE fusion proteins and methods of use |
KR101323411B1 (en) * | 2004-08-03 | 2013-10-30 | 트랜스테크 파르마, 인크. | RAGE Fusion Proteins and Methods of Use |
EP2314618A3 (en) | 2004-11-12 | 2011-10-19 | Xencor Inc. | Fc variants with altered binding to FcRn |
US8367805B2 (en) | 2004-11-12 | 2013-02-05 | Xencor, Inc. | Fc variants with altered binding to FcRn |
DE602005020837D1 (en) * | 2004-12-09 | 2010-06-02 | Merck Patent Gmbh | IL-7 VARIANTS WITH REDUCED IMMUNOGENITY |
CA2595169A1 (en) * | 2005-01-12 | 2006-07-20 | Xencor, Inc. | Antibodies and fc fusion proteins with altered immunogenicity |
WO2006086823A1 (en) * | 2005-02-15 | 2006-08-24 | Apollo Life Sciences Limited | Molecules and chimeric molecules thereof |
US7833979B2 (en) * | 2005-04-22 | 2010-11-16 | Amgen Inc. | Toxin peptide therapeutic agents |
US20070104689A1 (en) * | 2005-09-27 | 2007-05-10 | Merck Patent Gmbh | Compositions and methods for treating tumors presenting survivin antigens |
JP2009510102A (en) * | 2005-09-29 | 2009-03-12 | ヴァイラル ロジック システムズ テクノロジー コーポレーション | Immunomodulatory compositions and uses thereof |
ES2616316T3 (en) | 2005-10-11 | 2017-06-12 | Amgen Research (Munich) Gmbh | Compositions comprising specific antibodies for different species and uses thereof |
AU2006310882A1 (en) | 2005-11-07 | 2007-05-10 | Copenhagen University | Neurotrophin-derived peptide sequences |
LT1976880T (en) | 2005-12-21 | 2016-10-10 | Amgen Research (Munich) Gmbh | Pharmaceutical compositions with resistance to soluble cea |
WO2007073272A1 (en) * | 2005-12-23 | 2007-06-28 | Gcoder Systems Ab | Positioning pattern |
PT2270050E (en) | 2005-12-30 | 2013-09-12 | Merck Patent Gmbh | Anti-cd19 antibodies with reduced immunogenicity |
CA2635618C (en) * | 2005-12-30 | 2015-10-06 | Merck Patent Gesellschaft Mit Beschraekter Haftung | Interleukin-12p40 variants with improved stability |
EP1989227A2 (en) * | 2006-02-09 | 2008-11-12 | Transtech Pharma, Inc. | Rage fusion proteins and methods of use |
PT2005185E (en) | 2006-03-22 | 2011-01-27 | Viral Logic Systems Technology Corp | Methods for identifying polypeptide targets |
EP2007815A2 (en) * | 2006-03-31 | 2008-12-31 | Biotherapix Molecular Medicines S.L.U. | Mono- and bifunctional molecules with ability to bind to g protein-coupled receptors |
CN100402551C (en) * | 2006-04-14 | 2008-07-16 | 中国科学院长春应用化学研究所 | Antigen epitope of beta2-microglobulin and its application |
MX2008013863A (en) | 2006-05-05 | 2008-11-14 | Transtech Pharma Inc | Rage fusion proteins, formulations, and methods of use thereof. |
US8377448B2 (en) * | 2006-05-15 | 2013-02-19 | The Board Of Trustees Of The Leland Standford Junior University | CD47 related compositions and methods for treating immunological diseases and disorders |
WO2007133811A2 (en) * | 2006-05-15 | 2007-11-22 | Viral Logic Systems Technology Corp. | Cd47 related compositions and methods for treating immunological diseases and disorders |
WO2008045380A2 (en) * | 2006-10-04 | 2008-04-17 | Codon Devices, Inc. | Nucleic acid libraries and their design and assembly |
JP2010510794A (en) | 2006-11-28 | 2010-04-08 | ハナル ファーマシューティカル カンパニー リミテッド | Modified erythropoietin polypeptide and therapeutic use thereof |
JP2008169195A (en) | 2007-01-05 | 2008-07-24 | Hanmi Pharmaceutical Co Ltd | Insulinotopic peptide drug combo using carrier material |
US20080199467A1 (en) * | 2007-02-15 | 2008-08-21 | Mjalli Adnan M M | Immunoglobulin fusion proteins and methods of making |
EA200901301A1 (en) * | 2007-06-06 | 2010-06-30 | Домантис Лимитед | POLYPEPTIDES, VARIABLE DOMAINS OF ANTIBODIES AND ANTAGONISTS |
WO2008157776A2 (en) * | 2007-06-21 | 2008-12-24 | Angelica Therapeutics, Inc. | Modified diphtheria toxins |
AU2008289441A1 (en) | 2007-08-22 | 2009-02-26 | Cytomx Therapeutics, Inc. | Activatable binding polypeptides and methods of identification and use thereof |
GB0723712D0 (en) * | 2007-12-04 | 2008-01-16 | Apitope Technology Bristol Ltd | Peptides |
ES2742268T3 (en) | 2007-12-26 | 2020-02-13 | Xencor Inc | Fc variants with altered FcRn binding |
CA2711256C (en) * | 2008-01-03 | 2019-01-15 | The Scripps Research Institute | Antibody targeting through a modular recognition domain |
WO2009110944A1 (en) * | 2008-02-29 | 2009-09-11 | Angelica Therapeutics, Inc. | Modified toxins |
WO2009149218A2 (en) * | 2008-06-03 | 2009-12-10 | Codon Devices, Inc. | Novel proteins and methods of designing and using same |
AU2009308707A1 (en) | 2008-10-31 | 2010-05-06 | Biogen Idec Ma Inc. | LIGHT targeting molecules and uses thereof |
CN106995495A (en) | 2009-01-12 | 2017-08-01 | 希托马克斯医疗有限责任公司 | Modified antibodies composition and its preparation and application |
RU2011138951A (en) | 2009-02-23 | 2013-03-27 | Сайтомкс Терапьютикс, Инк. | PROTEINS AND WAYS OF THEIR APPLICATION |
CN101863982A (en) * | 2009-04-17 | 2010-10-20 | 哈药集团生物工程有限公司 | Fusion protein for increasing blood platelets and preparation method thereof |
MX2011010989A (en) | 2009-04-20 | 2012-02-28 | Pfizer | Control of protein glycosylation and compositions and methods relating thereto. |
AU2010238858A1 (en) * | 2009-04-22 | 2011-12-08 | Merck Patent Gmbh | Antibody fusion proteins with modified FcRn binding sites |
WO2011002673A1 (en) | 2009-07-01 | 2011-01-06 | Temple University - Of The Commonwealth System Of Higher Education | Leptin agonist and methods of use |
JP6193570B2 (en) | 2009-07-17 | 2017-09-13 | バイオアトラ、エルエルシー | Simultaneously integrated selection and evolution of antibody / protein performance and expression in the production host |
US9493578B2 (en) | 2009-09-02 | 2016-11-15 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
US8362210B2 (en) | 2010-01-19 | 2013-01-29 | Xencor, Inc. | Antibody variants with enhanced complement activity |
WO2011098095A1 (en) * | 2010-02-09 | 2011-08-18 | Aplagen Gmbh | Peptides binding the tpo receptor |
CN102906108B (en) | 2010-03-04 | 2016-01-20 | 菲尼克斯公司 | For preparing the method for solubility recombinant interferon albumen without sex change |
PL2552949T3 (en) | 2010-04-01 | 2017-01-31 | Pfenex Inc. | Methods for g-csf production in a pseudomonas host cell |
ES2826445T3 (en) * | 2010-04-28 | 2021-05-18 | Oncolmmune Inc | Soluble CD24 Medical Use |
US20120100166A1 (en) | 2010-07-15 | 2012-04-26 | Zyngenia, Inc. | Ang-2 Binding Complexes and Uses Thereof |
DK3435087T3 (en) | 2010-07-16 | 2023-11-27 | Bioatla Inc | UNKNOWN PROCESSES FOR PROTEIN EVOLUTION |
AU2011352207B2 (en) | 2010-12-31 | 2016-03-03 | Bioatla, Llc | Comprehensive monoclonal antibody generation |
DK2658970T3 (en) | 2010-12-31 | 2017-01-16 | Bioatla Llc | Express humanization of antibodies |
JP5979673B2 (en) * | 2011-02-18 | 2016-08-24 | 国立大学法人京都大学 | Protein aqueous solution |
WO2012119989A2 (en) | 2011-03-04 | 2012-09-13 | Oryzon Genomics, S.A. | Methods and antibodies for the diagnosis and treatment of cancer |
CA2837169C (en) | 2011-05-24 | 2021-11-09 | Zyngenia, Inc. | Multispecific complexes comprising angiopoietin-2-binding peptide and their uses |
BR112014013086A2 (en) | 2011-11-29 | 2020-10-27 | Neurophage Pharmaceuticals, Inc. | COMPOSITIONS FOR TREATMENT OF DISEASE ASSOCIATED WITH AGGREGATED AMYLOID PROTEIN AND TO DETECT OR GENERATE AGGREGATED AMYLOID IMAGE AND USE OF THOSE COMPOSITIONS |
MX2019001355A (en) | 2012-05-10 | 2023-01-17 | Bioatla Llc | Multi-specific monoclonal antibodies. |
NZ706838A (en) | 2012-10-02 | 2017-06-30 | Proclara Biosciences Inc | Use of p3 of bacteriophage fusion proteins as amyloid binding agents |
US10150800B2 (en) | 2013-03-15 | 2018-12-11 | Zyngenia, Inc. | EGFR-binding modular recognition domains |
EP2968450A4 (en) | 2013-03-15 | 2016-10-26 | Angelica Therapeutics Inc | Modified toxins |
SG11201509647WA (en) | 2013-05-28 | 2015-12-30 | Neurophage Pharmaceuticals Inc | Polypeptides comprising a modified bacteriophage g3p amino acid sequence with reduced immunogenicity |
AU2014287221C1 (en) | 2013-07-09 | 2020-03-05 | Annexon, Inc. | Anti-complement factor C1q antibodies and uses thereof |
EP2840091A1 (en) | 2013-08-23 | 2015-02-25 | MacroGenics, Inc. | Bi-specific diabodies that are capable of binding gpA33 and CD3 and uses thereof |
US11293929B2 (en) | 2014-01-07 | 2022-04-05 | Bioatla, Inc. | Proteins targeting orthologs |
GB201403775D0 (en) | 2014-03-04 | 2014-04-16 | Kymab Ltd | Antibodies, uses & methods |
JP2017514458A (en) | 2014-03-12 | 2017-06-08 | プロセナ バイオサイエンシーズ リミテッド | Anti-laminin 4 antibody specific for LG4-5 |
CA2938945A1 (en) * | 2014-03-13 | 2015-09-17 | Prothena Biosciences Limited | Combination treatment for multiple sclerosis |
KR20150140177A (en) * | 2014-06-05 | 2015-12-15 | 한미약품 주식회사 | Method of decreasing immunogenicity of protein and pepteide |
WO2016073685A1 (en) * | 2014-11-05 | 2016-05-12 | Annexon, Inc. | Humanized anti-complement factor c1q antibodies and uses thereof |
US20170269092A1 (en) | 2014-12-02 | 2017-09-21 | Cemm - Forschungszentrum Fuer Molekulare Medizin Gmbh | Anti-mutant calreticulin antibodies and their use in the diagnosis and therapy of myeloid malignancies |
TW201632542A (en) | 2014-12-03 | 2016-09-16 | 神經噬菌體製藥股份有限公司 | Polypeptides comprising a modified bacteriophage G3P amino acid sequence lacking a glycosylation signal |
EP3369023A1 (en) * | 2015-10-30 | 2018-09-05 | Janssen Vaccines & Prevention B.V. | Structure based design of d-protein ligands |
GB201520568D0 (en) | 2015-11-23 | 2016-01-06 | Immunocore Ltd | Peptides |
GB201520550D0 (en) | 2015-11-23 | 2016-01-06 | Immunocore Ltd & Adaptimmune Ltd | Peptides |
GB201520545D0 (en) * | 2015-11-23 | 2016-01-06 | Immunocore Ltd & Adaptimmune Ltd | Peptides |
WO2017091719A1 (en) | 2015-11-24 | 2017-06-01 | Annexon, Inc. | Anti-complement factor c1q fab fragments and uses thereof |
GB201607521D0 (en) * | 2016-04-29 | 2016-06-15 | Oncolmmunity As | Method |
US9567399B1 (en) | 2016-06-20 | 2017-02-14 | Kymab Limited | Antibodies and immunocytokines |
JP2019532103A (en) * | 2016-10-04 | 2019-11-07 | ザ・カウンシル・オヴ・ザ・クイーンズランド・インスティテュート・オヴ・メディカル・リサーチ | Peptide libraries and methods of use |
US11779604B2 (en) | 2016-11-03 | 2023-10-10 | Kymab Limited | Antibodies, combinations comprising antibodies, biomarkers, uses and methods |
JP6925431B2 (en) * | 2016-11-09 | 2021-08-25 | フィロジェン エッセ.ピー.アー. | Immunoconjugates of IL2 and TNF mutants |
JP2020513814A (en) | 2017-03-14 | 2020-05-21 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニア | Operation of CRISPR CAS9 Immune Stealth |
US11607457B2 (en) | 2017-07-13 | 2023-03-21 | City Of Hope | Anti-cancer phosphorothioate-coupled peptide conjugates and methods of using the same |
WO2019014648A1 (en) * | 2017-07-13 | 2019-01-17 | City Of Hope | Phosphorothioate-conjugated peptides and methods of using the same |
SG11202005732XA (en) | 2017-12-19 | 2020-07-29 | Xencor Inc | Engineered il-2 fc fusion proteins |
WO2020072821A2 (en) | 2018-10-03 | 2020-04-09 | Xencor, Inc. | Il-12 heterodimeric fc-fusion proteins |
WO2021067863A2 (en) | 2019-10-03 | 2021-04-08 | Xencor, Inc. | Targeted il-12 heterodimeric fc-fusion proteins |
CN112457399B (en) * | 2020-12-19 | 2023-09-01 | 上海佰君生物科技有限公司 | Purification method of human immunoglobulin G |
CN112466390B (en) * | 2020-12-19 | 2023-11-14 | 广东众源药业有限公司 | Hydrophobic cyclic peptide ligands useful for purification of human immunoglobulin G |
CN115724988B (en) * | 2021-08-26 | 2023-11-17 | 瑅安生物医药(杭州)有限公司 | Polypeptide fusion molecule close to natural molecule |
Family Cites Families (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5650150A (en) * | 1990-11-09 | 1997-07-22 | Gillies; Stephen D. | Recombinant antibody cytokine fusion proteins |
GB9511935D0 (en) * | 1995-06-13 | 1995-08-09 | Smithkline Beecham Plc | Novel compound |
CA2290485C (en) * | 1997-05-21 | 2008-08-05 | Biovation Limited | Method for the production of non-immunogenic proteins |
DE19822406A1 (en) | 1998-05-19 | 1999-11-25 | Alexander Cherkasky | Composition for treating cancer and other diseases caused by pathogenic proteins |
ES2278463T3 (en) * | 1998-12-08 | 2007-08-01 | Biovation Limited | METHOD TO REDUCE THE IMMUNOGENICITY OF PROTEINS. |
KR20020007287A (en) * | 1999-01-07 | 2002-01-26 | 추후보정 | EXPRESSION AND EXPORT OF ANTI-OBESITY PROTEINS AS Fc FUSION PROTEINS |
DE19925052B4 (en) | 1999-06-01 | 2012-01-12 | Alexander Cherkasky | Protein complexes for the targeted transport of (poly) peptides and nucleic acids and sequence-specific integration of DNA vectors |
EP1361893B1 (en) * | 2001-02-19 | 2012-10-24 | Merck Patent GmbH | Modified anti-egfr antibodies with reduced immunogenicity |
DE10133071A1 (en) | 2001-07-07 | 2003-03-06 | Alexander Cherkasky | New compound containing protease and a recognition component, useful for treating diseases associated with specific proteins, e.g. multiple sclerosis |
-
2002
- 2002-02-18 JP JP2002566227A patent/JP2004532620A/en active Pending
- 2002-02-18 WO PCT/EP2002/001690 patent/WO2002066514A2/en active Application Filing
- 2002-02-18 BR BR0207267-0A patent/BR0207267A/en not_active IP Right Cessation
- 2002-02-18 US US10/468,370 patent/US7189830B2/en not_active Expired - Fee Related
- 2002-02-18 KR KR10-2003-7010884A patent/KR20040074587A/en not_active Application Discontinuation
- 2002-02-18 CN CNB028051580A patent/CN100522242C/en not_active Expired - Fee Related
- 2002-02-18 HU HU0303171A patent/HUP0303171A2/en unknown
- 2002-02-18 AU AU2002233340A patent/AU2002233340B2/en not_active Ceased
- 2002-02-18 PL PL36232402A patent/PL362324A1/en not_active Application Discontinuation
- 2002-02-18 MX MXPA03007323A patent/MXPA03007323A/en not_active Application Discontinuation
- 2002-02-18 EP EP02700246A patent/EP1361891A2/en not_active Withdrawn
- 2002-02-18 CA CA002438628A patent/CA2438628A1/en not_active Abandoned
- 2002-02-18 RU RU2003127387/13A patent/RU2363707C2/en not_active IP Right Cessation
-
2007
- 2007-03-12 US US11/716,878 patent/US7615217B2/en not_active Expired - Fee Related
Also Published As
Publication number | Publication date |
---|---|
PL362324A1 (en) | 2004-10-18 |
CN1492768A (en) | 2004-04-28 |
RU2003127387A (en) | 2005-03-27 |
CN100522242C (en) | 2009-08-05 |
US7189830B2 (en) | 2007-03-13 |
US20040082039A1 (en) | 2004-04-29 |
US7615217B2 (en) | 2009-11-10 |
US20070269435A1 (en) | 2007-11-22 |
RU2363707C2 (en) | 2009-08-10 |
WO2002066514A2 (en) | 2002-08-29 |
KR20040074587A (en) | 2004-08-25 |
AU2002233340B2 (en) | 2008-05-22 |
MXPA03007323A (en) | 2003-12-12 |
EP1361891A2 (en) | 2003-11-19 |
JP2004532620A (en) | 2004-10-28 |
HUP0303171A2 (en) | 2003-12-29 |
BR0207267A (en) | 2004-02-10 |
WO2002066514A3 (en) | 2003-02-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7615217B2 (en) | Artificial proteins with reduced immunogenicity | |
AU2002233340A1 (en) | Artificial fusion proteins with reduced immunogenicity | |
US7430476B2 (en) | Method for identification of t-cell epitopes and use for preparing molecules with reduced immunogenicity | |
CA2438513C (en) | Modified anti-egfr antibodies with reduced immunogenicity | |
AU2002256624A1 (en) | Method for identification of T-cell epitopes and use for preparing molecules with reduced immunogenicity | |
AU2002306976B2 (en) | Reducing the immunogenicity of fusion proteins | |
JPH02503867A (en) | IL-2 receptor-specific chimeric antibody | |
ZA200307323B (en) | Artificial fusion proteins with reduced immunogenicity. | |
RU2303264C2 (en) | Method for identifying epitopes of t-cells and its using in preparing molecules of reduced immunogenicity | |
AU2002249224B2 (en) | Modified anti-EGFR antibodies with reduced immunogenicity | |
AU2002249224A1 (en) | Modified anti-EGFR antibodies with reduced immunogenicity |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Discontinued |