CA2477043A1

CA2477043A1 - Novel methods of diagnosis of metastatic colorectal cancer, compositions and methods of screening for modulators of metastatic colorectal cancer

Info

Publication number: CA2477043A1
Application number: CA 2477043
Authority: CA
Inventors: David H. Mack; Sanford David Markowitz
Original assignee: Individual
Current assignee: Case Western Reserve University; EOS Biotechnology Inc
Priority date: 2001-02-27
Filing date: 2002-02-27
Publication date: 2002-09-06
Also published as: WO2002068677A2; AU2002252144A1; EP1392861A1; WO2002068677A8; JP2004532622A; US20030235820A1

Abstract

Published without an

Description

DEMANDES OU BREVETS VOLUMINEUX
LA PRESENTE PARTIE I)E CETTE DEMANDE OU CE BREVETS
COMPRI~:ND PLUS D'UN TOME.
CECI EST ~.E TOME 1 DE 2 NOTE: Pour les tomes additionels, veillez contacter le Bureau Canadien des Brevets.
JUMBO APPLICATIONS / PATENTS
THIS SECTION OF THE APPLICATION / PATENT CONTAINS MORE
THAN ONE VOLUME.

NOTE: For additional vohxmes please contact the Canadian Patent Oi~ice.

NOVEL METHODS OF DIAGNOSIS OF METASTATIC COLORECTAL
CANCER, COMPOSITIONS AND METHODS OF SCREENING FOR
MODULATORS OF METASTATIC COLORECTAL CANCER
CROSS-REFERENCES TO RELATED APPLICATIONS
The present application is related to USSN 60/272,206, filed February 27, 2001, USSN 60/21,149, filed April 2, 2001, and USSN 60/24,555, filed April 17, 2001, all of which are herein incorporated by referenced in their entirety.
FIELD OF THE INVENTION
The invention relates to the identification of nucleic acid and protein expression profiles and nucleic acids, products, and antibodies thereto that are involved in metastatic colorectal cancer; and to the use of such expression profiles and compositions in diagnosis and therapy of metastatic colorectal cancer. The invention further relates to methods for identifying and using agents and/or targets that inhibit metastatic colorectal cancer.
BACKGROUND OF THE INVENTION
Cancer of the colon and/or rectum (referred to as "colorectal cancer") are significant in Western populations and particularly in the United States.
Cancers of the colon and rectum occur in both men and women most commonly after the age of 50.
These develop as the result of a pathologic.transformation of normal colon epithelium to an invasive cancer. There have been a number of recently characterized genetic alterations that have been implicated in colorectal cancer, including mutations in two classes of genes, tumor-suppressor genes and proto-oncogenes, with recent work suggesting that mutations in DNA
repair genes may also be involved in tumorigenesis. For example, inactivating mutations of both alleles of the adenomatous polyposis coli (APC) gene, a tumor suppressor gene, appears to be one of the earliest events in colorectal cancer, and may even be the initiating event.
Other genes implicated in colorectal cancer include the MCC gene, the p53 gene, the DCC
(deleted in colorectal carcinoma) gene and other chromosome 1 ~q genes, and genes in the TGF-(3 signaling pathway. For a review, see Molecular Biology of Colorectal Cancer, pp.
23~-299, in Curr. Probl. Cancer, Sept/Oct 1997; see also Willams, Colorectal Cancer (1996); Kinsella & Schofield, Colorectal Cancer: A Scientific Perspective (1993); Colorectal Cancer: Molecular Mechanisms, Premalignant State and its Prevention (Schmiegel &
Scholinerich eds., 2000); Colorectal Cancer: New Aspects of Molecular Biology and Their Clinical Applications (Hanski et al., eds 2000); McArdle et al., Colorectal Cancer (2000);
Wanebo, Colorectal Cancer (1993); Levin, The American Cancer Society:
Colorectal Cancer (1999); Treatment ofHepatic Metastases of Colorectal Cancer (Nordlinger &
Jaeck eds., 1993); Management of Colorectal Cancer (Dunitz et al., eds. 1998); Cancer:
Principles and Practice of Oncology (Devita et al., eds. 2001); Surgical Oncology:
Contemporary Principles and Practice (Kirby et al., eds. 2001); Offit, Clinical Cancer Genetics: Risk Counseling and Management (1997); Radioimnaunotherapy of Cancer (Abrams & Fritzberg eds.
2000);
Fleming, AJCC Cancer Staging Handbook (1998); Textbook ofRadiation Oncology (Leibel & Phillips eds. 2000); and Clinical Oncology (Abeloff et al., eds. 2000).
Imaging of colorectal cancer for diagnosis has been problematic and limited.
In addition, metastasis of the tumor to the lumen, and metastasis of tumor cells to regional lymph nodes are important prognostic factors (see, e.g., PET in Oncology:
Basics and Clinical Application (Ruhlinann et al. eds. 1999). For example, five year survival rates drop from 80 percent in patients with no lymph node metastases to 45 to SO percent in those patients who do have lymph node metastases. A recent report showed that micrometastases can be detected from lymph nodes using reverse transcriptase-PCR methods based on the presence of mRNA for carcinoembryonic antigen, which has previously been shown to be present in the vast majority of colorectal cancers but not in normal tissues.
Liefers et al., New England J. ofMed. 339(4):223 (1998). In addition, colorectal cancers often metastasize to the liver. However, the lack of information about the gene expression exhibited by these cancers limits the ability to effectively diagnose and treat the disease.
Thus, methods for diagnosis and prognosis of metastatic colorectal cancer and effective treatment of colorectal cancer would be desirable. Accordingly, provided herein are methods that can be used in diagnosis and prognosis of metastatic colorectal cancer. Further provided are methods that can be used to screen candidate therapeutic agents for the ability to modulate, e.g., treat, colorectal cancer. Additionally, provided herein are molecular targets and compositions for therapeutic intervention in metastatic colorectal disease and other metastatic cancers.
SUMMARY OF THE INVENTION
The present invention therefore provides nucleotide sequences of genes that are up- and down-regulated in metastatic colorectal cancer cells. Such genes and the proteins they encode are useful for diagnostic and prognostic purposes, and also as targets for screening for therapeutic compounds that modulate metastatic colorectal cancer, such as antibodies. The methods of detecting nucleic acids of the invention or their encoded proteins can be used for a number of purposes. Examples include, early detection of colon cancers, monitoring and early detection of relapse following treatment of colon cancers, monitoring response to therapy of colon cancers, determining prognosis of colon cancers, directing therapy of colon cancers, selecting patients for postoperative chemotherapy or radiation therapy, selecting therapy, determining tumor prognosis, treatment, or response to treatment, and early detection of precancerous colon adenomas. Other aspects of the invention will become apparent to the skilled artisan by the following description of the invention.
In one aspect, the present invention provides a method of detecting a metastatic colorectal cancer-associated transcript in a cell from a patient, the method comprising contacting a biological sample from the patient with a polynucleotide that selectively hybridizes to a sequence at least 80% identical to a sequence as shown in Tables 1-26.
In one embodiment, the polynucleotide selectively hybridizes to a sequence at least 95% identical to a sequence as shown in Tables 1-26. In another embodiment, the polynucleotide comprises a sequence as shown in Tables 1-26.
In one embodiment, the biological sample is a tissue sample. In another embodiment, the biological sample comprises isolated nucleic acids, e.g., mRNA.
In one embodiment, the polynucleotide is labeled, e.g., with a fluorescent label.
In one embodiment, the polynucleotide is immobilized on a solid surface.
In one embodiment, the patient is undergoing a therapeutic regimen to treat metastatic colorectal cancer. In another embodiment, the patient is suspected of having metastatic colorectal cancer.
In one embodiment, the patient is a human.
In one embodiment, the method further comprises the step of amplifying nucleic acids before the step of contacting the biological sample with the polynucleotide.
In another aspect, the present invention provides methods of detecting polypeptide encoded by a metastatic colorectal cancer-associated transcript in a cell from a patient, the method comprising contacting a biological sample from the patient with an antibody that specifically binds a polypeptide encoded by a sequence at least 80% identical to a sequence as shown in Tables 1-26.

In another aspect, the present invention provides a method of monitoring the efficacy of a therapeutic treatment of metastatic colorectal cancer, the method comprising the steps of: (i) providing a biological sample from a patient undergoing the therapeutic treatment; and (ii) determining the level of a metastatic colorectal cancer-associated transcript in the biological sample by contacting the biological sample with a polynucleotide that selectively hybridizes to a sequence at least 80% identical to a sequence as shown in Tables 1-26., thereby monitoring the efficacy of the therapy.
In one embodiment, the method further comprises the step of (iii) comparing the level of the metastatic colorectal cancer-associated transcript to a level of the metastatic colorectal cancer-associated transcript in a biological sample from the patient prior to, or earlier in, the therapeutic treatment.
In another aspect, the present invention provides a method of monitoring the efficacy of a therapeutic treatment of metastatic colorectal cancer, the method comprising the steps of (i) providing a biological sample from a patient undergoing the therapeutic treatment; and (ii) determining the level of a metastatic colorectal cancer-associated antibody in the biological sample by contacting the biological sample with a polypeptide encoded by a polynucleotide that selectively hybridizes to a sequence at least 80%
identical to a sequence as shown in Tables 1-26, wherein the polypeptide specifically binds to the metastatic colorectal cancer-associated antibody, thereby monitoring the efficacy of the therapy.
In one embodiment, the method further comprises the step of (iii) comparing the level of the metastatic colorectal cancer-associated antibody to a level of the metastatic colorectal cancer-associated antibody in a biological sample from the patient prior to, or earlier in, the therapeutic treatment.
In another aspect, the present invention provides a method of monitoring the efficacy of a therapeutic treatment of metastatic colorectal cancer, the method comprising the steps of (i) providing a biological sample from a patient undergoing the therapeutic treatment; and (ii) determining the level of a metastatic colorectal cancer-associated polypeptide in the biological sample by contacting the biological sample with an antibody, wherein the antibody specifically binds to a polypeptide encoded by a polynucleotide that selectively hybridizes to a sequence at least 80% identical to a sequence as shown in Tables 1-26, thereby monitoring the efficacy of the therapy.
In one embodiment, the method further comprises the step af: (iii) comparing the level of the metastatic colorectal cancer-associated polypeptide to a level of the metastatic colorectal cancer-associated polypeptide in a biological sample from the patient prior to, or earlier in, the therapeutic treatment.
In one aspect, the present invention provides an isolated nucleic acid molecule consisting of a polynucleotide sequence as shown in Tables 1-26.
In one embodiment, an expression vector or cell comprises the isolated nucleic acid.
In one aspect, the present invention provides an isolated polypeptide which is encoded by a nucleic acid molecule having polynucleotide sequence as shown in Tables 1-26.
In another aspect, the present invention provides an antibody that specifically binds to an isolated polypeptide which is encoded by a nucleic acid molecule having polynucleotide sequence as shown in Tables 1-26.
In one embodiment, the antibody is conjugated to an effector component, e.g., a fluorescent label, a radioisotope or a cytotoxic chemical.
In one embodiment, the antibody is an antibody fragment. In another embodiment, the antibody is humanized.
In one aspect, the present invention provides a method of detecting a metastatic colorectal cancer cell in a biological-sample from a patient, the method comprising contacting the biological sample with an antibody as described herein.
In another aspect, the present invention provides a method of detecting antibodies specific to metastatic colorectal cancer in a patient, the method comprising contacting a biological sample from the patient with a polypeptide encoded by a nucleic acid comprises a sequence from Tables 1-26.
In another aspect, the present invention provides a method for identifying a compound that modulates a metastatic colorectal cancer-associated polypeptide, the method comprising the steps of (i) contacting the compound with a metastatic colorectal cancer-associated polypeptide, the polypeptide encoded by a polynucleotide that selectively hybridizes to a sequence at least 80% identical to a sequence as shown in Tables 1-26; and (ii) determining the functional effect of the compound upon the polypeptide.
In one embodiment, the functional effect is a physical effect, an enzymatic effect, or a chemical effect.
In one embodiment, the polypeptide is expressed in a eukaryotic host cell or cell membrane. In another embodiment, the polypeptide is recombinant.
In one embodiment, the functional effect is determined by measuring ligand binding to the polypeptide.

In another aspect, the present invention provides a method of inhibiting proliferation of a metastatic colorectal cancer-associated cell to treat colorectal cancer in a patient, the method comprising the step of administering to the subject a therapeutically effective amount of a compound identified as described herein.
In one embodiment, the compound is an antibody.
In another aspect, the present invention provides a drug screening assay comprising the steps of (i) administering a test compound to a mammal having colorectal cancer or a cell isolated therefrom; (ii) comparing the level of gene expression of a polynucleotide that selectively hybridizes to a sequence at least 50%
identical to a sequence as shown in Tables 1-26, in a treated cell or mammal with the level of gene expression of the polynucleotide in a control cell or mammal, wherein a test compound that modulates the level of expression of the polynucleotide is a candidate for the treatment of colorectal cancer.
In one embodiment, the control is a mammal with colorectal cancer or a cell therefrom that has not been treated with the test compound. In another embodiment, the control is a normal cell or mammal.
In another aspect, the present invention provides a method for treating a mammal having colorectal cancer comprising administering a compound identified by the assay described herein.
In another aspect, the present invention provides a pharmaceutical composition for treating a mammal having colorectal cancer, the composition comprising a compound identified by the assay described herein and a physiologically acceptable excipient.
DETAILED DESCRIPTION OF THE INVENTION
In accordance with the objects outlined above, the present invention provides novel methods for diagnosis and treatment of colon and/or rectal cancer (e.g., colorectal cancer), including metastatic colorectal cancers, as well as methods for screening for compositions which modulate colorectal cancer. By "metastatic colorectal cancer" herein is meant a colon andlor rectal tumor or cancer that is classified as Dukes stage C or D (see, e.g., Cohen et al., Cancer of the Colon, in Cancer: Principles and Practice of Oncology, pp. 1144-1197 (Devita et al., eds., 5th ed. 1997); see also Harrison's Principles of Internal Medicine, pp. 1259-129 (Wilson et al., eds., 12th ed., 1991). "Treatment, monitoring, detection or modulation of metastatic colorectal cancer" includes treatment, monitoring, detection, or modulation of metastatic colorectal disease in those patients who have metastatic colorectal disease (Dukes stage C or D). In Dukes stage A, the tumor has penetrated into, but not through, the bowel wall. In Dukes stage B, the tumor has penetrated through the bowel wall but there is not yet any lymph involvement. In Dukes stage C, the cancer involves regional lymph nodes. In Dukes stage D, there is distant metastasis, e.g., liver, lung, etc.
Tables, l-26 provide UniGene cluster identification numbers for the nucleotide sequence of genes that exhibit increased or decreased expression in metastasizing colorectal cancer samples. Tables 1-26 also provide an exemplar accession number that provides a nucleotide sequence that is part of the UniGene cluster. In Tables 1-26, the ratio provided represents primary tumor samples from known Dukes B stage survivors vs. liver metastasis samples from patients with metastatic colorectal cancer. In these samples, the identified genes are underexpressed in the metastatic samples, as the ratio is greater than one, preferably 1.5 or greater, more preferably 2.0 or greater. In Tables 1-26, the ratio provided represents liver metastasis samples from patients with known metastatic colorectal cancer vs. known primary tumor samples from Dukes B stage survivors. In these samples, the identified genes are overexpressed in the metastatic samples, as the ratio is greater than one, preferably 1.5 or greater, more preferably 2.0 or greater. In Tables 1-26, the ratio provided represents primary tumor samples from known Dukes B stage survivors vs. liver metastasis samples from patients with metastatic colorectal cancer. In these samples, the identified genes are overexpressed in the metastatic samples, as the ratio is less than one, preferably 0.5 or less, more preferably 0.25 or less. Survivors are subjects who have been disease free for five years or longer.
In Tables 1-26, the ratio provided represents liver metastasis samples from patients with known metastatic disease vs. tissue samples from normal colon tissue. In these samples, the identified genes are overexpressed in the metastatic samples, as the ratio is greater than one, preferably 1.5 or greater, more preferably 2.0 or greater.
In Tables 1-26, the ratio represents liver metastasis samples from patients with known metastatic disease vs.
tissue samples from normal colon tissue. In these samples, the identified genes are underexpressed in the metastatic samples, as the ratio is less than one, preferably 0.5 or less, more preferably 0.25 or less.
One of skill will recognize that although the sequences identified in Tables 1-26 exhibited increased or decreased expression in metastasizing colorectal cancer samples, the sequences of the invention, and their encoded proteins, can be used to diagnose, treat or prevent cancers in patients with Dukes stage A or B colorectal cancers.
Alteration of gene expression for a gene in Tables 1-26 may be more likely or less likely to indicate that the subject will progress to metastatic disease. The sequences can also be used to diagnose, treat or prevent precancerous or benign conditions such as precancerous colon adenomas.
Alteration of gene expression for a gene in Tables 1-26 may or may not indicate that the subject is more likely to progress to cancer or to metastatic disease. Thus, although the specification focuses primarily on metastasizing colorectal cancer, the methods described below can also be applied to non- metastasizing colorectal cancers (e.g., Dukes stages A and B) and precancerous or benign conditions (e.g., precancerous adenomas) as well.
Definitions The term "metastatic colorectal cancer protein" or "metastatic colorectal cancer polynucleotide" or "metastatic colorectal cancer-associated transcript"
refers to nucleic acid and polypeptide polymorphic variants, alleles, mutants, and interspecies homologs that: (1) have a nucleotide sequence that has greater than about 60%
nucleotide sequence identity, 65%, 70%, 75%, 80%, 85%, 90%, preferably 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater nucleotide sequence identity, preferably over a region of over a region of at least about 25, 50, 100, 200, 500, 1000, or more nucleotides, to a nucleotide sequence of or associated with a UniGene cluster of Tables 1-26;

(2) bind to antibodies, e.g., polyclonal antibodies, raised against an immunogen comprising an amino acid sequence encoded by a nucleotide sequence of or associated with a UniGene cluster of Tables 1-26, and conservatively modified variants thereof; (3) specifically hybridize under stringent hybridization conditions to a nucleic acid sequence, or the complement thereof of Tables 1-26 and conservatively modified variants thereof or (4) have an amino acid sequence that has greater than about 60% amino acid sequence identity, 65%, 70%, 75%, 80%, 85%, 90°I°, preferably 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%
or greater amino sequence identity, preferably over a region of over a region of at least about 25, 50, 100, 200, 500, 1000, or more amino acid, to an amino acid sequence encoded by a nucleotide sequence of or associated with a UniGene cluster of Tables 1-26. A polynucleotide or polypeptide sequence is typically from a mammal including, but not limited to, primate, e.g., human;
rodent, e.g., rat, mouse, hamster; cow, pig, horse, sheep, or other mammal. A
"metastatic colorectal cancer polypeptide" and a "metastatic colorectal cancer polynucleotide," include both naturally occurring or recombinant.

A "full length" metastatic colorectal cancer protein or nucleic acid refers to a metastatic colorectal cancer polypeptide or polynucleotide sequence, or a variant thereof, that contains all of the elements normally contained in one or more naturally occurring, wild type metastatic colorectal cancer polynucleotide or polypeptide sequences. The "full length" may be prior to, or after, various stages of post-translation processing or splicing, including alternative splicing.
"Biological sample" as used herein is a sample of biological tissue or fluid that contains nucleic acids or polypeptides, e.g., of a metastatic colorectal cancer protein, polynucleotide or transcript. Such samples include, but are not limited to, tissue isolated from primates, e.g., humans, or rodents, e.g., mice, and rats. Biological samples may also include sections of tissues such as biopsy and autopsy samples, frozen sections taken for histologic purposes, blood, plasma, serum, sputum, stool, tears, mucus, hair, skin, etc.
Biological samples also include explants and primary andlor transformed cell cultures derived from patient tissues. A biological sample is typically obtained from a eukaryotic organism, most preferably a mammal such as a primate, e.g., chimpanzee or human; cow;
dog; cat; a rodent, e.g., guinea pig, rat, mouse; rabbit; or other mammal; or a bird; reptile;
fish.
"Providing a biological sample" means to obtain a biological sample for use in methods described in this invention. Most often, this will be done by removing a sample of cells from an animal, but can also be accomplished by using previously isolated cells (e.g., isolated by another person, at another time, and/or for another purpose), or by performing the methods of the invention ih vivo. Archival tissues, having treatment or outcome history, will be particularly useful.
The terms "identical" or percent "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, preferably 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI
web site http://www.ncbi.nlm.nih.govBLAST/ or the like). Such sequences are then said to be "substantially identical." This definition also refers to, or may be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions andlor additions, as well as those that have substitutions, as well as naturally occurring, e.g., polymorphic or allelic variants, and man-made variants. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length.
For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates axe designated, if necessary, and sequence algorithm program parameters are designated.
Preferably, default program parameters can be used, or alternative parameters can be designated.
The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
A "comparison window", as used herein, includes reference to a segment of one of the number of contiguous positions selected from the group consisting typically of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl.
Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol.
Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l.
Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Current Protocols ih Molecular Biology (Ausubel et al., eds.
1995 supplement)).
Preferred examples of algorithms that are suitable for determining percent sequence identity and sequence similarity include the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al., J. Mol. Biol. 215:403-410 (1990). BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov~.
This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short to words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra).
These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, e.g., for nucleotide sequences, the parameters M (reward score for a pair of matching residues;
always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score.
Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X
determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff ~ Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Marlin & Altschul, Proc. Nat'l. Acad. Sci.
USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(I~), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
Log values may be large negative numbers, e.g., 5, 10, 20, 30, 40, 40, 70, 90, 110, 150, 170, etc.
An indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, e.g., where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below.
Yet another indication that two nucleic acid sequences are substantially identical is that the same primexs can be used to amplify the sequences.
A "host cell" is a naturally occurring cell or a transformed cell that contains an expression vector and supports the replication or expression of the expression vector. Host cells may be cultured cells, explants, cells in vivo, and the like. Host cells may be prokaryotic cells such as E. coli, or eukaryotic cells such as yeast, insect, amphibian, or mammalian cells such as CHO, HeLa, and the like (see, e.g., the American Type Culture Collection catalog or web site, www.atcc.org).
The terms "isolated," "purified," or "biologically pure" refer to material that is substantially or essentially free from components that normally accompany it as found in its native state, Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein or nucleic acid that is the predominant species present in a preparation is substantially purified. In particular, an isolated nucleic acid is separated from some open reading frames that naturally flank the gene and encode proteins other than protein encoded by the gene. The term "purified" in some embodiments denotes that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
Preferably, it means that the nucleic acid or protein is at least 85% pure, more preferably at least 95% pure, and most preferably at least 99% pure. "Purify" or "purification" in other embodiments means removing at least one contaminant from the composition to be purified. In this sense, purification does not require that the purified compound be homogenous, e.g., 100% pure.
The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers, those containing modified residues, and non-naturally occurring amino acid polymer.
The term "amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, y-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, e.g., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurnng amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the I(JPAC-ICTB
Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
"Conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical or associated, e.g., naturally contiguous, sequences.
Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode most proteins. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to another of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes silent variations of the nucleic acid. One of skill will recognize that in certain contexts each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, often silent variations of a nucleic acid which encodes a polypeptide is implicit in a described sequence with respect to the expression product, but not with respect to actual probe sequences.
As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid.
Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.

The following eight groups each contain amino acids that are typically conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (I~, Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
Macromolecular structures such as polypeptide structures can be described in terms of various levels of organization. For a general discussion of this organization, see, e.g., Alberts et al., Molecular Biology of the Cell (3rd ed., 1994) and Cantor & Schimmel, Biophysical Chemistry Part L~ The Conformation of Biological Macromolecules (1980).
"Primary structure" refers to the amino acid sequence of a particular peptide.
"Secondary structure" refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains. Domains are portions of a polypeptide that often form a compact unit of the polypeptide and are typically 25 to approximately 500 amino acids long. Typical domains are made up of sections of lesser organization such as stretches of (3-sheet and a-helices. "Tertiary structure" refers to the complete three dimensional structure of a polypeptide monomer. "Quaternary structure" refers to the three dimensional structure formed, usually by the noncovalent association of independent tertiary units. Anisotropic terms are also known as energy terms.
"Nucleic acid" or "oligonucleotide" or "polynucleotide" or grammatical equivalents used herein means at least two nucleotides covalently linked together.
Oligonucleotides are typically from about 5, 6, 7, 8, 9, 10, 12, 15, 25, 30, 40, 50 or more nucleotides in length, up to about 100 nucleotides in length. Nucleic acids and polynucleotides are a polymers of any length, including longer lengths, e.g., 200, 300, 500, 1000, 2000, 3000, 5000, 7000, 10,000, etc. A nucleic acid of the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs are included that may have alternate backbones, comprising, e.g., phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages (see Eckstein, Oligonucleotides and Analogues: A Practical Approach, Oxford University Press); and peptide nucleic acid backbones and linkages. Other analog nucleic acids include those with positive backbones; non-ionic backbones, and non-ribose backbones, including those described in U.S. Patent Nos. 5,235,033 and 5,034,506, and Chapters 6 and 7, ASC
Symposium Series 580, Carbohydrate Modifications in Antisense Research, Sanghui &

Cook, eds.. Nucleic acids containing one or more carbocyclic sugars are also included within one definition of nucleic acids. Modifications of the ribose-phosphate backbone may be done for a variety of reasons, e.g. to increase the stability and half life of such molecules in physiological environments or as probes on a biochip. Mixtures of naturally occurring nucleic acids and analogs can be made; alternatively, mixtures of different nucleic acid analogs, and mixtures of naturally occurring nucleic acids and analogs may be made.
Particularly preferred are peptide nucleic acids (PNA) which includes peptide nucleic acid analogs. These backbones are substantially non-ionic under neutral conditions, in contrast to the highly charged phosphodiester backbone of naturally occurring nucleic acids.
This results in two advantages. First, the PNA backbone exhibits improved hybridization kinetics. PNAs have larger changes in the melting temperature (Tm) for mismatched versus perfectly matched basepairs. DNA and RNA typically exhibit a 2-4°C drop in Tm for an internal mismatch. With the non-ionic PNA backbone, the drop is closer to 7-9°C. Similarly, due to their non-ionic nature, hybridization of the bases attached to these backbones is relatively insensitive to salt concentration. In addition, PNAs are not degraded by cellular enzymes, and thus can be more stable.
The nucleic acids may be single stranded or double stranded, as specified, or contain portions of both double stranded or single stranded sequence. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus the sequences described herein also provide the complement of the sequence. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc. "Transcript" typically refers to a naturally occurring RNA, e.g., a pre-mRNA, hnRNA, or mRNA. As used herein, the term "nucleoside" includes nucleotides and nucleoside and nucleotide analogs, and modified nucleosides such as amino modified nucleosides. In addition, "nucleoside"
includes non-naturally occurring analog structures. Thus, e.g. the individual units of a peptide nucleic acid, each containing a base, are referred to herein as a nucleoside.
A "label" or a "detectable moiety" is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means. For example, useful labels include 32P, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins is or other entities which can be made detectable, e.g., by incorporating a radiolabeh into the peptide or used to detect antibodies specifically reactive with the peptide.
An "effector" or "effector moiety" or "effector component" is a molecule that is bound (or linked, or conjugated), either covalently, through a linker or a chemical bond, or noncovalently, through ionic, van der Waals, electrostatic, or hydrogen bonds, to an antibody.
The "effector" can be a variety of molecules including, e.g., detection moieties including radioactive compounds, fluorescent compounds, an enzyme or substrate, tags such as epitope tags, a toxin; activatable moieties, a chemotherapeutic agent; a lipase; an antibiotic; or a radioisotope emitting "hard" e.g., beta radiation.
A "labeled nucleic acid probe or oligonucleotide" is one that is bound, either covalently, through a linker or a chemical bond, or noncovalently, through ionic, van der Waals, electrostatic, or hydrogen bonds to a label such that the presence of the probe may be detected by detecting the presence of the label bound to the probe.
Alternatively, method using high affinity interactions may achieve the same results where one of a pair of binding partners binds to the other, e.g., biotin, streptavidin.
As used herein a "nucleic acid probe or oligonucleotide" is defined as a nucleic acid capable of binding to a target nucleic acid of complementary sequence through one or more types of chemical bonds, usually through complementary base pairing, usually through hydrogen bond formation. As used herein, a probe may include natural (i.e., A, G, C, or T) or modified bases (7-deazaguanosine, inosine, etc.). In addition, the bases in a probe may be joined by a linkage other than a phosphodiester bond, so long as it does not functionally interfere with hybridization. Thus, e.g., probes may be peptide nucleic acids in which the constituent bases are joined by peptide bonds rather than phosphodiester linkages.
It will be understood by one of skill in the art that probes may bind target sequences lacking complete complementarity with the probe sequence depending upon the stringency of the hybridization conditions. The probes are preferably directly labeled as with isotopes, chromophores, lumiphores, chromogens, or indirectly labeled such as with biotin to which a streptavidin complex may later bind. By assaying for the presence or absence of the probe, one can detect the presence or absence of the select sequence or subsequence.
Diagnosis or prognosis may be based at the genomic level, or at the level of RNA or protein expression.
The term "recombinant" when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, e.g., recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all. By the term "recombinant nucleic acid" herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases and endonucleases, in a form not normally found in nature. In this manner, operably linkage of different sequences is achieved. Thus an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined, are both considered recombinant for the purposes of this invention. It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention. Similarly, a "recombinant protein" is a protein made using recombinant techniques, i.e., through the expression of a recombinant nucleic acid as depicted above.
The term "heterologous" when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not normally found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences, e.g., from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source. Similarly, a heterologous protein will often refer to two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).
A "promoter" is defined as an array of nucleic acid control sequences that direct transcription of a nucleic acid. As used herein, a promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A "constitutive" promoter is a promoter that is active under most environmental and developmental conditions. An "inducible" promoter is a promoter that is active under environmental or developmental regulation. The term "operably linked" refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
An "expression vector" is a nucleic acid construct, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a host cell. The expression vector can be part of a plasmid, virus, or nucleic acid fragment. Typically, the expression vector includes a nucleic acid to be transcribed operably linked to a promoter.
The phrase "selectively (or specifically) hybridizes to" refers to the binding, duplexing, or hybridizing of a molecule only to a particular nucleotide sequence under stringent hybridization conditions when that sequence is present in a complex mixture (e.g., total cellular or library DNA or RNA).
The phrase "stringent hybridization conditions" refers to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acids, but to essentially no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques ira Biochemistry and Molecular Biology--Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993). Generally, stringent conditions are selected to be about 5-10°C lower than the thermal melting point (Tin) for the specific sequence at a defined ionic strength pH. The Tm is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium). Stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than SO
nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal is at least two times background, preferably 10 times background hybridization. Exemplary stringent hybridization conditions are often: SO% formamide, Sx SSC, and 1% SDS, incubating at 42°C, or, Sx SSC, 1% SDS, incubating at 65°C, with wash in 0.2x SSC, and 0.1% SDS at 65°C. For PCR, a temperature of about 36°C is typical for low stringency amplification, although annealing temperatures may vary between about 32°C and 48°C depending on primer length. For high stringency PCR amplification, a temperature of about 62°C is typical, although high stringency annealing temperatures can range from about 50°C to about 65°C, depending on the primer length and specificity. Typical cycle conditions for both high and low stringency amplifications include a denaturation phase of 90°C -95°C for 30 sec - 2 min., an annealing phase lasting 30 sec. - 2 min., and an extension phase of about 72°C for 1 -2 min. Protocols and guidelines for low and high stringency amplification reactions are provided, e.g., in Itmis et al., PCR Protocols, A Guide to Methods and Applications (1990).
Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical.
This occurs, e.g., when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code. In such cases, the nucleic acids typically hybridize under moderately stringent hybridization conditions. Exemplary "moderately stringent hybridization conditions" include a hybridization in a buffer of 40%
formamide, 1 M NaCI, 1% SDS at 37°C, and a wash in 1X SSC at 45°C. A positive hybridization is at least twice background. Those of ordinary skill will readily recognize that alternative hybridization and wash conditions can be utilized to provide conditions of similar stringency.
Additional guidelines for determining hybridization parameters are provided in numerous reference, e.g., and Current Protocols in Molecular Biology, ed. Ausubel, et al.
The phrase "functional effects" in the context of assays for testing compounds that modulate activity of a metastatic colorectal cancer protein includes the determination of a parameter that is indirectly or directly under the influence of the metastatic colorectal cancer protein or nucleic acid, e.g., an enzymatic, functional, physical, or chemical effect, such as the ability to decrease metastatic colorectal cancer. It includes ligand binding activity; cell growth on soft agar; anchorage dependence; contact inhibition and density limitation of growth; cellular proliferation; cellular transformation; growth factor or serum dependence;
tumor specific marker levels; invasiveness into Matrigel; tumor growth and metastasis in vivo; mRNA and protein expression in cells undergoing metastasis, and other characteristics of metastatic colorectal cancer cells. "Functional effects" include in vitro, in vivo, and ex vivo activities.
By "determining the functional effect" is meant assaying for a compound that increases or decreases a parameter that is indirectly or directly under the influence of a metastatic colorectal cancer protein sequence, e.g., functional, enzymatic, physical and chemical effects. Such functional effects can be measured by any means known to those skilled in the art, e.g., changes in spectroscopic characteristics (e.g., fluorescence, absorbance, refractive index), hydrodynamic (e.g., shape), chromatographic, or solubility properties for the protein, measuring inducible markers or transcriptional activation of the metastatic colorectal cancer protein; measuring binding activity or binding assays, e.g., binding to antibodies or other ligands, and measuring cellular proliferation.
Determination of the functional effect of a compound on metastatic colorectal cancer can also be performed using metastatic colorectal cancer assays known to those of skill in the art such as an in vitro assays, e.g., cell growth on soft agar; anchorage dependence; contact inhibition and density limitation of growth; cellular proliferation; cellular transformation; growth factor or serum dependence; tumor specific marker levels; invasiveness into Matrigel; tumor growth and metastasis ih vivo; mRNA and protein expression in cells undergoing metastasis, and other characteristics of metastatic colorectal cancer cells. The functional effects can be evaluated by many means known to those skilled in the art, e.g., microscopy for quantitative or qualitative measures of alterations in morphological features, measurement of changes in RNA or protein levels for metastatic colorectal cancer-associated sequences, measurement of RNA stability, identification of downstream or reporter gene expression (CAT, luciferase, ~3-gal, GFP and the like), e.g., via chemiluminescence, fluorescence, colorimetric reactions, antibody binding, inducible markers, and ligand binding assays.
"Inhibitors", "activators", and "modulators" of metastatic colorectal cancer polynucleotide and polypeptide sequences are used to refer to activating, inhibitory, or modulating molecules or compounds identified using in vitro and in vivo assays of metastatic colorectal cancer polynucleotide and polypeptide sequences of the invention.
Inhibitors are compounds that, e.g., bind to, partially or totally block activity, decrease, prevent, delay activation, inactivate, desensitize, or down regulate the activity or expression of metastatic colorectal cancer proteins of the invention, e.g., antagonists. Antisense nucleic acids may seem to inhibit expression and subsequent function of the protein.
"Activators" are compounds that increase, open, activate, facilitate, enhance activation, sensitize, agonize, or up regulate metastatic colorectal cancer protein activity. Inhibitors, activators, or modulators also include genetically modified versions of metastatic colorectal cancer proteins, e.g., versions with altered activity, as well as naturally occurnng and synthetic ligands, antagonists, agonists, antibodies, small chemical molecules and the like. Such assays for inhibitors and activators include, e.g., expressing the metastatic colorectal cancer protein in vitro, in cells, or cell membranes, applying putative modulator compounds, and then determining the functional effects on activity, as described above. Activators and inhibitors of metastatic colorectal cancer can also be identified by incubating metastatic colorectal cancer cells with the test compound and determining increases or decreases in the expression of 1 or more metastatic colorectal cancer proteins, e.g., 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50 or more metastatic colorectal cancer proteins, such as colorectal cancer proteins encoded by the sequences set out in Tables 1-26.
Samples or assays comprising metastatic colorectal cancer proteins that are treated with a potential activator, inhibitor, or modulator are compared to control samples without the inhibitor, activator, or modulator to examine the extent of inhibition. Control samples (untreated with inhibitors) are assigned a relative protein activity value of 100%.
Inhibition of a polypeptide is achieved when the activity value relative to the control is about 80%, preferably 50%, more preferably 25-0%. Activation of a metastatic colorectal cancer polypeptide is achieved when the activity value relative to the control (untreated with activators) is 110%, more preferably 150%, more preferably 200-500% (i.e., two to five fold higher relative to the control), more preferably 1000-3000% higher.
The phrase "changes in cell growth" refers to any change in cell growth and proliferation characteristics in vitro or in vivo, such as formation of foci, anchorage independence, semi-solid or soft agar growth, changes in contact inhibition and density limitation of growth, loss of growth factor or serum requirements, changes in cell morphology, gaining or losing immortalization, gaining or losing tumor specific markers, ability to form or suppress tumors when injected into suitable animal hosts, andlor immortalization of the cell. See, e.g., Freshney, Culture of Animal Cells a Ma~aual of Basic Technique pp. 231-241 (3rd ed. 1994).
"Tumor cell" refers to precancerous, cancerous, and normal cells in a tumor.
"Cancer cells," "transformed" cells or "transformation" in tissue culture, refers to spontaneous or induced phenotypic changes that do not necessarily involve the uptake of new genetic material. Although transformation can arise from infection with a transforming virus and incorporation of new genomic DNA, or uptake of exogenous DNA, it can also arise spontaneously or following exposure to a carcinogen, thereby mutating an endogenous gene.
Transformation is associated with phenotypic changes, such as immortalization of cells, aberrant growth control, nonmorphological changes, and/or malignancy (see, Freshney, Culture ofAnimal Cells a Manual of Basic Technique (3rd ed. 1994)).
"Antibody" refers to a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen.

The recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively. Typically, the antigen-binding region of an antibody or its functional equivalent will be most critical in specificity and affinity of binding. See Paul, Fundamental Immunology.
An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kD) and one "heavy" chain (about 50-70 kD). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains respectively.
Antibodies exist, e.g., as intact immunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases. Thus, e.g., pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab')Z, a dimer of Fab which itself is a light chain joined to VH-CH1 by a disulfide bond. The F(ab')a may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab')'2 dimer into an Fab' monomer. The Fab' monomer is essentially Fab with part of the hinge region (see Fundamental Immunology (Paul ed., 3d ed.
1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de novo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries (see, e.g., McCafferty et al., Nature 348:552-554 (1990)) For preparation of antibodies, e.g., recombinant, monoclonal, or polyclonal antibodies, many technique known in the art can be used (see, e.g., Kohler &
Milstein, Nature 256:495-497 (1975); Kozbor et al., Immunology Today 4:72 (1983); Cole et al., pp.
77-96 in Monoclonal Antibodies and Cancer Therapy (1985); Coligan, Current Protocols in Immunology (1991); Harlow & Lane, Antibodies, A Laboratory Manual (1988); and Goding, Monoclonal Antibodies: Principles and Practice (2d ed. 1986)). Techniques for the production of single chain antibodies (LJ.S. Patent 4,946,778) can be adapted to produce antibodies to polypeptides of this invention. Also, transgenic mice, or other organisms such as other mammals, may be used to express humanized antibodies. Alternatively, phage display technology can be used to identify antibodies and heteromeric Fab fragments that specifically bind to selected antigens (see, e.g., McCafferty et al., Nature 348:552-554 (1990); Marks et aZ., Biotechnology 10:779-783 (1992)).
A "chimeric antibody" is an antibody molecule in which, e.g, (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
Identification of metastatic colorectal cancer-associated sequences In one aspect, the expression levels of genes are determined in different patient samples for which diagnosis information is desired, to provide expression profiles.
An expression profile of a particular sample is essentially a "fingerprint" of the state of the sample; while two states may have any particular gene similarly expressed, the evaluation of a number of genes simultaneously allows the generation of a gene expression profile that is characteristic of the state of the cell. That is, normal tissue may be distinguished from cancerous or metastatic cancerous tissue, or metastatic cancerous tissue can be compared with tissue from surviving cancer patients. By comparing expression profiles of tissue in known different metastatic colorectal cancer states, information regarding which genes are important (including both up- and down-regulation of genes) in each of these states is obtained.
The identification of sequences that are differentially expressed in metastatic colorectal cancer versus non-metastatic colorectal cancer tissue allows the use of this information in a number of ways. For example, a particular treatment regime may be evaluated: does a chemotherapeutic drug act to down-regulate metastatic colorectal cancer, and thus tumor growth or recurrence, in a particular patient. Similarly, diagnosis and treatment outcomes may be done or confirmed by comparing patient samples with the known expression profiles. Metastatic tissue can also be analyzed to determine the stage of metastatic colorectal cancer in the tissue. Furthermore, these gene expression profiles (or individual genes) allow screening of drug candidates with an eye to mimicking or altering a particular expression profile; e.g., screening can be done for drugs that suppress the metastatic colorectal cancer expression profile. This may be done by making biochips comprising sets of the important metastatic colorectal cancer genes, which can then be used in these screens. PCR methods may be applied with selected primer pairs, and analysis may be of RNA or of genomic sequences. These methods can also be done on the protein basis;
that is, protein expression levels of the metastatic colorectal cancer proteins can be evaluated for diagnostic purposes or to screen candidate agents. In addition, the metastatic colorectal cancer nucleic acid sequences can be administered for gene therapy purposes, including the administration of antisense nucleic acids, or the metastatic colorectal cancer proteins (including antibodies and other modulators thereof administered as therapeutic drugs or as protein or DNA vaccines.
Thus the present invention provides nucleic acid and protein sequences that are differentially expressed in metastatic colorectal cancer, herein termed "metastatic colorectal cancer sequences." As outlined below, metastatic colorectal cancer sequences include those that are up-regulated (i.e., expressed at a higher level) in metastatic colorectal cancer, as well as those that are down-regulated (i.e., expressed at a lower level). In a preferred embodiment, the metastatic colorectal cancer sequences are from humans; however, as will be appreciated by those in the art, metastatic colorectal cancer sequences from other organisms may be useful in animal models of disease and drug evaluation; thus, other metastatic colorectal cancer sequences are provided, from vertebrates, including mammals, including rodents (rats, mice, hamsters, guinea pigs, etc.), primates, farm animals (including sheep, goats, pigs, cows, horses, etc.) and pets (dogs, cats, etc.).
Metastatic colorectal cancer sequences from other organisms may be obtained using the techniques outlined below.
Metastatic colorectal cancer sequences can include both nucleic acid and amino acid sequences. As will be appreciated by those in the art and is more fully outlined below, metastatic colorectal cancer nucleic acid sequences are useful in a variety of applications, including diagnostic applications, which will detect naturally occurring nucleic acids, as well as screening applications; e.g., biochips comprising nucleic acid probes or PCR
microtiter plates with selected probes to the metastatic colorectal cancer sequences can be generated.
A metastatic colorectal cancer sequence can be initially identified by substantial nucleic acid and/or amino acid sequence homology to the metastatic colorectal cancer sequences outlined herein. Such homology can be based upon the overall nucleic acid or amino acid sequence, and is generally determined as outlined below, using either homology programs or hybridization conditions.
For identifying metastatic colorectal cancer-associated sequences, the metastatic colorectal cancer screen typically includes comparing genes identified in different tissues, e.g., normal and cancerous tissues, or tumor tissue samples from patients who have metastatic disease vs. non metastatic tissue, or tumor tissue samples from patients who have been diagnosed with Dukes stage A or B cancer but have survived vs. metastatic tissue.
Other suitable tissue comparisons include comparing metastatic colorectal cancer samples with metastatic cancer samples from other cancers, such as lung, breast, other gastrointestinal cancers, prostate, ovarian, etc. Samples of, e.g., Dukes stage B survivor tissue and tissue undergoing metastasis are applied to biochips comprising nucleic acid probes.
The samples are first microdissected, if applicable, and treated as is known in the art for the preparation of mRNA. Suitable biochips are commercially available, e.g., from Affymetrix.
Gene expression profiles as described herein are generated and the data analyzed.
In one embodiment, the genes showing changes in expression as between normal and disease states are compared to genes expressed in other normal tissues, preferably normal colon, but also including, and not limited to lung, heart, brain, liver, breast, kidney, muscle, prostate, small intestine, large intestine, spleen, bone and placenta.
In a preferred embodiment, those genes identified during the metastatic colorectal cancer screen that are expressed in significant amounts in other tissues are removed from the profile, although in some embodiments, this is not necessary. That is, when screening for drugs, it is usually preferable that the target be disease specific, to minimize possible side effects.
In a preferred embodiment, metastatic colorectal cancer sequences are those that are up-regulated in metastatic colorectal cancer; that is, the expression of these genes is higher in the metastatic tissue as compared to non-metastatic cancerous tissue or normal colon tissue (see, e.g., Tables 1-25). "Up-regulation" as used herein means, when the ratio is presented as a number greater than one, that the ratio is greater than one, preferably 1.5 or greater, more preferably 2.0 or greater. All UniGene cluster identification numbers and accession numbers herein are for the GenBank sequence database and the sequences of the accession numbers are hereby expressly incorporated by reference. GenBank is known in the art, see, e.g., Benson, DA, et al., Nucleic Acids Research 25:1-7 (1998) and http:/lwww.ncbi.nlin.nih.gov/. Sequences are also available in other databases, e.g., European Molecular Biology Laboratory (EMBL) and DNA Database of Japan (DDBJ).
2s In another preferred embodiment, metastatic colorectal cancer sequences are those that are down-regulated in the metastatic colorectal cancer; that is, the expression of these genes is lower in metastatic tissue as compared to non-metastatic cancerous tissue or normal colon tissue (see, e.g., Tables 1-26). "Down-regulation" as used herein means, when the ratio is presented as a number greater than one, that the ratio is greater than one, preferably 1.5 or greater, more preferably 2.0 or greater, or, when the ratio is presented as a number less than one, that the ratio is less than one, preferably 0.5 or less, more preferably 0.25 or less.
Informatics The ability to identify genes that axe over or under expressed in metastatic colorectal cancer can additionally provide high-resolution, high-sensitivity datasets which can be used in the areas of diagnostics, therapeutics, drug development, pharmacogenetics, protein structure, biosensor development, and other related areas. For example, the expression profiles can be used in diagnostic or prognostic evaluation of patients with metastatic colorectal cancer. Or as another example, subcellular toxicological information can be generated to better direct drug structure and activity correlation (see Anderson, Pharmaceutical Proteornics: Targets, Mechanism, and Functi~n, paper presented at the IBC
Proteomics conference, Coronado, CA (June 11-12, 1998)). Subcellular toxicological information can also be utilized in a biological sensor device to predict the likely toxicological effect of chemical exposures and likely tolerable exposure thresholds (see U.S.
Patent No. 5,811,231). Similar advantages accrue from datasets relevant to other biomolecules and bioactive agents (e.g., nucleic acids, saccharides, lipids, drugs, and the like).
Thus, in another embodiment, the present invention provides a database that includes at least one set of assay data. The data contained in the database is acquired, e.g., using array analysis either singly or in a library format. The database can be in substantially any form in which data can be maintained and transmitted, but is preferably an electronic database. The electronic database of the invention can be maintained on any electronic device allowing for the storage of and access to the database, such as a personal computer, but is preferably distributed on a wide area network, such as the World Wide Web.
The focus of the present section on databases that include peptide sequence data is for clarity of illustration only. It will be apparent to those of skill in the art that similar databases can be assembled for assay data acquired using an assay of the invention.

The compositions and methods for identifying and/or quantitating the relative and/or absolute abundance of a variety of molecular and macromolecular species from a biological sample undergoing metastatic colorectal cancer, i.e., the identification of metastatic colorectal cancer-associated sequences described herein, provide an abundance of information, which can be correlated with pathological conditions, predisposition to disease, drug testing, therapeutic monitoring, gene-disease causal linkages, identification of correlates of immunity and physiological status, among others. Although the data generated from the assays of the invention is suited for manual review and analysis, in a preferred embodiment, prior data processing using high-speed computers is utilized.
An array of methods for indexing and retrieving biomolecular information is known in the art. For example, U.S. Patents 6,023,659 and 5,966,712 disclose a relational database system for storing biomolecular sequence information in a manner that allows sequences to be catalogued and searched according to one or more protein function hierarchies. U.S. Patent 5,953,727 discloses a relational database having sequence records containing information in a format that allows a collection of partial-length DNA sequences to be catalogued and searched according to association with one or more sequencing projects for obtaining full-length sequences from the collection ofpartial length sequences. U.S.
Patent 5,706,498 discloses a gene database retrieval system for making a retrieval of a gene sequence similar to a sequence data item in a gene database based on the degree of similarity between a key sequence and a target sequence. U.S. Patent 5,538,897 discloses a method using mass spectroscopy fragmentation patterns of peptides to identify amino acid sequences in computer databases by comparison of predicted mass spectra with experimentally-derived mass spectra using a closeness-of fit measure. U.S. Patent 5,926,818 discloses a multi-dimensional database comprising a functionality for multi-dimensional data analysis described as on-line analytical processing (OLAP), which entails the consolidation of projected and actual data according to more than one consolidation path or dimension. U.S.
Patent 5,295,261 reports a hybrid database structure in which the fields of each.database record are divided into two classes, navigational and informational data, with navigational fields stored in a hierarchical topological map which can be viewed as a tree structure or as the merger of two or more such tree structures.
See also Mount et al., Bioinfot~matics (2001); Biological Sequence Analysis:
Probabilistic Models of PYOteins and Nucleic Acids (Durbin et al., eds., 1999);
Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins (Baxevanis &
Oeullette eds., 1998)); Rashidi & Buehler, Bioinformatics: Basic Applications in Biological Science and Medicine (1999); Introduction to Computational Molecular Biology (Setubal et al., eds 1997); Bioinformatics: Methods and Protocols (Misener & Krawetz, eds, 2000);
Bioinformatics: Sequence, Structure, arad Databanks: A Practical Approach (Higgins &
Taylor, eds., 2000); Brown, Bioinformatics: A Biologist's Guide to Biocomputing and the Internet (2001); Han & Kamber, Data Mining: Concepts and Techniques (2000);
and Waterman, Introduction to Computational Biology: Maps, Sequences, and Genomes (1995).
The present invention provides a computer database comprising a computer and software for storing in computer-retrievable form assay data records cross-tabulated, e.g., with data specifying the source of the target-containing sample from which each sequence specificity record was obtained.
In an exemplary embodiment, at least one of the sources of target-containing sample is from a control tissue sample known to be free of pathological disorders. In a variation, at least one of the sources is a known pathological tissue specimen, e.g., a neoplastic lesion or another tissue specimen to be analyzed for metastatic colorectal cancer.
In another variation, the assay records cross-tabulate one or more of the following parameters for each target species in a sample: (1) a unique identification code, which can include, e.g., a target molecular structure and/or characteristic separation coordinate (e.g., electrophoretic coordinates); (2) sample source; and (3) absolute and/or relative quantity of the target species present in the sample.
The invention also provides for the storage and retrieval of a collection of target data in a computer data storage apparatus, which can include magnetic disks, optical disks, magneto-optical disks, DRAM, SRAM, SGRAM, SDRAM, RDRAM, DDR RAM, magnetic bubble memory devices, and other data storage devices, including CPU
registers and on-CPU data storage arrays. Typically, the target data records are stored as a bit pattern in an array of magnetic domains on a magnetizable medium or as an array of charge states or transistor gate states, such as an array of cells in a DRAM device (e.g., each cell comprised of a transistor and a charge storage area, which may be on the transistor). In one embodiment, the invention provides such storage devices, and computer systems built therewith, comprising a bit pattern encoding a protein expression fingerprint record comprising unique identifiers for at least 10 target data records cross-tabulated with target source.
When the target is a peptide or nucleic acid, the invention preferably provides a method for identifying related peptide or nucleic acid sequences, comprising performing a computerized comparison between a peptide or nucleic acid sequence assay record stored in or retrieved from a computer storage device or database and at least one other sequence. The comparison can include a sequence analysis or comparison algorithm or computer program embodiment thereof (e.g., FASTA, TFASTA, GAP, BESTFIT) and/or the comparison may be of the relative amount of a peptide or nucleic acid sequence in a pool of sequences determined from a polypeptide or nucleic acid sample of a specimen.
The invention also preferably provides a magnetic disk, such as an IBM-compatible (DOS, Windows, Windows95/98/2000, Windows NT, OS/2) or other format (e.g., Linux, SunOS, Solaris, AIX, SCO Unix, VMS, MV, Macintosh, etc.) floppy diskette or hard (fixed, Winchester) disk drive, comprising a bit pattern encoding data from an assay of the invention in a file format suitable for retrieval and processing in a computerized sequence analysis, comparison, or relative quantitation method.
The invention also provides a network, comprising a plurality of computing devices linked via a data link, such as an Ethernet cable (coax or lOBaseT), telephone line, ISDN line, wireless network, optical fiber, or other suitable signal transmission medium, whereby at least one network device (e.g., computer, disk array, etc.) comprises a pattern of magnetic domains (e.g., magnetic disk) and/or charge domains (e.g., an array of DRAM
cells) composing a bit pattern encoding data acquired from an assay of the invention.
The invention also provides a method for transmitting assay data that includes generating an electronic signal on an electronic communications device, such as a modem, ISDN terminal adapter, DSL, cable modem, ATM switch, or the like, wherein the signal includes (in native or encrypted format) a bit pattern encoding data from an assay or a database comprising a plurality of assay results obtained by the method of the invention.
In a preferred embodiment, the invention provides a computer system for comparing a query target to a database containing an array of data structures, such as an assay result obtained by the method of the invention, and ranking database targets based on the degree of identity and gap weight to the target data. A central processor is preferably initialized to load and execute the computer program for alignment and/or comparison of the assay results. Data for a query target is entered into the central processor via an I/O device.
Execution of the computer program results in the central processor retrieving the assay data from the data file, which comprises a binary description of an assay result.
The target data or record and the computer program can be transferred to secondary memory, which is typically random access memory (e.g., DRAM, SRAM, SGRAM, or SDRAM). Targets are ranked according to the degree of correspondence between a selected assay characteristic (e.g., binding to a selected affinity moiety) and the lama characteristic of the query target and results are output via an I/O
device. For example, a central processor can be a conventional computer (e.g., Intel Pentium, PowerPC, Alpha, PA-8000, SPARC, MIPS 4400, MIPS 10000, VAX, etc.); a program can be a commercial or public domain molecular biology software package (e.g., UWGGG Sequence Analysis Software, Darwin); a data file can be an optical or magnetic disk, a data server, a memory device (e.g., DRAM, SRAM, SGRAM, SDRAM, EPROM, bubble memory, flash memory, etc.); an I/O device can be a terminal comprising a video display and a keyboard, a modem, an ISDN terminal adapter, an Ethernet port, a punched card reader, a magnetic strip reader, or other suitable I/O device.
The invention also preferably provides the use of a computer system, such as that described above, which comprises: (1) a computer; (~) a stored bit pattern encoding a collection of peptide sequence specificity records obtained by the methods of the invention, which may be stored in the computer; (3) a comparison target, such as a query target; and (4) a program for alignment and comparison, typically with rank-ordering of comparison results on the basis of computed similarity values.
Characteristics of metastatic colorectal cancer-associated proteins Metastatic colorectal cancer proteins of the present invention may be classified as secreted proteins, transmembrane proteins or intracellular proteins. In one embodiment, the metastatic colorectal cancer protein is an intracellular protein.
Intracellular proteins may be found in the cytoplasm and/or in the nucleus and/or in the organelles.
Proteins containing one or more transmembrane domains that exclusively reside in organelles are also considered intracellular proteins. Intracellular proteins are involved in all aspects of cellular function and replication (including, e.g., signaling pathways); aberrant expression of such proteins often results in unregulated or disregulated cellular processes (see, e.g., lllolecular Biol~gy of the Cell (Alberts, ed., 3rd ed., 1994). For example, many intracellular proteins have enzymatic activity such as protein kinase activity, protein phosphatase activity, protease activity, nucleotide cyclase activity, polymerase activity and the like.
Intracellular proteins also serve as docking proteins that are involved in organizing complexes of proteins, or targeting proteins to various subcellular localizations, and are involved in maintaining the structural integrity of organelles.
An increasingly appreciated concept in characterizing proteins is the presence in the proteins of one or more motifs for which defined functions have been attributed. In addition to the highly conserved sequences found in the enzymatic domain of proteins, highly conserved sequences have been identified in proteins that are involved in protein-protein interaction. For example, Src-homology-2 (SH2) domains bind tyrosine-phosphorylated targets in a sequence dependent manner. PTB domains, which are distinct from domains, also bind tyrosine phosphorylated targets. SH3 domains bind to proline-rich targets. In addition, PH domains, tetratricopeptide repeats and WD domains to name only a few, have been shown to mediate protein-protein interactions. Some of these may also be involved in binding to phospholipids or other second messengers. As will be appreciated by one of ordinary skill in the art, these motifs can be identified on the basis of primary sequence; thus, an analysis of the sequence of proteins may provide insight into both the enzymatic potential of the molecule and/or molecules with which the protein may associate.
One useful database is Pfam (protein families), which is a large collection of multiple sequence alignments and hidden Markov models covering many common protein domains.
Versions are available via the Internet from Washington University in St.
Louis, the Sanger Center in England, and the I~arolinska Institute in Sweden (see, e.g., Bateman et al., Nuc.
Acids Res. 28:263-266 (2000); Sonnhammer et al., Proteins 28:405-420 (1997);
Bateman et al., Nuc. Acids Res. 27:260-262 (1999); and Sonnhammer et al., Nuc. Aeids Res.
26:320-322-(1998)).
In another embodiment, the metastatic colorectal cancer sequences are transmembrane proteins. Transmembrane proteins are molecules that span a phospholipid bilayer of a cell. They may have an intracellular domain, an extracellular domain, or both.
The intracellular domains of such proteins may have a number of functions including those already described for intracellular proteins. For example, the intracellular domain may have enzymatic activity and/or may serve as a binding site for additional proteins.
Frequently the intracellular domain of transmembrane proteins serves both roles. For example certain receptor tyrosine kinases have both protein kinase activity and SH2 domains.
In addition, autophosphorylation of tyrosines on the receptor molecule itself, creates binding sites for additional SH2 domain containing proteins.
Transmembrane proteins may contain from one to many transmembrane domains. For example, receptor tyrosine kinases, certain cytokine receptors, receptor guanylyl cyclases and receptor serine/threonine protein kinases contain a single transmembrane domain. However, various other proteins including channels, pumps, and adenylyl cyclases contain numerous transmembrane domains. Many important cell surface receptors such as G protein coupled receptors (GPCRs) are classified as "seven transmembrane domain" proteins, as they contain 7 membrane spanning regions.
Characteristics of transmembrane domains include approximately 20 consecutive hydrophobic amino acids that may be followed by charged amino acids.
Therefore, upon analysis of the amino acid sequence of a particular protein, the localization and number of transmembrane domains within the protein may be predicted (see, e.g. PSORT web site http:llpsort.nibb.ac ;jpn.
The extracellular domains of transmembrane proteins are diverse; however, conserved motifs are found repeatedly among various extracellular domains.
Conserved structure and/or functions have been ascribed to different extracellular motifs. Many extracellular domains are involved in binding to other molecules. In one aspect, extracellular domains are found on receptors. Factors that bind the receptor domain include circulating ligands, which may be peptides, proteins, or small molecules such as adenosine and the like.
For example, growth factors such as EGF, FGF and PDGF are circulating growth factors that bind to their cognate receptors to initiate a variety of cellular responses.
Other factors include cytokines, mitogenic factors, hormones, neurotrophic factors and the like.
Extracellular domains also bind to cell-associated molecules. In this respect, they mediate cell-cell interactions. Cell-associated ligands can be tethered to the cell, e.g., via a glycosylphosphatidylinositol (GPI) anchor, or may themselves be transmembrane proteins.
Extracellular domains also associate with the extracellular matrix and contribute to the maintenance of the cell structure.
Metastatic colorectal cancer proteins that are transmembrane are particularly preferred in the present invention as they are readily accessible targets for extracellular immunotherapeutics, as are described herein. In addition, as outlined below, transmembrane proteins can be also useful in imaging modalities. Antibodies may be used to label such readily accessible proteins in situ or in histological analysis.
Alternatively, antibodies can also label intracellular proteins, in which case analytical samples are typically permeablized to provide access to intracellular proteins.
It will also be appreciated by those in the art that a transmembrane protein can be made soluble by removing transmembrane sequences, e.g., through recombinant methods.
Furthermore, transmembrane proteins that have been made soluble can be made to be secreted through recombinant means by adding an appropriate signal sequence.
In another embodiment, the metastatic colorectal cancer proteins are secreted proteins; the secretion of which can be either constitutive or regulated.
These proteins have a signal peptide or signal sequence that targets the molecule to the secretory pathway. Secreted proteins are involved in numerous physiological events; by virtue of their circulating nature, they often serve to transmit signals to various other cell types. The secreted protein may function in an autocrine manner (acting on. the cell that secreted the factor), a paracrine manner (acting on cells in close proximity to the cell that secreted the factor) or an endocrine manner (acting on cells at a distance). Thus secreted molecules find use in modulating ox altering numerous aspects of physiology. Metastatic colorectal cancer proteins that are secreted proteins are particularly preferred in the present invention as they serve as good targets for diagnostic markers, e.g., for blood, plasma, serum, or stool tests.
Use of metastatic colorectal cancer nucleic acids As described above, metastatic colorectal cancer sequence is initially identified by substantial nucleic acid and/or amino acid sequence homology or linkage to the metastatic colorectal cancer sequences outlined herein. Such homology can be based upon the overall nucleic acid or amino acid sequence, and is generally determined as outlined below, using either homology programs or hybridization conditions. Typically, linked sequences on a mRNA are found on the same molecule.
The metastatic colorectal cancer nucleic acid sequences of the invention, e.g., the sequences in Tables 1-26, can be fragments of larger genes, i.e., they are nucleic acid segments. "Genes" in this context includes coding regions, non-coding regions, and mixtures of coding and non-coding regions. Accordingly, as will be appreciated by those in the art, using the sequences provided herein, extended sequences, in either direction, of the metastatic colorectal cancer genes can be obtained, using techniques well known in the art for cloning either longer sequences or the full length sequences; see Ausubel, et al., supra.
Much can be done by informatics and many sequences can be clustered to include multiple sequences corresponding to a single gene, e.g., systems such as UniGene (see, http://www.ncbi.nhn.nih.gov/unigene~.
Once the metastatic colorectal cancer nucleic acid is identified, it can be cloned and, if necessary, its constituent parts recombined to form the entire metastatic colorectal cancer nucleic acid coding regions or the entire mRNA sequence.
Once isolated from its natural source, e.g., contained within a plasmid or other vector or excised therefrom as a linear nucleic acid segment, the recombinant metastatic colorectal cancer nucleic acid can be further-used as a probe to identify and isolate other metastatic colorectal cancer nucleic acids, e.g., extended coding regions. It can also be used as a "precursor" nucleic acid to make modified or variant metastatic colorectal cancer nucleic acids and proteins.
The metastatic colorectal cancer nucleic acids of the present invention are used in several ways. In a first embodiment, nucleic acid probes to the metastatic colorectal cancer nucleic acids are made and attached to biochips to be used in screening and diagnostic methods, as outlined below, or for administration, e.g., for gene therapy, vaccine, and/or antisense applications. Alternatively, the metastatic colorectal cancer nucleic acids that include coding regions of metastatic colorectal cancer proteins can be put into expression vectors for the expression of metastatic colorectal cancer proteins, again for screening purposes or for administration to a patient.
In a preferred embodiment, nucleic acid probes to metastatic colorectal cancer nucleic acids (both the nucleic acid sequences outlined in the figures and/or the complements thereof) are made. The nucleic acid probes attached to the biochip are designed to be substantially complementary to the metastatic colorectal cancer nucleic acids, i.e. the target sequence (either the target sequence of the sample or to other probe sequences, e.g., in sandwich assays), such that hybridization of the target sequence and the probes of the present invention occurs. As outlined below, this complementarity need not be perfect;
there may be any number of base pair mismatches which will interfere with hybridization between the target sequence and the single stranded nucleic acids of the present invention. However, if the number of mutations is so great that no hybridization can occur under even the least stringent of hybridization conditions, the sequence is not a complementary target sequence.
Thus, by "substantially complementary" herein is meant that the probes are sufficiently complementary to the target sequences to hybridize under appropriate reaction conditions, particularly high stringency conditions, as outlined herein.
A nucleic acid probe is generally single stranded but can be partially single and partially double stranded. The strandedness of the probe is dictated by the structure, composition, and properties of the target sequence. In general, the nucleic acid probes range from about 8 to about 100 bases long, with from about 10 to about 80 bases being preferred, and from about 30 to about 50 bases being particularly preferred. That is, generally complements of ORFs or whole genes are not used. In some embodiments, nucleic acids of lengths up to hundreds of bases can be used.
In a preferred embodiment, more than one probe per sequence is used, with either overlapping probes or probes to different sections of the target being used. That is, two, three, four or more probes, with three being preferred, are used to build in a redundancy for a particular target. The probes can be overlapping (i.e., have some sequence in common), or separate. In some cases, PCR primers may be used to amplify signal for higher sensitivity.
As will be appreciated by those in the art, nucleic acids can be attached or immobilized to a solid support in a wide variety of ways. By "immobilized" and grammatical equivalents herein is meant the association or binding between the nucleic acid probe and the solid support is sufficient to be stable under the conditions of binding, washing, analysis, and removal as outlined below. The binding can typically be covalent or non-covalent. By "non-covalent binding" and grammatical equivalents herein is typically meant one or more of electrostatic, hydrophilic, and hydrophobic interactions. Included in non-covalent binding is the covalent attachment of a molecule, such as, streptavidin to the support and the non-covalent binding of the biotinylated probe to the streptavidin. By "covalent binding" and grammatical equivalents herein is meant that the two moieties, the solid support and the probe, are attached by at least one bond, including sigma bonds, pi bonds and coordination bonds. Covalent bonds can be formed directly between the probe and the solid support or can be formed by a cross linker or by inclusion of a specific reactive group on either the solid support or the probe or both molecules. Immobilization may also involve a combination of covalent and non-covalent interactions. .
In general, the probes are attached to a biochip in a wide variety of ways, as will be appreciated by those in the art. As described herein, the nucleic acids can either be synthesized first, with subsequent attachment to the biochip, or can be directly synthesized on the biochip.
The biochip comprises a suitable solid substrate. By "substrate" or "solid support" or other grammatical equivalents herein is meant a material that can be modified to contain discrete individual sites appropriate for the attachment or association of the nucleic acid probes and is amenable to at least one detection method. As will be appreciated by those in the art, the number of possible substrates are very large, and include, but axe not limited to, glass and modified or functionalized glass, plastics (including acrylics, polystyrene and copolymers of styrene and other materials, polypropylene, polyethylene, polybutylene, polyurethanes, Teflon, etc.), polysaccharides, nylon or nitrocellulose, resins, silica or silica-based materials including silicon and modified silicon, carbon, metals, inorganic glasses, plastics, etc. In general, the substrates allow optical detection and do not appreciably fluoresce. A preferred substrate is described in copending application entitled Reusable Low Fluorescent Plastic Biochip, U.S. Application Serial No. 09/270,214, filed March 15, 1999, herein incorporated by reference in its entirety.
Generally the substrate is planar, although as will be appreciated by those in the art, other configurations of substrates may be used as well. For example, the probes may be placed on the inside surface of a tube, for flow-through sample analysis to minimize sample volume. Similarly, the substrate may be flexible, such as a flexible foam, including closed cell foams made of particular plastics.
In a preferred embodiment, the surface of the biochip and the probe may be derivatized with chemical fiuictional groups for subsequent attachment of the two. Thus, e.g., the biochip is derivatized with a chemical functional group including, but not limited to, amino groups, carboxy groups, oxo groups and thiol groups, with amino groups being particularly preferred. Using these functional groups, the probes can be attached using functional groups on the probes. For example, nucleic acids containing amino groups can be attached to surfaces comprising amino groups, e.g., using linkers as are known in the art; e.g., homo-or hetero-bifunctional linkers as are well known (see 1994 Pierce Chemical Company catalog, technical section on cross-linkers, pages 155-200). In addition, in some cases, additional linkers, such as alkyl groups (including substituted and heteroalkyl groups) may be used.
In this embodiment, oligonucleotides are synthesized as is known in the art, and then attached to the surface of the solid support. As will be appreciated by those skilled in the art, either the 5' or 3' terminus may be attached to the solid support, or attachment may be via an internal nucleoside.
In another embodiment, the immobilization to the solid support may be very strong, yet non-covalent. For example, biotinylated oligonucleotides can be made, which bind to surfaces covalently coated with streptavidin, resulting in attachment.
Alternatively, the oligonucleotides may be synthesized on the surface, as is known in the art. For example, photoactivation techniques utilizing photopolymerization compounds and techniques are used. In a preferred embodiment, the nucleic acids can be synthesized in situ, using well known photolithographic techniques, such as those described in WO 95125116; WO 95135505; U.S. Patent Nos. 5,700,637 and 5,445,934; and references cited within, all of which are expressly incorporated by reference; these methods of attachment form the basis of the Affimetrix GeneChipTM technology.
Often, amplification-based assays are performed to measure the expression level of metastatic colorectal cancer-associated sequences. These assays are typically performed in conjunction with reverse transcription. In such assays, a metastatic colorectal cancer-associated nucleic acid sequence acts as a template in an amplification reaction (e.g., Polymerase Chain Reaction, or PCR). In a quantitative amplification, the amount of amplification product will be proportional to the amount of template in the original sample.
Comparison to appropriate controls provides a measure of the amount of metastatic colorectal cancer-associated RNA. Methods of quantitative amplification are well known to those of skill in the art. Detailed protocols for quantitative PCR are provided, e.g., in Innis et al., PCR
Protocols, A Guide to Methods and Applications (1990).
In some embodiments, a TaqMan based assay is used to measure expression.
TaqMan based assays use a fluorogenic oligonucleotide probe that contains a 5' fluorescent dye and a 3' quenching agent. The probe hybridizes to a PCR product, but cannot itself be extended due to a blocking agent at the 3' end. When the PCR product is amplified in subsequent cycles, the 5' nuclease activity of the polymerase, e.g., AmpliTaq, results in the cleavage of the TaqMan probe. This cleavage separates the 5' fluorescent dye and the 3' quenching agent, thereby resulting in an increase in fluorescence as a function of amplification (see, e.g., literature provided by Perkin-Eliner, e.g., www2.perkin-eliner.com).
Other suitable amplification methods include, but are not limited to, ligase chain reaction (LCR) (see Wu & Wallace, Genomics 4:560 (1989), Landegren et al., Science 241:1077 (1988), and Barringer et al., Gene 89:117 (1990)), transcription amplification (Kwoh et al., Proc. Natl. Acad. Sci. USA 86:1173 (1989)), self sustained sequence replication (Guatelli et al., Proc. Nat. Acad. Sci. USA 87:1874 (1990)), dot PCR, and linker adapter PCR, etc.
Expression of metastatic colorectal cancer proteins from nucleic acids In a preferred embodiment, metastatic colorectal cancer nucleic acids, e.g., encoding metastatic colorectal cancer proteins, are used to make a variety of expression vectors to express metastatic colorectal cancer proteins which can then be used in screening assays, as described below. Expression vectors and recombinant DNA technology are well known to those of skill in the art (see, e.g., Ausubel, supra, and Gene Expression Systems (Fernandez & Hoeffler, eds, 1999)) and are used to express proteins. The expression vectors may be either self replicating extrachromosomal vectors or vectors which integrate into a host genome. Generally, these expression vectors include transcriptional and translational regulatory nucleic acid operably linked to the nucleic acid encoding the metastatic colorectal cancer protein. The term "control sequences" refers to DNA sequences used for the expression of an operably linked coding sequence in a particular host organism. Control sequences that are suitable for prokaryotes, e.g., include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.

Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
Generally, "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase.
However, enhancers do not have to be contiguous. Linking is typically accomplished by ligation at convenient restriction sites. If such sites do not exist, synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice. Transcriptional and translational regulatory nucleic acid will generally be appropriate to the host cell used to express the metastatic colorectal cancer protein. Numerous types of appropriate expression vectors, and suitable regulatory sequences are known in the art for a variety of host cells.
In general, transcriptional and translational regulatory sequences may include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.
In a preferred embodiment, the regulatory sequences include a promoter and transcriptional start and stop sequences.
Promoter sequences encode either constitutive or inducible promoters. The promoters may be either naturally occurring promoters or hybrid promoters.
Hybrid promoters, which combine elements of more than one promoter, are also known in the art, and are useful in the present invention.
In addition, an expression vector may comprise additional elements. For example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, e.g., in mammalian or insect cells for expression and in a procaryotic host for cloning and amplification. Furthermore, for integrating expression vectors, the expression vector contains at least one sequence homologous to the host cell genome, and preferably two homologous sequences which flank the expression construct.
The integrating vector may be directed to a specific locus in the host cell by selecting the appropriate homologous sequence for inclusion in the vector. Constructs for integrating vectors are well known in the art (e.g., Fernandez & Hoeffler, supra).

In addition, in a preferred embodiment, the expression vector contains a selectable marker gene to allow the selection of transformed host cells.
Selection genes are well known in the art and will vary with the host cell used.
The metastatic colorectal cancer proteins of the present invention are produced by culturing a host cell transformed with an expression vector containing nucleic acid encoding a metastatic colorectal cancer protein, under the appropriate conditions to induce or cause expression of the metastatic colorectal cancer protein. Conditions appropriate for metastatic colorectal cancer protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation or optimization. For example, the use of constitutive promoters in the expression vector will require optimizing the growth and proliferation of the host cell, while the use of an inducible promoter requires the appropriate growth conditions for induction. In addition, in some embodiments, the timing of the harvest is important. For example, the baculoviral systems used in insect cell expression are lytic viruses, and thus harvest time selection can be crucial for product yield.
Appropriate host cells include yeast, bacteria, archaebacteria, fungi, and insect and animal cells, including mammalian cells. Of particular interest are Saccharom~ces cerevisiae and other yeasts, E. coli, Bacillus subtilis, Sf9 cells, C 129 cells, 293 cells, Neurospora, BHK, CHO, COS, HeLa cells, HIJVEC (human umbilical vein endothelial cells), THP1 cells (a macrophage cell line) and various other human cells and cell lines.
In a preferred embodiment, the metastatic colorectal cancer proteins are expressed in mammalian cells. Mammalian expression systems are also known in the art, and include retroviral and adenoviral systems. Of particular use as mammalian promoters are the promoters from mammalian viral genes, since the viral genes are often highly expressed and have a broad host range. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter, herpes simplex virus promoter, and the CMV promoter (see, e.g., Fernandez & Hoeffler, supra). Typically, transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence. Examples of transcription terminator and polyadenylation signals include those derived form SV40.
The methods of introducing exogenous nucleic acid into mammalian hosts, as well as other hosts, is well known in the art, and will vary with the host cell used.
Techniques include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, viral infection, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA
into nuclei.
In a preferred embodiment, metastatic colorectal cancer proteins are expressed in bacterial systems. Promoters from bacteriophage may also be used and are known in the art. In addition, synthetic promoters and hybrid promoters are also useful;
e.g., the tac promoter is a hybrid of the trp and lac promoter sequences. Furthermore, a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription. In addition to a functioning promoter sequence, an efficient ribosome binding site is desirable. The expression vector may also include a signal peptide sequence that provides for secretion of the metastatic colorectal cancer protein in bacteria. The protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria). The bacterial expression vector may also include a selectable marker gene to allow for the selection of bacterial strains that have been transformed. Suitable selection genes include genes which render the bacteria resistant to drugs such as ampicillin, chloramphenicol, erythromycin, kanamycin, neomycin and tetracycline. Selectable markers also include biosynthetic genes, such as those in the histidine, tryptophan and leucine biosynthetic pathways. These components are assembled into expression vectors. Expression vectors for bacteria are well known in the art, and include vectors for Bacillus subtilis, E. coli, Streptococcus cremoris, and Streptococcus lividans, among others (e.g., Fernandez & Hoeffler, supra). The bacterial expression vectors are transformed into bacterial host cells using techniques well known in the art, such as calcium chloride treatment, electroporation, and others.
In one embodiment, metastatic colorectal cancer proteins are produced in insect cells. Expression vectors for the transformation of insect cells, and in particular, baculovirus-based expression vectors, are well known in the art.
In a preferred embodiment, metastatic colorectal cancer protein is produced in yeast cells. Yeast expression systems are well known in the art, and include expression vectors for Saccharomyces cerevisiae, Candida albicans and C. maltosa, Hansenula polymorpha, Kluyveromyces fragilis and K. lactis, Pichia guillerimondii and P.
pastoris, Schizosaccharomyces pombe, and Yarrowia lipolytica.
The metastatic colorectal cancer protein may also be made as a fusion protein, using techniques well known in the art. Thus, e.g., for the creation of monoclonal antibodies, if the desired epitope is small, the metastatic colorectal cancer protein may be fused to a carrier protein to form an immunogen. Alternatively, the metastatic colorectal cancer protein may be made as a fusion protein to increase expression for affinity purification purposes, or for other reasons. For example, when the metastatic colorectal cancer protein is a metastatic colorectal cancer peptide, the nucleic acid encoding the peptide may be linked to other nucleic acid for expression purposes.
In a preferred embodiment, the metastatic colorectal cancer protein is purified or isolated after expression. Metastatic colorectal cancer proteins may be isolated or purified in a variety of appropriate ways. Standard purification methods include electrophoretic, molecular, immunological and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HI'LC chromatography, and chromatofocusing. For example, the metastatic colorectal cancer protein may be purified using a standard anti-metastatic colorectal cancer protein antibody column. Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. For general guidance in suitable purification techniques, see Scopes, Protein Purification (1982).
The degree of purification necessary will vary depending on the use of the metastatic colorectal cancer protein. In some instances no purification will be necessary.
Once expressed and purified if necessary, the metastatic colorectal cancer proteins and nucleic acids are useful in a number of applications. They may be used as immunoselection reagents, as vaccine reagents, as screening agents, etc.
Variants of metastatic colorectal cancer proteins In one embodiment, the metastatic colorectal cancer proteins are derivative or variant metastatic colorectal cancer proteins as compared to the wild-type sequence. That is, as outlined more fully below, the derivative metastatic colorectal cancer peptide will often contain at least one amino acid substitution, deletion or insertion, with amino acid substitutions being particularly preferred. The amino acid substitution, insertion or deletion may occur at a particular residue within the metastatic colorectal cancer peptide.
Also included within one embodiment of metastatic colorectal cancer proteins of the present invention are amino acid sequence variants. These variants typically fall into one or more of three classes: substitutional, insertional or deletional variants. These variants ordinarily are prepared by site specific mutagenesis of nucleotides in the DNA
encoding the metastatic colorectal cancer protein, using cassette or PCR mutagenesis or other techniques, to produce DNA encoding the variant, and thereafter expressing the DNA in recombinant cell culture as outlined above. However, variant metastatic colorectal cancer protein fragments having up to about 100-150 residues may be prepared by in vitro synthesis.
Amino acid sequence variants are characterized by the predetermined nature of the variation, a feature that sets them apart from naturally occurring allelic or interspecies variation of the metastatic colorectal cancer protein amino acid sequence. The variants typically exhibit the same qualitative biological activity as the naturally occurring analogue, although variants can also be selected which have modified characteristics as will be more fully outlined below.
While the site or region for introducing an amino acid sequence variation is often predetermined, the mutation per se need not be predetermined. For example, in order to optimize the performance of a mutation at a given site, random mutagenesis may be conducted at the target codon or region and the expressed metastatic colorectal cancer variants screened for the optimal combination of desired activity. Techniques exist for making substitution mutations at predetermined sites in DNA having a known sequence, e.g., M13 primer mutagenesis and PCR mutagenesis. Screening of the mutants is done using assays of metastatic colorectal cancer protein activities.
Amino acid substitutions are typically of single residues; insertions usually will be on the order of from about 1 to 20 amino acids, although considerably larger insertions may be occasionally tolerated. Deletions range from about 1 to about 20 residues, although in some cases deletions may be much larger.
Substitutions, deletions, insertions or any combination thereof may be used to arrive at a final derivative. Generally these changes are done on a few amino acids to minimize the alteration of the molecule. Larger changes may be tolerated in certain circumstances. When small alterations in the characteristics of a metastatic colorectal cancer protein are desired, substitutions are generally made in accordance with the amino acid substitution chart provided in the definition section.
Variants typically exhibit the same qualitative biological activity and will elicit the same immune response as the naturally-occurring analog, although variants also are selected to modify the characteristics of the metastatic colorectal cancer proteins as needed.
Alternatively, the variant may be designed or reorganized such that the biological activity of the metastatic colorectal cancer protein is altered. For example, glycosylation sites may be altered or removed.
Covalent modifications of metastatic colorectal cancer polypeptides are included within the scope of this invention. One type of covalent modification includes reacting targeted amino acid residues of a metastatic colorectal cancer polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or the N-or C-terminal residues of a metastatic colorectal cancer polypeptide.
Derivatization with bifunctional agents is useful, for instance, for crosslinking metastatic colorectal cancer polypeptides to a water-insoluble support matrix or surface for use in the method for purifying anti-metastatic colorectal cancer polypeptide antibodies or screening assays, as is more fully described below. Commonly used crosslinking agents include, e.g., 1,1-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, e.g., esters with 4-azidosalicylic acid, homobifimctional imidoesters, including disuccinimidyl esters such as 3,3'-dithiobis(succinimidylpropionate), bifunctional maleimides such as bis-N-maleimido-1,8-octane and agents such as methyl-3-((p-azidophenyl)dithio)propioimidate.
Other modifications include deamidation of glutaminyl and asparaginyl residues to the corresponding glutamyl and aspartyl residues, respectively, hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl, threonyl or tyrosyl residues, methylation of the y-amino groups of lysine, arginine, and histidine side chains (Creighton, Proteins: Structure and Molecular Properties, pp. 79-86 (1983)), acetylation of the N-terminal amine, and amidation of any C-terminal carboxyl group.
Another type of covalent modification of the metastatic colorectal cancer polypeptide encompassed by this invention is an altered native glycosylation pattern of the polypeptide. "Altering the native glycosylation pattern" is intended herein to mean adding to or deleting one or more carbohydrate moieties of a native sequence metastatic colorectal cancer polypeptide. Glycosylation patterns can be altered in many ways. For example the use of different cell types to express metastatic colorectal cancer-associated sequences can result in different glycosylation patterns.
Addition of glycosylation sites to metastatic colorectal cancer polypeptides may also be accomplished by altering the amino acid sequence thereof. The alteration may be made, e.g., by the addition of, or substitution by, one or more serine or threonine residues to the native sequence metastatic colorectal cancer polypeptide (for O-linked glycosylation sites). The metastatic colorectal cancer amino acid sequence may optionally be altered through changes at the DNA level, particularly by mutating the DNA encoding the metastatic colorectal cancer polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.
Another means of increasing the number of carbohydrate moieties on the metastatic colorectal cancer polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide. Such methods are described in the art, e.g., in WO
87105330, and in Aplin & Wriston, CRC Crit. Rev. Biochem., pp. 259-306 (1981).
Removal of carbohydrate moieties present on the metastatic colorectal cancer polypeptide may be accomplished chemically or enzymatically or by mutational substitution of codons encoding for amino acid residues that serve as targets for glycosylation. Chemical deglycosylation techniques are known in the art and described, for instance, by Hakimuddin, et al., Arch. Bioclaem. Biophys., 259:52 (1987) and by Edge et al., Anal.
Biochem., 118:131 (1981). Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo-and exo-glycosidases as described by Thotakura et al., Meth.
Enzymol., 138:350 (1987).
Another type of covalent modification of metastatic colorectal cancer comprises linking the metastatic colorectal cancer polypeptide to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Patent Nos. 4,640,835;

4,496,689;
4,301,144; 4,670,417; 4,791,192 or 4,179,337.
Metastatic colorectal cancer polypeptides of the present invention may also be modified in a way to form chimeric molecules comprising a metastatic colorectal cancer polypeptide fused to another, heterologous polypeptide or amino acid sequence.
In one embodiment, such a chimeric molecule comprises a fusion of a metastatic colorectal cancer polypeptide with a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind. The epitope tag is generally placed at the amino-or carboxyl-terminus of the metastatic colorectal cancer polypeptide. The presence of such epitope-tagged forms of a metastatic colorectal cancer polypeptide can be detected using an antibody against the tag polypeptide. Also, provision of the epitope tag enables the metastatic colorectal cancer polypeptide to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag. In an alternative embodiment, the chimeric molecule may comprise a fusion of a metastatic colorectal cancer polypeptide with an immunoglobulin or a particular region of an immunoglobulin. For a bivalent form of the chimeric molecule, such a fusion could be to the Fc region of an IgG
molecule.
Various tag polypeptides and their respective antibodies are well known and examples include poly-histidine (poly-his) or poly-histidine-glycine (poly-his-gly) tags; HIS6 and metal chelation tags, the flu HA tag polypeptide and its antibody 12CA5 (Field et al., Mol. Cell. Biol. 8:2159-2165 (1988)); the c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto (Evan et al., Molecular and Cellular Biology 5:3610-3616 (1985));

and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody (Paborsky et al., Protein Engineering 3(6):547-553 (1990)). Other tag polypeptides include the Flag-peptide (Hopp et al., BioTechraology 6:1204-1210 (1988)); the KT3 epitope peptide (Martin et al., Science 255:192-194 (1992)); tubulin epitope peptide (Skinner et al., J. Biol.
Chem.
266:15163-15166 (1991)); and the T7 gene 10 protein peptide tag (Lutz-Freyermuth et al., Proc. Natl. Acad. Sci. USA 87:6393-6397 (1990)).
Also included are other metastatic colorectal cancer proteins of the metastatic colorectal cancer family, and metastatic colorectal cancer proteins from other organisms, which are cloned and expressed as outlined below. Thus, probe or degenerate polymerase chain reaction (PCR) primer sequences may be used to find other related metastatic colorectal cancer proteins from primates or other organisms. As will be appreciated by those in the art, particularly useful probe and/or PCR primer sequences include unique areas of the metastatic colorectal cancer nucleic acid sequence. As is generally known in the art, preferred PCR
primers are from about 15 to about 35 nucleotides in length, with from about 20 to about 30 being preferred, and may contain inosine as needed. PCR reaction conditions are well known in the art (e.g., Innis, PCR Protocols, supra).
Antibodies to metastatic colorectal cancer proteins In a preferred embodiment, when a metastatic colorectal cancer protein is to be used to generate antibodies, e.g., for immunotherapy or immunodiagnosis, the metastatic colorectal cancer protein should share at least one epitope or determinant with the full length protein. By "epitope" or "determinant" herein is typically meant a portion of a protein which will generate and/or bind an antibody or T-cell receptor in the context of MHC. Thus, in most instances, antibodies made to a smaller metastatic colorectal cancer protein will be able to bind to the full-length protein, particularly linear epitopes. In a preferred embodiment, the epitope is unique; that is, antibodies generated to a unique epitope show little or no cross-reactivity.
Methods of preparing polyclonal antibodies are well known (e.g., Coligan, supra; and Harlow & Lane, supra). Polyclonal antibodies can be raised in a mammal, e.g., by one or more injections of an immunizing agent and, if desired, an adjuvant.
Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal inj ections. The immunizing agent may include a protein encoded by a nucleic acid of Tables 1-26 or fragment thereof or a fusion protein thereof.
It may be useful to conjugate the immunizing agent to a protein known to be immunogenic in the mammal being immunized. Immunogenic proteins include, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. Adjuvants include, e.g., Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate). The immunization protocol may be selected by one skilled in the art.
The antibodies may, alternatively, be monoclonal antibodies. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler &
Milstein, Nature 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro. The immunizing agent will typically include a polypeptide encoded by a nucleic acid of Tables 1-26, or fragment thereof, or a fusion protein thereof. Generally, either peripheral blood lymphocytes ("PBLs") are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (1986)). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and primate origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT
medium"), which substances prevent the growth of HGPRT-deficient cells.
In one embodiment, the antibodies are bispecific antibodies. Bispecific antibodies are typically monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens or that have binding specificities for two epitopes on the same antigen. In one embodiment, one of the binding specificities is for a protein encoded by a nucleic acid of Tables 1-26 or a fragment thereof, the other one is for any other antigen, and preferably for a cell-surface protein or receptor or receptor subunit, preferably one that is tumor specific. Alternatively, tetramer-type technology may create multivalent reagents.

In a preferred embodiment, the antibodies to metastatic colorectal cancer protein are capable of reducing or eliminating a biological function of a metastatic colorectal cancer protein, as is described below. That is, the addition of anti-metastatic colorectal cancer protein antibodies (either polyclonal or preferably monoclonal) to metastatic colorectal cancer tissue (or cells containing metastatic colorectal cancer) may reduce or eliminate the metastatic colorectal cancer. Generally, at least a 25% decrease in activity, growth, size or the like is preferred, with at least about 50% being particularly preferred and about a 95-100% decrease being especially preferred.
In a preferred embodiment the antibodies to the metastatic colorectal cancer proteins axe humanized antibodies (e.g., Xenerex Biosciences, Mederex, Inc., Abgenix, Inc., Protein Design Labs, Inc.) Humanized forms of non-human (e.g., marine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR
of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. St~~uct. Biol. 2:593-596 (1992)).
Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988);
Verhoeyen et al., Science 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
Human-like antibodies can also be produced using various techniques known in the art, including phage display libraries (Hoogenboom & Winter, J. Mol.
Biol. 227:381 (1991); Marks et al., J. Mol. Biol. 222:581 (1991)). The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and cancer Therapy, p. 77 (1985) and Boerner et al., J. Immunol.
147(1):86-95 (1991)). Similarly, human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in virtually all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, e.g., in U.S. Patent Nos. 5,545,807; 5,545,806;

5,569,825; 5,625,126;
5,633,425; 5,661,016, and in the following scientific publications: Marks et al., BiolTechnology 10:779-783 (1992); Lonberg et al., Nature 368:856-859 (1994);
Morrison, Nature 368:812-13 (1994); Fishwild et al., Nature Biotechnology 14:845-51 (1996);
Neuberger, Nature Biotechnology 14:826 (1996); Lonberg & Huszar, Intern. Rev.
Immunol.
13:65-93 (1995).
By immunotherapy is meant treatment of metastatic colorectal cancer with an antibody raised against a metastatic colorectal cancer proteins. As used herein, immunotherapy can be passive or active. Passive immunotherapy as defined herein is the passive transfer of antibody to a recipient (patient). Active immunization is the induction of antibody and/or T-cell responses in a recipient (patient). Induction of an immune response is the result of providing the recipient with an antigen to which antibodies are raised. The antigen may be provided by injecting a polypeptide against which antibodies are desired to be raised into a recipient, or contacting the recipient with a nucleic acid capable of expressing the antigen and under conditions for expression of the antigen, leading to an immune response.
In a preferred embodiment the metastatic colorectal cancer proteins against which antibodies are raised are secreted proteins as described above. Without being bound by theory, antibodies used for treatment, bind and prevent the secreted protein from binding to its receptor, thereby inactivating the secreted metastatic colorectal cancer protein.
In another preferred embodiment, the metastatic colorectal cancer protein to which antibodies are raised is a transmembrane protein. Without being bound by theory, antibodies used for this treatment typically bind the extracellular domain of the metastatic colorectal cancer protein and prevent it from binding to other proteins, such as circulating ligands or cell-associated molecules. The antibody may cause down-regulation of the transmembrane metastatic colorectal cancer protein. The antibody may be a competitive, non-competitive or uncompetitive inhibitor of protein binding to the extracellular domain of the metastatic colorectal cancer protein. The antibody may be an antagonist of the metastatic colorectal cancer protein or may prevent activation of the transmembrane metastatic colorectal cancer protein. In some embodiments, when the antibody prevents the binding of other molecules to the metastatic colorectal cancer protein, the antibody prevents growth of the cell. The antibody may also be used to target or sensitize the cell to cytotoxic agents, including, but not limited to TNF-a, TNF-(3, IL-l, INF-y and IL-2, or chemotherapeutic agents including SFU, vinblastine, actinomycin D, cisplatin, methotrexate, and the like. In some instances the antibody belongs to a sub-type that activates serum complement when complexed with the transmembrane protein thereby mediating cytotoxicity or antigen-dependent cytotoxicity (ADCC). Thus, metastatic colorectal cancer is treated by administering to a patient antibodies directed against the transmembrane metastatic colorectal cancer protein. Antibody-labeling may activate a co-toxin, localize a toxin payload, or otherwise provide means to locally ablate cells.
In another preferred embodiment, the antibody is conjugated to an effector moiety. The effector moiety can be any number of molecules, including labeling moieties such as radioactive labels or fluorescent labels, or can be a therapeutic moiety. In one aspect the therapeutic moiety is a small molecule that modulates the activity of the metastatic colorectal cancer protein. In another aspect the therapeutic moiety modulates the activity of molecules associated with or in close proximity to the metastatic colorectal cancer protein.
The therapeutic moiety may inhibit enzymatic activity such as protease or collagenase activity associated with metastatic colorectal cancer.
In a preferred embodiment, the therapeutic moiety can also be a cytotoxic agent. In this method, targeting the cytotoxic agent to metastatic colorectal cancer tissue or cells results in a reduction in the number of afflicted cells, thereby reducing symptoms associated with metastatic colorectal cancer. Cytotoxic agents are numerous and varied and include, but are not limited to, cytotoxic drugs or toxins or active fragments of such toxins.
Suitable toxins and their corresponding fragments include diphtheria A chain, exotoxin A
chain, ricin A chain, abrin A chain, curcin, crotin, phenomycin, enomycin and the like.

Cytotoxic agents also include radiochemicals made by conjugating radioisotopes to antibodies raised against metastatic colorectal cancer proteins, or binding of a radionuclide to a chelating agent that has been covalently attached to the antibody. Targeting the therapeutic moiety to transmembrane metastatic colorectal cancer proteins not only serves to increase the local concentration of therapeutic moiety in the metastatic colorectal cancer afflicted area, but also serves to reduce deleterious side effects that may be associated with the therapeutic moiety.
In another preferred embodiment, the metastatic colorectal cancer protein against which the antibodies are raised is an intracellular protein. In this case, the antibody may be conjugated to a protein or other entity which facilitates entry into the cell. In one case, the antibody enters the cell by endocytosis. In another embodiment, a nucleic acid encoding the antibody is administered to the individual or cell. Moreover, wherein the metastatic colorectal cancer protein can be targeted within a cell, i.e., the nucleus, an antibody thereto contains a signal for that target localization, i.e., a nuclear localization signal.
The metastatic colorectal cancer antibodies of the invention specifically bind to metastatic colorectal cancer proteins. By "specifically bind" herein is meant that the antibodies bind to the protein with a Ka of at least about 0.1 mM, more usually at least about 1 ~.M, preferably at least about 0.1 ~,M or better, and most preferably, 0.01 ~,M or better.
Selectivity of binding is also important.
Detection of metastatic colorectal cancer sequence for diagnostic and therapeutic applications In one aspect, the RNA expression levels of genes are determined for different cellular states in the metastatic colorectal cancer phenotype. Expression levels of genes in normal tissue (i.e., not undergoing metastatic colorectal cancer) and in metastatic colorectal cancer tissue (and in some cases, for varying severities of metastatic colorectal cancer that relate to prognosis, as outlined below) are evaluated to provide expression profiles. An expression profile of a particular cell state or point of development is essentially a "fingerprint" of the state. While two states may have any particular gene similarly expressed, the evaluation of a number of genes simultaneously allows the generation of a gene expression profile that is reflective of the state of the cell. By comparing expression profiles of cells in different states, information regarding which genes are important (including both up- and down-regulation of genes) in each of these states is obtained. Then, diagnosis may so be performed or confirmed to determine whether a tissue sample has the gene expression profile of normal or cancerous tissue. This will provide for molecular diagnosis of related conditions.
"Differential expression," or grammatical equivalents as used herein, refers to qualitative or quantitative differences in the temporal and/or cellular gene expression patterns within and among cells and tissue. Thus, a differentially expressed gene can qualitatively have its expression altered, including an activation or inactivation, in, e.g., normal versus metastatic colorectal cancer tissue. Genes may be turned on or turned off in a particular state, relative to another state thus permitting comparison of two or more states. A
qualitatively regulated gene will exhibit an expression pattern within a state or cell type which is detectable by standard techniques. Some genes will be expressed in one state or cell type, but not in both. Alternatively, the difference in expression may be quantitative, e.g., in that expression is increased or decreased; i.e., gene expression is either upregulated, resulting in an increased amount of transcript, or downregulated, resulting in a decreased amount of transcript. The degree to which expression differs need only be large enough to quantify via standard characterization techniques as outlined below, such as by use of Affymetrix GeneChipTM expression arrays, Lockhart, Nature Biotechnology 14:1675-160 (1996), hereby expressly incorporated by reference. Other techniques include, but are not limited to, quantitative reverse transcriptase PCR, northern analysis and RNase protection. As outlined above, preferably the change in expression (i.e., upregulation or downregulation) is typically at least about SO%, more preferably at least about 100%, more preferably at least about 150%, more preferably at least about 200%, with from 300 to at least 1000%
being especially preferred.
Evaluation may be at the gene transcript, or the protein level. The amount of gene expression may be monitored using nucleic acid probes to the DNA or RNA
equivalent of the gene transcript, and the quantification of gene expression levels, or, alternatively, the final gene product itself (protein) can be monitored, e.g., with antibodies to the metastatic colorectal cancer protein and standard immunoassays (ELISAs, etc.) or other techniques, including mass spectroscopy assays, ZD gel electrophoresis assays, etc.
Proteins corresponding to metastatic colorectal cancer genes, i.e., those identified as being important in a metastatic colorectal cancer phenotype, can be evaluated in a metastatic colorectal cancer diagnostic test.
In a preferred embodiment, gene expression monitoring is performed simultaneously on a number of genes.
sl The metastatic colorectal cancer nucleic acid probes may be attached to biochips as outlined herein for the detection and quantification of metastatic colorectal cancer sequences in a particular cell. The assays are further described below in the example. PCR
techniques can be used to provide greater sensitivity. Multiple protein expression monitoring can be performed as well. Similarly, these assays may be performed on an individual basis as well.
In a preferred embodiment nucleic acids encoding the metastatic colorectal cancer protein are detected. Although DNA or RNA encoding the metastatic colorectal cancer protein may be detected, of particular interest are methods wherein an mRNA
encoding a metastatic colorectal cancer protein is detected. Probes to detect mRNA can be a nucleotide/deoxynucleotide probe that is complementary to and hybridizes with the mRNA
and includes, but is not limited to, oligonucleotides, cDNA or RNA. Probes also should contain a detectable label, as defined herein. In one method the mRNA is detected after immobilizing the nucleic acid to be examined on a solid support such as nylon membranes and hybridizing the probe with the sample. Following washing to remove the non-specifically bound probe, the label is detected. In another method detection of the mRNA is performed in situ. In this method permeabilized cells or tissue samples are contacted with a detectably labeled nucleic acid probe for sufficient time to allow the probe to hybridize with the target mRNA. Following washing to remove the non-specifically bound probe, the label is detected. For example a digoxygenin labeled riboprobe (RNA probe) that is complementary to the mRNA encoding a metastatic colorectal cancer protein is detected by binding the digoxygenin with an anti-digoxygenin secondary antibody and developed with nitro blue tetrazolium and 5-bromo-4-chloro-3-indoyl phosphate.
In a preferred embodiment, various proteins from the three classes of proteins as described herein (secreted, transmembrane or intracellular proteins) are used in diagnostic assays. The metastatic colorectal cancer proteins, antibodies, nucleic acids, modified proteins and cells containing metastatic colorectal cancer sequences are used in diagnostic assays.
This can be performed on an individual gene or corresponding polypeptide level. In a preferred embodiment, the expression profiles are used, preferably in conjunction with high throughput screening techniques to allow monitoring for expression profile genes and/or corresponding polypeptides.
As described and defined herein, metastatic colorectal cancer proteins, including intracellular, transmembrane or secreted proteins, find use as markers of metastatic colorectal cancer. Detection of these proteins in putative metastatic colorectal cancer tissue s2 allows for detection or diagnosis of metastatic colorectal cancer. In one embodiment, antibodies are used to detect metastatic colorectal cancer proteins. A
preferred method separates proteins from a sample by electrophoresis on a gel (typically a denaturing and reducing protein gel, but may be another type of gel, including isoelectric focusing gels and the like). Following separation of proteins, the metastatic colorectal cancer protein is detected, e.g., by immunoblotting with antibodies raised against the metastatic colorectal cancer protein. Methods of immunoblotting are well known to those of ordinary skill in the art.
In another preferred method, antibodies to the metastatic colorectal cancer protein find use in in situ imaging techniques, e.g., in histology (e.g., Methods in Cell Biology: Antibodies in Cell Biology, volume 37 (Asai, ed. 1993)). In this method cells are contacted with from one to many antibodies to the metastatic colorectal cancer protein(s).
Following washing to remove non-specific antibody binding, the presence of the antibody or antibodies is detected. In one embodiment the antibody is detected by incubating with a secondary antibody that contains a detectable label, e.g., multicolor fluorescence or confocal imaging. In another method the primary antibody to the metastatic colorectal cancer proteins) contains a detectable label, e.g., an enzyme marker that can act on a substrate. In another preferred embodiment each one of multiple primary antibodies contains a distinct and detectable label. This method finds particular use in simultaneous screening for a plurality of metastatic colorectal cancer proteins. Many other histological imaging techniques are also provided by the invention.
In a preferred embodiment the label is detected in a fluorometer which has the ability to detect and distinguish emissions of different wavelengths. In addition, a fluorescence activated cell sorter (FAGS) can be used in the method.
In another preferred embodiment, antibodies find use in diagnosing metastatic colorectal cancer from blood, serum, plasma, stool, and other samples. Such samples, therefore, are useful as samples to be probed or tested for the presence of metastatic colorectal cancer proteins. Antibodies can be used to detect a metastatic colorectal cancer protein by previously described immunoassay techniques including ELISA, immunoblotting (western blotting), imrnunoprecipitation, BIACORE technology and the like.
Conversely, the presence of antibodies may indicate an immune response against an endogenous metastatic colorectal cancer protein or vaccine.
In a preferred embodiment, in situ hybridization of labeled metastatic colorectal cancer nucleic acid probes to tissue arrays is done. For example, arrays of tissue samples, including metastatic colorectal cancer tissue and/or normal tissue, are made. In situ hybridization (see, e.g., Ausubel, supra) is then performed. When comparing the fingerprints between an individual and a standard, the skilled artisan can make a diagnosis, a prognosis, or a prediction based on the findings. It is further understood that the genes which indicate the diagnosis may differ from those which indicate the prognosis and molecular profiling of the condition of the cells may lead to distinctions between responsive or refractory conditions or may be predictive of outcomes.
In a preferred embodiment, the metastatic colorectal cancer proteins, antibodies, nucleic acids, modified proteins and cells containing metastatic colorectal cancer sequences are used in prognosis assays. As above, gene expression profiles can be generated that correlate to metastatic colorectal cancer, in terms of long term prognosis. Again, this may be done on either a protein or gene level, with the use of genes being preferred. As above, metastatic colorectal cancer probes may be attached to biochips for the detection and quantification of metastatic colorectal cancer sequences in a tissue or patient. The assays proceed as outlined above for diagnosis. PCR method may provide more sensitive and accurate quantification.
Assays for therapeutic compounds In a preferred embodiment members of the three classes of proteins as described herein are used in drug screening assays. The metastatic colorectal cancer proteins, antibodies, nucleic acids, modified proteins and cells containing metastatic colorectal cancer sequences are used in drug screening assays or by evaluating the effect of drug candidates on a "gene expression profile" or expression profile of polypeptides. In a preferred embodiment, the expression profiles are used, preferably in conjunction with high throughput screening techniques to allow monitoring for expression profile genes after treatment with a candidate agent (e.g., Zlokarnik, et al., Sciehce 279:84-8 (1998); Heid, Genome Res 6:986-94, 1996).
In a preferred embodiment, the metastatic colorectal cancer proteins, antibodies, nucleic acids, modified proteins and cells containing the native or modified metastatic colorectal cancer proteins are used in screening assays. That is, the present invention provides novel methods for screening for compositions which modulate the metastatic colorectal cancer phenotype or an identified physiological function of a metastatic colorectal cancer protein. As above, this can be done on an individual gene level or by evaluating the effect of drug candidates on a "gene expression profile". In a preferred embodiment, the expression profiles are used, preferably in conjunction with high throughput screening techniques to allow monitoring for expression profile genes after treatment with a candidate agent, see Zlokarnik, supra.
Having identified the differentially expressed genes herein, a variety of assays may be applied. In a preferred embodiment, assays may be run on an individual gene or protein level. That is, having identified a particular gene with altered regulation in metastatic colorectal cancer, test compounds can be screened for the ability to modulate gene expression or for binding to the metastatic colorectal cancer protein. "Modulation" thus includes an increase or a decrease in gene expression. The preferred amount of modulation will depend on the original change of the gene expression in normal versus tissue undergoing metastatic colorectal cancer, with changes of at least 10%, preferably 50%, more preferably 100-300%, and in some embodiments 300-1000% or greater. Thus, if a gene exhibits a 4-fold increase in metastatic colorectal cancer tissue compared to normal tissue, a decrease of about four-fold is often desired; similarly, a 10-fold decrease in metastatic colorectal cancer tissue compared to normal tissue often provides a target value of a 10-fold increase in expression to be induced by the test compound.
The amount of gene expression may be monitored using nucleic acid probes and the quantification of gene expression levels, or, alternatively, the gene product itself can be monitored, e.g., through the use of antibodies to the metastatic colorectal cancer protein and standard immunoassays. Proteomics and separation techniques may also allow quantification of expression.
In a preferred embodiment, gene or protein expression monitoring of a number of entities, i.e., an expression profile, is monitored simultaneously. Such profiles will typically involve a plurality of those entities described herein.
In this embodiment, the metastatic colorectal cancer nucleic acid probes are attached to biochips as outlined herein for the detection and quantification of metastatic colorectal cancer sequences in a particular cell. Alternatively, PCR may be used. Thus, a series, e.g., of microtiter plate, may be used with dispensed primers in desired wells. A PCR
reaction can then be performed and analyzed for each well.
Expression monitoring can be performed to identify compounds that modify the expression of one or more metastatic colorectal cancer-associated sequences, e.g., a polynucleotide sequence set out in Tables 1-26. Generally, in a preferred embodiment, a test compound is added to the cells prior to analysis. Moreover, screens axe also provided to identify agents that modulate metastatic colorectal cancer, modulate metastatic colorectal ss cancer proteins, bind to a metastatic colorectal cancer protein, or interfere with the binding of a metastatic colorectal cancer protein and an antibody, substrate, or other binding partner.
The term "test compound" or "drug candidate" or "modulator" or grammatical equivalents as used herein describes any molecule, e.g., protein, oligopeptide, small organic molecule, polysaccharide, polynucleotide, etc., to be tested for the capacity to directly or indirectly alter the metastatic colorectal cancer phenotype or the expression of a rnetastatic colorectal cancer sequence, e.g., a nucleic acid or protein sequence. In preferred embodiments, modulators alter expression profiles of nucleic acids or proteins provided herein. In one embodiment, the modulator suppresses a metastatic colorectal cancer phenotype, e.g., to a normal tissue fingerprint. In another embodiment, a modulator induces a metastatic colorectal cancer phenotype. Generally, a plurality of assay mixtures are run in parallel with different agent concentrations to obtain a differential response to the various concentrations. Typically, one of these concentrations serves as a negative control, i.e., at zero concentration or below the level of detection.
In one aspect, a modulator will neutralize the effect of a metastatic colorectal cancer protein. By "neutralize" is meant that activity of a protein and the consequent effect on the cell is inhibited or blocked.
In certain embodiments, combinatorial libraries of potential modulators will be screened for an ability to bind to a metastatic colorectal cancer polypeptide or to modulate activity. Conventionally, new chemical entities with useful properties are generated by identifying a chemical compound (called a "lead compound") with some desirable property or activity, e.g., inhibiting activity, creating variants of the lead compound, and evaluating the property and activity of those variant compounds. Often, high throughput screening (HTS) methods are employed fox such an analysis.
In one preferred embodiment, high throughput screening methods involve providing a library containing a large number of potential therapeutic compounds (candidate compounds). Such "combinatorial chemical libraries" are then screened in one or more assays to identify those library members (particular chemical species or subclasses) that display a desired characteristic activity. The compounds thus identified can serve as conventional "lead compounds" or can themselves be used as potential or actual therapeutics.
A combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical "building blocks" such as reagents. For example, a linear combinatorial chemical library, such as a polypeptide (e.g., mutein) library, is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks (Gallop et al., J. Med. Chena. 37(9):1233-1251 (1994)).
Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Patent No. 5,010,175, Furka, Pept. Prot.
Res. 37:487-493 (1991), Houghton et al., Nature, 354:84-88 (1991)), peptoids (PCT Publication No WO
91/19735), encoded peptides (PCT Publication WO 93120242), random bio-oligomers (PCT
Publication WO 92100091), benzodiazepines (U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al.; Proc. Nat. Acad.
Sci. USA
90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al., J. Amer. Chem.
Soe.
114:6568 (1992)), nonpeptidal peptidomimetics with a Beta-D-Glucose scaffolding (Hirschmann et al., J. Amer. Chem. Soc. 114:9217-9218 (1992)), analogous organic syntheses of small compound libraries (Chen et al., J. Amer. Chem. Soc. 116:2661 (1994)), oligocarbamates (Cho, et al., Science 261:1303 (1993)), and/or peptidyl phosphonates (Campbell et al., J. Org. Chem. 59:658 (1994)). See, generally, Gordon et al., J. Med. Chem.
37:1385 (1994), nucleic acid libraries (see, e.g., Strategene, Corp.), peptide nucleic acid libraries (see, e.g., U.S. Patent 5,539,083), antibody libraries (see, e.g., Vaughn et al., Nature Biotechnology 14(3):309-314 (1996), and PCT/LTS96/10287), carbohydrate libraries (see, e.g., Liang et al., Science 274:1520-1522 (1996), and U.S. Patent No.
5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum, C&EN, Jan 18, page 33 (1993);
isoprenoids, U.S. Patent No. 5,569,588; thiazolidinones and metathiazanones, U.S. Patent No.
5,549,974; pyrrolidines, U.S. Patent Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Patent No. 5,506,337; benzodiazepines, U.S. Patent No. 5,288,514; and the like).
Devices for the preparation of combinatorial libraries are commercially available (see, e.g., 357 MPS, 390 MPS, Advanced Chem Tech, Louisville KY, Symphony, Rainin, Woburn, MA, 433A Applied Biosystems, Foster City, CA, 9050 Plus, Millipore, Bedford, MA).
A number of well known robotic systems have also been developed for solution phase chemistries. These systems include automated workstations like the automated synthesis apparatus developed by Takeda Chemical Industries, LTD.
(Osaka, Japan) and many robotic systems utilizing robotic arms (Zymate II, Zymark Corporation, Hopkinton, Mass.; Orca, Hewlett-Packard, Palo Alto, Calif.), which mimic the manual s7 synthetic operations performed by a chemist. The above devices, with appropriate modification, are suitable for use with the present invention. In addition, numerous combinatorial libraries are themselves commercially available (see, e.g., ComGenex, Princeton, N.J., Asinex, Moscow, Ru, Tripos, Inc., St. Louis, MO, ChemStar, Ltd, Moscow, RU, 3D Pharmaceuticals, Exton, PA, Martek Biosciences, Columbia, MD, etc.).
The assays to identify modulators are amenable to high throughput screening.
Preferred assays thus detect modulation of metastatic colorectal cancer gene transcription, polypeptide expression, and polypeptide activity.
High throughput assays for evaluating the presence, absence, quantification, or other properties of particular nucleic acids or protein products are well known to those of skill in the art. Similarly, binding assays and reporter gene assays are similarly well known.
Thus, e.g., U.S. Patent No. 5,559,410 discloses high throughput screening methods for proteins, U.S. Patent No. 5,585,639 discloses high throughput screening methods for nucleic acid binding (i.e., in arrays), while U.S. Patent Nos. 5,576,220 and 5,541,061 disclose high throughput methods of screening for ligand/antibody binding.
In addition, high throughput screening systems are commercially available (see, e.g., Zymark Corp., Hopkinton, MA; Air Technical Industries, Mentor, OH;
Beckman Instruments, Inc. Fullerton, CA; Precision Systems, Inc., Natick, MA, etc.).
These systems typically automate procedures, including sample and reagent pipetting, liquid dispensing, timed incubations, and final readings of the microplate in detectors) appropriate for the assay. These configurable systems provide high throughput and rapid start up as well as a high degree of flexibility and customization. The manufacturers of such systems provide detailed protocols for various high throughput systems. Thus, e.g., Zymark Corp. provides technical bulletins describing screening systems for detecting the modulation of gene transcription, ligand binding, and the like.
In one embodiment, modulators are proteins, often naturally occurring proteins or fragments of naturally occurnng proteins. Thus, e.g., cellular extracts containing proteins, or random or directed digests of proteinaceous cellular extracts, may be used. In this way libraries of proteins may be made for screening in the methods of the invention.
Particularly preferred in this embodiment are libraries of bacterial, fungal, viral, and mammalian proteins, with the latter being preferred, and human proteins being especially preferred. Particularly useful test compound will be directed to the class of proteins to which the target belongs, e.g., substrates for enzymes or ligands and receptors.
s8 In a preferred embodiment, modulators are peptides of from about 5 to about 30 amino acids, with from about 5 to about 20 amino acids being preferred, and from about 7 to about 15 being particularly preferred. The peptides may be digests of naturally occurnng proteins as is outlined above, random peptides, or "biased",random peptides.
By "randomized" or grammatical equivalents herein is meant that the nucleic acid or peptide consists of essentially random sequences of nucleotides and amino acids, respectively. Since these random peptides (or nucleic acids, discussed below) are often chemically synthesized, they may incorporate any nucleotide or amino acid at any position. The synthetic process can be designed to generate randomized proteins or nucleic acids, to allow the formation of all or most of the possible combinations over the length of the sequence, thus forming a library of randomized candidate bioactive proteinaceous agents.
In one embodiment, the library is fully randomized, with no sequence preferences or constants at any position. In a preferred embodiment, the library is biased.
That is, some positions within the sequence are either held constant, or are selected from a limited number of possibilities. J.n a preferred embodiment, the nucleotides or amino acid residues are randomized within a defined class, e.g., of hydrophobic amino acids, hydrophilic residues, sterically biased (either small or large) residues, towards the creation of nucleic acid binding domains, the creation of cysteines, for cross-linking, prolines for SH-3 domains, serines, threonines, tyrosines or histidines for phosphorylation sites, etc.
Modulators of metastatic colorectal cancer can also be nucleic acids, as defined above.
As described above generally for proteins, nucleic acid modulating agents may be naturally occurnng nucleic acids, random nucleic acids, or "biased" random nucleic acids.
Digests of procaryotic or eucaryotic genomes may be used as is outlined above for proteins.
In a preferred embodiment, the candidate compounds are organic chemical moieties, a wide variety of which are available in the literature.
After a candidate agent has been added and the cells allowed to incubate for some period of time, the sample containing a target sequence is analyzed. If required, the target sequence is prepared using known techniques. For example, the sample may be treated to lyse the cells, using known lysis buffers, electroporation, etc., with purification and/or amplification such as PCR performed as appropriate. For example, an ih vitro transcription with labels covalently attached to the nucleotides is performed. Generally, the nucleic acids are labeled with biotin-FITC or PE, or with cy3 or cy5.

In a preferred embodiment, the target sequence is labeled with, e.g., a fluorescent, a chemiluminescent, a chemical, or a radioactive signal, to provide a means of detecting the target sequence's specific binding to a probe. The label also can be an enzyme, such as, alkaline phosphatase or horseradish peroxidase, which when provided with an appropriate substrate produces a product that can be detected. Alternatively, the label can be a labeled compound or small molecule, such as an enzyme inhibitor, that binds but is not catalyzed or altered by the enzyme. The label also can be a moiety or compound, such as, an epitope tag or biotin which specifically binds to streptavidin. For the example of biotin, the streptavidin is labeled as described above, thereby, providing a detectable signal for the bound target sequence. Unbound labeled streptavidin is typically removed prior to analysis.
Nucleic acid assays can be direct hybridization assays or can comprise "sandwich assays", which include the use of multiple probes, as is generally outlined in U.S.
Patent Nos. 5,681,702, 5,597,909, 5,545,730, 5,594,117, 5,591,584, 5,571,670, 5,580,731, 5,571,670, 5,591,584, 5,624,802, 5,635,352, 5,594,118, 5,359,100, 5,124,246 and 5,681,697, all of which are hereby incorporated by reference. In this embodiment, in general, the target nucleic acid is prepared as outlined above, and then added to the biochip comprising a plurality of nucleic acid probes, under conditions that allow the formation of a hybridization complex.
A variety of hybridization conditions may be used in the present invention, including high, moderate and low stringency conditions as outlined above. The assays are generally run under stringency conditions which allow formation of the label probe hybridization complex only in the presence of target. Stringency can be controlled by altering a step parameter that is a thermodynamic variable, including, but not limited to, temperature, formamide concentration, salt concentration, chaotropic salt concentration, pH, organic solvent concentration, etc.
These parameters may also be used to control non-specific binding, as is generally outlined in U.S. Patent No. 5,681,697. Thus it may be desirable to perform certain steps at higher stringency conditions to reduce non-specific binding.
The reactions outlined herein may be accomplished in a variety of ways.
Components of the reaction may be added simultaneously, or sequentially, in different orders, with preferred embodiments outlined below. In addition, the reaction may include a variety of other reagents. These include salts, buffers, neutral proteins, e.g., albumin, detergents, etc.
which may be used to facilitate optimal hybridization and detection, and/or reduce non-specific or background interactions. Reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc., may also be used as appropriate, depending on the sample preparation methods and purity of the target.
The assay data are analyzed to determine the expression levels, and changes in expression levels as between states, of individual genes, forming a gene expression profile.
Screens are performed to identify modulators of the metastatic colorectal cancer phenotype. In one embodiment, screening is performed to identify modulators that can induce or suppress a particular expression profile, thus preferably generating the associated phenotype. In another embodiment, e.g., for diagnostic applications, having identified differentially expressed genes important in a particular state, screens can be performed to identify modulators that alter expression of individual genes. In an another embodiment, screening is performed to identify modulators that alter a biological function of the expression product of a differentially expressed gene. Again, having identified the importance of a gene in a particular state, screens are performed to identify agents that bind and/or modulate the biological activity of the gene product, or evaluate genetic polymorphisms.
Genes can be screened for those that are induced in response to a candidate agent. After identifying a modulator based upon its ability to suppress a metastatic colorectal cancer expression pattern leading to a normal expression pattern, or to modulate a single metastatic colorectal cancer gene expression profile so as to mimic the expression of the gene from normal tissue, a screen as described above can be performed to identify genes that are specifically modulated in response to the agent. Comparing expression profiles between normal tissue and agent treated metastatic colorectal cancer tissue reveals genes that are not expressed in normal tissue or metastatic colorectal cancer tissue, but are expressed in agent treated tissue. These agent-specific sequences can be identified and used by methods described herein for metastatic colorectal cancer genes or proteins. In particular these sequences and the proteins they encode find use in marking or identifying agent treated cells.
In addition, antibodies can be raised against the agent induced proteins and used to target novel therapeutics to the treated metastatic colorectal cancer tissue sample.
Thus, in one embodiment, a test compound is administered to a population of metastatic colorectal cancer cells, that have an associated metastatic colorectal cancer expression profile. By "administration" or "contacting" herein is meant that the candidate agent is added to the cells in such a manner as to allow the agent to act upon the cell, whether by uptake and intracellular action, or by action at the cell surface. In some embodiments, nucleic acid encoding a proteinaceous candidate agent (i.e., a peptide) may be put into a viral construct such as an adenoviral or retroviral construct, and added to the cell, such that expression of the peptide agent is accomplished, e.g., PCT US97/01019.
Regulatable gene therapy systems can also be used.
Once the test compound has been administered to the cells, the cells can be washed if desired and are allowed to incubate under preferably physiological conditions for some period of time. The cells are then harvested and a new gene expression profile is generated, as outlined herein.
Thus, e.g., metastatic colorectal cancer tissue may be screened for agents that modulate, e.g., induce or suppress the metastatic colorectal cancer phenotype.
A change in at least one gene, preferably many, of the expression profile indicates that the agent has an effect on metastatic colorectal cancer activity. By defining such a signature for the metastatic colorectal cancer phenotype, screens for new drugs that alter the phenotype can be devised.
With this approach, the drug target need not be known and need not be represented in the original expression screening platform, nor does the level of transcript for the target protein need to change.
Measure of metastatic colorectal cancer polypeptide activity, or of metastatic colorectal cancer or the metastatic colorectal cancer phenotype can be performed using a variety of assays. For example, the effects of the test compounds upon the function of the metastatic polypeptides can be measured by examining parameters described above. A
suitable physiological change that affects activity can be used to assess the influence of a test compound on the polypeptides of this invention. When the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as, in the case of metastatic colorectal cancer associated with tumors, tumor growth, tumor metastasis, neovascularization, hormone release, transcriptional changes to both known and uncharacterized genetic markers (e.g., northern blots), changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as cGMP. In the assays of the invention, mammalian metastatic colorectal cancer polypeptide is typically used, e.g., mouse, preferably human.
Assays to identify compounds with modulating activity can be performed ih vitro. For example, a colorectal cancer polypeptide is first contacted with a potential modulator and incubated for a suitable amount of time, e.g., from 0.5 to 48 hours. In one embodiment, the metastatic colorectal cancer polypeptide levels are determined in vitro by measuring the level of protein or mRNA. The level of protein is measured using immunoassays such as western blotting, ELISA and the like with an antibody that selectively binds to the metastatic colorectal cancer polypeptide or a fragment thereof.
For measurement of mRNA, amplification, e.g., using PCR, LCR, or hybridization assays, e.g., northern hybridization, RNAse protection, dot blotting, are preferred. The level of protein or mRNA
is detected using directly or indirectly labeled detection agents, e.g., fluorescently or radioactively labeled nucleic acids, radioactively or enzymatically labeled antibodies, and the like, as described herein.
Alternatively, a reporter gene system can be devised using the metastatic colorectal cancer protein promoter operably linked to a reporter gene such as luciferase, green fluorescent protein, CAT, or (3-gal. The reporter construct is typically transfected into a cell.
After treatment with a potential modulator, the amount of reporter gene transcription, translation, or activity is measured according to standard techniques known to those of skill in the art.
In a preferred embodiment, as outlined above, screens may be done on individual genes and gene products (proteins). That is, having identified a particular differentially expressed gene as important in a particular state, screening of modulators of the expression of the gene or the gene product itself can be done. The gene products of differentially expressed genes are sometimes referred to herein as "metastatic colorectal cancer proteins." The metastatic colorectal cancer protein may be a fragment, or alternatively, be the full length protein to a fragment shown herein.
In one embodiment, screening for modulators of expression of specific genes is performed. Typically, the expression of only one or a few genes are evaluated. In another embodiment, screens are designed to first find compounds that bind to differentially expressed proteins. These compounds are then evaluated for the ability to modulate differentially expressed activity. Moreover, once initial candidate compounds are identified, variants can be further screened to better evaluate structure activity relationships.
In a preferred embodiment, binding assays are done. In general, purified or isolated gene product is used; that is, the gene products of one or more differentially expressed nucleic acids are made. For example, antibodies are generated to the protein gene products, and standard immunoassays are run to determine the amount of protein present.
Alternatively, cells comprising the metastatic colorectal cancer proteins can be used in the assays.
Thus, in a preferred embodiment, the methods comprise combining a metastatic colorectal cancer protein and a candidate compound, and determining the binding of the compound to the metastatic colorectal cancer protein. Preferred embodiments utilize the human metastatic colorectal cancer protein, although other mammalian proteins may also be used, e.g., for the development of animal models of human disease. In some embodiments, as outlined herein, variant or derivative metastatic colorectal cancer proteins may be used.
Generally, in a preferred embodiment of the methods herein, the metastatic colorectal cancer protein or the candidate agent is non-diffusably bound to an insoluble support having isolated sample receiving areas (e.g., a microtiter plate; an array, etc.). The insoluble supports may be made of any composition to which the compositions can be bound, is readily separated from soluble material, and is otherwise compatible with the overall method of screening. The surface of such supports may be solid or porous and of any convenient shape. Examples of suitable insoluble supports include microtiter plates, arrays, membranes and beads. These are typically made of glass, plastic (e.g., polystyrene), polysaccharides, nylon or nitrocellulose, teflonTM, etc. Microtiter plates and arrays are especially convenient because a large number of assays can be carried out simultaneously, using small amounts of reagents and samples. The particular manner of binding of the composition is not crucial so long as it is compatible with the reagents and overall methods of the invention, maintains the activity of the composition and is nondiffusable.
Preferred methods of binding include the use of antibodies (which do not sterically block either the ligand binding site or activation sequence when the protein is bound to the support), direct binding to "sticky" or ionic supports, chemical crosslinking, the synthesis of the protein or agent on the surface, etc. Following binding of the protein or agent, excess unbound material is removed by washing. The sample receiving areas may then be blocked through incubation with bovine serum albumin (BSA), casein or other innocuous protein or other moiety.
In a preferred embodiment, the metastatic colorectal cancer protein is bound to the support, and a test compound is added to the assay. Alternatively, the candidate agent is bound to the support and the metastatic colorectal cancer protein is added.
Novel binding agents include specific antibodies, non-natural binding agents identified in screens of chemical libraries, peptide analogs, etc. Of particular interest are screening assays for agents that have a low toxicity for human cells. A wide variety of assays may be used for this purpose, including labeled in vitro protein-protein binding assays, electrophoretic mobility shift assays, immunoassays for protein binding, functional assays (phosphorylation assays, etc.) and the like.
The determination of the binding of the test modulating compound to the metastatic colorectal cancer protein may be done in a number of ways. In a preferred embodiment, the compound is labeled, and binding determined directly, e.g., by attaching all or a portion of the metastatic colorectal cancer protein to a solid support, adding.a labeled candidate.agent (e.g., a fluorescent label), washing off excess reagent, and determining whether the label is present on the solid support. Various blocking and washing steps may be utilized as appropriate.
In some embodiments, only one of the components is labeled, e.g., the proteins (or proteinaceous candidate compounds) can be labeled. Alternatively, more than one component can be labeled with different labels, e.g., l2sl for the proteins and a fluorophor for the compound. Proximity reagents, e.g., quenching or energy transfer reagents are also useful.
In one embodiment, the binding of the test compound is determined by competitive binding assay. The competitor is a binding moiety known to bind to the target molecule (i.e., a metastatic colorectal cancer protein), such as an antibody, peptide, binding partner, ligand, etc. Under certain circumstances, there may be competitive binding between the compound and the binding moiety, with the binding moiety displacing the compound. In one embodiment, the test compound is labeled. Either the compound, or the competitor, or both, is added first to the protein for a time sufficient to allow binding, if present.
Incubations may be performed at a temperature which facilitates optimal activity, typically between 4 and 40°C. Incubation periods are typically optimized, e.g., to facilitate rapid high throughput screening. Typically between 0.1 and 1 hour will be sufficient.
Excess reagent is generally removed or washed away. The second component is then added, and the presence or absence of the labeled component is followed, to indicate binding.
In a preferred embodiment, the competitor is added first, followed by the test compound. Displacement of the competitor is an indication that the test compound is binding to the metastatic colorectal cancer protein and thus is capable of binding to, and potentially modulating, the activity of the metastatic colorectal cancer protein. In this embodiment, either component can be labeled. Thus, e.g., if the competitor is labeled, the presence of label in the wash solution indicates displacement by the agent. Alternatively, if the test compound is labeled, the presence of the label on the support indicates displacement.
In an alternative embodiment, the test compound is added first, with incubation and washing, followed by the competitor. The absence of binding by the competitor may indicate that the test compound is bound to the metastatic colorectal cancer protein with a higher affinity. Thus, if the test compound is labeled, the presence of the label on the support, coupled with a lack of competitor binding, may indicate that the test compound is capable of binding to the metastatic colorectal cancer protein.

In a preferred embodiment, the methods comprise differential screening to identity agents that are capable of modulating the activity of the metastatic colorectal cancer proteins. In this embodiment, the methods comprise combining a metastatic colorectal cancer protein and a competitor in a first sample. A second sample comprises a test compound, a metastatic colorectal cancer protein, and a competitor. The binding of the competitor is determined for both samples, and a change, or difference in binding between the two samples indicates the presence of an agent capable of binding to the metastatic colorectal cancer protein and potentially modulating its activity. That is, if the binding of the competitor is different in the second sample relative to the first sample, the agent is capable of binding to the metastatic colorectal cancer protein.
Alternatively, differential screening is used to identify drug candidates that bind to the native metastatic colorectal cancer protein, but cannot bind to modified metastatic colorectal cancer proteins. The structure of the metastatic colorectal cancer protein may be modeled, and used in rational drug design to synthesize agents that interact with that site.
Drug candidates that affect the activity of a metastatic colorectal cancer protein are also identified by screening drugs for the ability to either enhance or reduce the activity of the protein.
Positive controls and negative controls may be used in the assays. Preferably control and test samples are performed in at least triplicate to obtain statistically significant results. Incubation of all samples is for a time sufficient for the binding of the agent to the protein. Following incubation, samples are washed free of non-specifically bound material and the amount of bound, generally labeled agent determined. For example, where a radiolabel is employed, the samples may be counted in a scintillation counter to determine the amount of bound compound.
A variety of other reagents may be included in the screening assays. These include reagents like salts, neutral proteins, e.g., albumin, detergents, etc.
which may be used to facilitate optimal protein-protein binding and/or reduce non-specific or background interactions. Also reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc., may be used. The mixture of components may be added in an order that provides for the requisite binding.
In a preferred embodiment, the invention provides methods for screening for a compound capable of modulating the activity of a metastatic colorectal cancer protein. The methods comprise adding a test compound, as defined above, to a cell comprising metastatic colorectal cancer proteins. Preferred cell types include almost any cell. The cells contain a recombinant nucleic acid that encodes a metastatic colorectal cancer protein.
In a preferred embodiment, a library of candidate agents are tested on a plurality of cells.
In one aspect, the assays are evaluated in the presence or absence or previous or subsequent exposure of physiological signals, e.g., hormones, antibodies, peptides, antigens, cytokines, growth factors, action potentials, pharmacological agents including chemotherapeutics, radiation, carcinogenics, or other cells (i.e. cell-cell contacts). In another example, the determinations are determined at different stages of the cell cycle process.
In this way, compounds that modulate metastatic colorectal cancer agents are identified. Compounds with pharmacological activity are able to enhance or interfere with the activity of the metastatic colorectal cancer protein. Once identified, similar structures are evaluated to identify critical structural feature of the compound.
In one embodiment, a method of inhibiting metastatic colorectal cancer cell division is provided. The method comprises administration of a metastatic colorectal cancer inhibitor. In another embodiment, a method of inhibiting metastatic colorectal cancer is provided. The method comprises administration of a metastatic colorectal cancer inhibitor.
In a further embodiment, methods of treating cells or individuals with metastatic colorectal cancer are provided. The method comprises administration of a metastatic colorectal cancer inhibitor.
A variety of cell growth, proliferation, and metastasis assays are known to those of skill in the axt, as described below.
Soft agar growth or colony formation in suspension Normal cells require a solid substrate to attach and grow. When the cells are transformed, they lose this phenotype and grow detached from the substrate.
For example, transformed cells can grow in stirred suspension culture or suspended in semi-solid media, such as semi-solid or soft agar. The transformed cells, when transfected with tumor suppressor genes, regenerate normal phenotype and require a solid substrate to attach and grow. Soft agar growth or colony formation in suspension assays can be used to identify modulators of metastatic colorectal cancer sequences, which when expressed in host cells, inhibit abnormal cellular proliferation and transformation. A therapeutic compound would reduce or eliminate the host cells' ability to grow in stirred suspension culture or suspended in semi-solid media, such as semi-solid or soft.
Techniques for soft agar growth or colony formation in suspension assays are described in Freshney, Culture ofAnimal Cells a Manual ofBasic Technique (3Td ed., 1994), herein incorporated by reference. See also, the methods section of Garkavtsev et al. (1996), supra, herein incorporated by reference.
Contact inlaibitiora and density linaitatiora of growth Normal cells typically grow in a flat and organized pattern in a petri dish until they touch other cells. When the cells touch one another, they are contact inhibited and stop growing. When cells are transformed, however, the cells are not contact inhibited and continue to grow to high densities in disorganized foci. Thus, the transformed cells grow to a higher saturation density than normal cells. This can be detected morphologically by the formation of a disoriented monolayer of cells or rounded cells in foci within the regular pattern of normal surrounding cells. Alternatively, labeling index with (3H)-thymidine at saturation density can be used to measure density limitation of growth. See Freshney (1994), supra. The transformed cells, when transfected with tumor suppressor genes, regenerate a normal phenotype and become contact inhibited and would grow to a lower density.
In this assay, labeling index with (3H)-thymidine at saturation density is a preferred method of measuring density limitation of growth. Transformed host cells are transfected with a metastatic colorectal cancer-associated sequence and are grown for 24 hours at saturation density in non-limiting medium conditions. The percentage of cells labeling with (3H)-thymidine is determined autoradiographically. See, Freshney (1994), supra.
Growth factor or serum dependence Transformed cells have a lower serum dependence than their normal counterparts (see, e.g., Temin, .I. Natl. Cancer Insti. 37:167-175 (1966);
Eagle et al., J. Exp.
Med. 131:836-879 (1970)); Freshney, supra. This is in part due to release of various growth factors by the transformed cells. Growth factor or serum dependence of transformed host cells can be compared with that of control.
Tumor specific markers levels Tumor cells release an increased amount of certain factors (hereinafter "tumor specific markers") than their normal counterparts. For example, plasminogen activator (PA) is released from human glioma at a higher level than from normal brain cells (see, e.g., Gullino, Angiogenesis, tunaor vascularization, and potential interference with tumor growth.
in Biological Responses in Cancer, pp. 178-184 (Mihich (ed.) 1985)).
Similarly, Tumor angiogenesis factor (TAF) is released at a higher level in tumor cells than their normal counterparts. See, e.g., Folkman, Angiogenesis and Cancer, Sem Cancer Biol.
(1992)). .
Various techniques which measure the release of these factors are described in Freshney (1994), supra. Also, see, Unkless et al. , J. Biol. Chem. 249:4295-4305 (1974);
Strickland & Beers, J. Biol. Chem. 251:5694-5702 (1976); Whur et al., Br. J.
Cancer 42:305-312 (1980); Gullino, Angiogenesis, tumor vascularizatiorz, and potential interference with tumor growth. in Biological Responses ira Cancer, pp. 178-184 (Mihich (ed.) 1985);
Freshney Anticancer Res. 5:111-130 (1985).
Invasiveness into Matrigel The degree of invasiveness into Matrigel or some other extracellular matrix constituent can be used as an assay to identify compounds that modulate metastatic colorectal cancer-associated sequences. Tumor cells exhibit a good correlation between malignancy and invasiveness of cells into Matrigel or some other extracellular matrix constituent. In this assay, tumorigenic cells are typically used as host cells. Expression of a tumor suppressor gene in these host cells would decrease invasiveness of the host cells.
Techniques described in Freshney (1994), supra, can be used. Briefly, the level of invasion of host cells can be measured by using filters coated with Matrigel or some other extracellular matrix constituent. Penetration into the gel, or through to the distal side of the filter, is rated as invasiveness, and rated histologically by number of cells and distance moved, or by prelabeling the cells with lzsI and counting the radioactivity on the distal side of the filter or bottom of the dish. See, e.g., Freshney (1984), supra.
Tumor growth in vivo Effects of metastatic colorectal cancer-associated sequences on cell growth can be tested in transgenic or immune-suppressed mice. Knock-out transgenic mice can be made, in which the metastatic colorectal cancer gene is disrupted or in which a metastatic colorectal cancer gene is inserted. Knock-out transgenic mice can be made by insertion of a marker gene or other heterologous gene into the endogenous metastatic colorectal cancer gene site in the mouse genome via homologous recombination. Such mice can also be made by substituting the endogenous metastatic colorectal cancer gene with a mutated version of the metastatic colorectal cancer gene, or by mutating the endogenous metastatic colorectal cancer gene, e.g., by exposure to carcinogens.

A DNA construct is introduced into the nuclei of embryonic stem cells. Cells containing the newly engineered genetic lesion are injected into a host mouse embryo, which is re-implanted into a recipient female. Some of these embryos develop into chimeric mice that possess germ cells partially derived from the mutant cell line.
Therefore, by breeding the chimeric mice it is possible to obtain a new line of mice containing the introduced genetic lesion (see, e.g., Capecchi et al., Science 244:1288 (1989)). Chimeric targeted mice can be derived according to Hogan et al., Manipulating the Mouse Embryo: A Laboratory Manual, Cold Spring Harbor Laboratory (1988) and Teratocarcinomas and Embryonic Stem Cells: A
Practical Approach, Robertson, ed., IRL Press, Washington, D.C., (1987).
Alternatively, various immune-suppressed or immune-deficient host animals can be used. For example, genetically athymic "nude" mouse (see, e.g., Giovanella et al., J.
Natl. Cancer Inst. 52:921 (1974)), a SCID mouse, a thymectomized mouse, or an irradiated mouse (see, e.g., Bradley et al., Br. J. Cancer 38:263 (1978); Selby et al., Br. J. Cancer 41:52 (1980)) can be used as a host. Transplantable tumor cells (typically about 106 cells) injected into isogenic hosts will produce invasive tumors in a high proportions of cases, while normal cells of similar origin will not. In hosts which developed invasive tumors, cells expressing a metastatic colorectal cancer-associated sequences are injected subcutaneously.
After a suitable length of time, preferably 4-8 weeks, tumor growth is measured (e.g., by volume or by its two largest dimensions) and compared to the control. Tumors that have statistically significant reduction (using, e.g., Student's T test) axe said to have inhibited growth. Additionally, human tumor cells expressing the genes of the invention may be injected into immune compromised animals. Growth of these tumors, or xenografts, is compared to growth of similar human tumor cell that do not express the genes of the invention. These animals may also be used to binding assays and efficacy studies for therapeutic compounds that modulate metastatic colorectal cancer, such as antibodies or small molecules.
Polynucleotide modulators of metastatic colorectal cancer Antisense Polynucleotides In certain embodiments, the activity of a metastatic colorectal cancer-associated protein is downregulated, or entirely inhibited, by the use of antisense polynucleotide, i.e., a nucleic acid complementary to, and which can preferably hybridize specifically to, a coding mRNA nucleic acid sequence, e.g., a metastatic colorectal cancer protein mRNA, or a subsequence thereof. Binding of the antisense polynucleotide to the mRNA reduces the translation and/or stability of the mRNA.
In the context of this invention, antisense polynucleotides can comprise naturally-occurring nucleotides, or synthetic species formed from naturally-occurring subunits or their close homologs. Antisense polynucleotides may also have altered sugar moieties or inter-sugar linkages. Exemplary among these are the phosphorothioate and other sulfur containing species which are known for use in the axt. Analogs are comprehended by this invention so long as they function effectively to hybridize with the metastatic colorectal cancer protein mRNA. See, e.g., Isis Pharmaceuticals, Carlsbad, CA; Sequitor, Inc., Natick, MA.
Such antisense polynucleotides can readily be synthesized using recombinant means, or can be synthesized in vitro. Equipment for such synthesis is sold by several vendors, including Applied Biosystems. The preparation of other oligonucleotides such as phosphorothioates and alkylated derivatives is also well known to those of skill in the art.
Antisense molecules as used herein include antisense or sense oligonucleotides. Sense oligonucleotides can, e.g., be employed to block transcription by binding to the anti-sense strand. The antisense and sense oligonucleotide comprise a single-stranded nucleic acid sequence (either RNA or DNA) capable of binding to target mRNA
(sense) or DNA (antisense) sequences for metastatic colorectal cancer molecules. A
preferred antisense molecule is for a metastatic colorectal cancer sequence in Tables 1-26, or for a ligand or activator thereof. Antisense or sense oligonucleotides, according to the present invention, comprise a fragment generally at least about 14 nucleotides, preferably from about 14 to 30 nucleotides. The ability to derive an antisense or a sense oligonucleotide, based upon a cDNA sequence encoding a given protein is described in, e.g., Stein & Cohen (Cancer Res. 48:2659 (1988 and van der Krol et al.
(BioTechniques 6:958 (1988)).
Ribozymes In addition to antisense polynucleotides, ribozymes can be used to target and inhibit transcription of metastatic colorectal cancer-associated nucleotide sequences. A
ribozyme is an RNA molecule that catalytically cleaves other RNA molecules.
Different kinds of ribozymes have been described, including group I ribozymes, hammerhead ribozymes, hairpin ribozymes, RNase P, and axhead ribozymes (see, e.g., Castanotto et al., Adv. in Pharmacology 25: 289-317 (1994) for a general review of the properties of different ribozymes).
The general features of hairpin ribozymes are described, e.g., in Hampel et al., Nucl. Acids Res. 18:299-304 (1990); European Patent Publication No. 0 360 257;
U.S. Patent No. 5,254,678. Methods of preparing are well known to those of skill in the art (see, e.g., WO 94/26877; Ojwang et al., Proc. Natl. Acad. Sci. USA 90:6340-6344 (1993);
Yamada et al., Human Gene Therapy 1:39-45 (1994); Leavitt et al., Proc. Natl. Acad. Sci.
USA 92:699-703 (1995); Leavitt et al., Human Gene Therapy 5:1151-120 (1994); and Yamada et al., Virology 205: 121-126 (1994)).
Polynucleotide modulators of metastatic colorectal cancer may be introduced into a cell containing the target nucleotide sequence by formation of a conjugate with a ligand binding molecule, as described in WO 91/04753. Suitable ligand binding molecules include, but are not limited to, cell surface receptors, growth factors, other cytokines, or other ligands that bind to cell surface receptors. Preferably, conjugation of the ligand binding molecule does not substantially interfere with the ability of the ligand binding molecule to bind to its corresponding molecule or receptor, or block entry of the sense or antisense oligonucleotide or its conjugated version into the cell. Alternatively, a polynucleotide modulator of metastatic colorectal cancer may be introduced into a cell containing the target nucleic acid sequence, e.g., by formation of an polynucleotide-lipid complex, as described in WO
90/10448. It is understood that the use of antisense molecules or knock out and knock in models may also be used in screening assays as discussed above, in addition to methods of treatment.
Thus, in one embodiment, methods of modulating metastatic colorectal cancer in cells or organisms are provided. In one embodiment, the methods comprise administering to a cell an anti-metastatic colorectal cancer antibody that reduces or eliminates the biological activity of an endogenous metastatic colorectal cancer protein. Alternatively, the methods ' comprise administering to a cell or organism a recombinant nucleic acid encoding a metastatic colorectal cancer protein. This may be accomplished in any number of ways. In a preferred embodiment, e.g., when the metastatic colorectal cancer sequence is down-regulated in metastatic colorectal cancer, such state may be reversed by increasing the amount of metastatic colorectal cancer gene product in the cell. This can be accomplished, e.g., by overexpressing the endogenous metastatic colorectal cancer gene or administering a gene encoding the metastatic colorectal cancer sequence, using known gene-therapy techniques. In a preferred embodiment, the gene therapy techniques include the incorporation of the exogenous gene using enhanced homologous recombination (EHR), e.g., as described in PCT/LJS93/03868, hereby incorporated by reference in its entirety.
Alternatively, e.g., when the metastatic colorectal cancer sequence is up-regulated in metastatic colorectal cancer, the activity of the endogenous metastatic colorectal cancer gene is decreased, e.g., by the administration of a metastatic colorectal cancer antisense nucleic acid.
In one embodiment, the metastatic colorectal cancer proteins of the present invention may be used to generate polyclonal and monoclonal antibodies to metastatic colorectal cancer proteins. Similarly, the metastatic colorectal cancer proteins can be coupled, using standard technology, to affinity chromatography columns. These columns may then be used to purify metastatic colorectal cancer antibodies useful for production, diagnostic, or therapeutic purposes. In a preferred embodiment, the antibodies are generated to epitopes unique to a metastatic colorectal cancer protein; that is, the antibodies show little or no cross-reactivity to other proteins. The metastatic colorectal cancer antibodies may be coupled to standard affinity chromatography columns and used to purify metastatic colorectal cancer proteins. The antibodies may also be used as blocking polypeptides, as outlined above, since they will specifically bind to the metastatic colorectal cancer protein.
Methods of-identifying variant metastatic colorectal cancer-associated sequences Without being bound by theory, expression of various metastatic colorectal cancer sequences is correlated with metastatic colorectal cancer. Accordingly, disorders based on mutant or variant metastatic colorectal cancer genes may be determined. In one embodiment, the invention provides methods for identifying cells containing variant metastatic colorectal cancer genes, e.g., determining all or part of the sequence of at least one endogenous metastatic colorectal cancer genes in a cell. This may be accomplished using any number of sequencing techniques. In a preferred embodiment, the invention provides methods of identifying the metastatic colorectal cancer genotype of an individual, e.g., determining all or part of the sequence of at least one metastatic colorectal cancer gene of the individual. This is generally done in at least one tissue of the individual, and may include the evaluation of a number of tissues or different samples of the same tissue. The method may include comparing the sequence of the sequenced metastatic colorectal cancer gene to a known metastatic colorectal cancer gene, i.e., a wild-type gene.
The sequence of all or part of the metastatic colorectal cancer gene can then be compared to the sequence of a known metastatic colorectal cancer gene to determine if any differences exist. This can be done using any number of known homology programs, such as Bestfit, etc. In a preferred embodiment, the presence of a difference in the sequence between the metastatic colorectal cancer gene of the patient and the known metastatic colorectal cancer gene correlates with a disease state or a propensity for a disease state, as outlined herein.
In a preferred embodiment, the metastatic colorectal cancer genes are used as probes to determine the number of copies of the metastatic colorectal cancer gene in the genome.
In another preferred embodiment, the metastatic colorectal cancer genes are used as probes to determine the chromosomal localization of the metastatic colorectal cancer genes. Information such as chromosomal localization finds use in providing a diagnosis or prognosis in particular when chromosomal abnormalities such as translocations, and the like are identified in the metastatic colorectal cancer gene locus.
Administration of pharmaceutical and vaccine compositions In one embodiment, a therapeutically effective dose of a metastatic colorectal cancer protein or modulator thereof, is administered to a patient. By "therapeutically effective dose" herein is meant a dose that produces effects for which it is administered. The exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (e.g., Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery; Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992), Dekker, ISBN 0824770846, 082476918X, 0824712692, 0824716981; Lloyd, The Art, Seience and Technology ofPharmaceutical Compounding (1999); and Pickar, Dosage Calculations (1999)). As is known in the art, adjustments for metastatic colorectal cancer degradation, systemic versus localized delivery, and rate of new protease synthesis, as well as the age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
A "patient" for the purposes of the present invention includes both humans and other animals, particularly mammals. Thus the methods are applicable to both human therapy and veterinary applications. In the preferred embodiment the patient is a mammal, preferably a primate, and in the most preferred embodiment the patient is human.
The administration of the metastatic colorectal cancer proteins and modulators thereof of the present invention can be done in a variety of ways as discussed above, including, but not limited to, orally, subcutaneously, intravenously, intranasally, transdermally, intraperitoneally, intramuscularly, intrapulmonary, vaginally, rectally, or intraocularly. In some instances, e.g., in the treatment of wounds and inflammation, the metastatic colorectal cancer proteins and modulators may be directly applied as a solution or spray.
The pharmaceutical compositions of the present invention comprise a metastatic colorectal cancer protein in a form suitable for administration to a patient. In the preferred embodiment, the pharmaceutical compositions are in a water soluble form, such as being present as pharmaceutically acceptable salts, which is meant to include both acid and base addition salts. "Pharmaceutically acceptable acid addition salt" refers to those salts that retain the biological effectiveness of the free bases and that are not biologically or otherwise undesirable, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malefic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like.
"Pharmaceutically acceptable base addition salts" include those derived from inorganic bases such as sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. Particularly preferred are the ammonium, potassium, sodium, calcium, and magnesium salts. Salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, and ethanolamine.
The pharmaceutical compositions may also include one or more of the following: Garner proteins such as serum albumin; buffers; fillers such as microcrystalline cellulose, lactose, corn and other starches; binding agents; sweeteners and other flavoring agents; coloring agents; and polyethylene glycol.
The pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration. For example, unit dosage forms suitable for oral administration include, but are not limited to, powder, tablets, pills, capsules and lozenges. It is recognized that metastatic colorectal cancer protein modulators (e.g., antibodies, antisense constructs, ribozymes, small organic molecules, etc.) when administered orally, should be protected from digestion. It is also recognized that, after delivery to other 7s sites in the body (e.g., circulatory system, lymphatic system, or the tumor site) the metastatic colorectal cancer modulators of the invention may need to be protected from excretion, hydrolisis, proteolytic digestion or modification, or detoxification by the liver. In all these cases, protection is typically accomplished either by complexing the molecules) with a composition to render it resistant to acidic and enzymatic hydrolysis, or by packaging the molecules) in an appropriately resistant Garner, such as a liposome or a protection barrier or by modifying the molecular size, weight, andlor charge of the modulator. Means of protecting agents from digestion degradation, and excretion are well known in the art.
The compositions for administration will commonly comprise a metastatic colorectal cancer protein modulator dissolved in a pharmaceutically acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, e.g., sodium acetate, sodium chlorides potassium chloride, calcium chloride, sodium lactate and the like. The concentration of active agent in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs (e.g., Remington's Pharmaceutical Science (15th ed., 1980) and Goodman & Gillman, The Pharmacologial Basis of Therapeutics (Hardman et al., eds., 1996)).
Thus, a typical pharmaceutical composition for intravenous administration would be about 0.1 to 10 mg per patient per day. Dosages from 0.1 up to about 100 mg per patient per day may be used, particularly when the drug is administered to a secluded site and not into the blood stream, such as into a body cavity or into a lumen of an organ.
Substantially higher dosages are possible in topical administration. Actual methods for preparing parenterally administrable compositions will be known or apparent to those skilled in the art, e.g., Remington's Pharmaceutical Science and Goodman and Gillinan, The Pharmacologial Basis of Therapeutics, supra.
The compositions containing modulators of metastatic colorectal cancer proteins can be administered for therapeutic or prophylactic treatments. In therapeutic applications, compositions are administered to a patient suffering from a disease (e.g., a cancer) in an amount sufficient to cure or at least partially arrest the disease and its complications. An amount adequate to accomplish this is defined as a "therapeutically effective dose." Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the composition should provide a sufficient quantity of the agents of this invention to effectively treat the patient. An amount of modulator that is capable of preventing or slowing the development of cancer in a mammal is referred to as a "prophylactically effective dose." The particular dose required for a prophylactic treatment will depend upon the medical condition and history of the mammal, the particular cancer being prevented, as well as other factors such as age, weight, gender, administration route, efficiency, etc. Such prophylactic treatments may be used, e.g., in a mammal who has previously had cancer to prevent a recurrence of the cancer, or in a mammal who is suspected of having a significant likelihood of developing cancer.
It will be appreciated that the present metastatic colorectal cancer protein-modulating compounds can be administered alone or in combination with additional metastatic colorectal cancer modulating compounds or with other therapeutic agent, e.g., other anti-cancer agents or treatments.
In numerous embodiments, one or more nucleic acids, e.g., polynucleotides comprising nucleic acid sequences set forth in Tables 1-26, such as antisense polynucleotides or ribozymes, will be introduced into cells, in vitro or in vivo. The present invention provides methods, reagents, vectors, and cells useful for expression of metastatic colorectal cancer-associated polypeptides and nucleic acids using in vitro (cell-free), ex vivo or in vivo (cell or organism-based) recombinant expression systems.
The particular procedure used to introduce the nucleic acids into a host cell for expression of a protein or nucleic acid is application specific. Many procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, spheroplasts, electroporation, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Berger ~ Kimmel, C'rciide to Molecular Cloning Techniques, Methods in Enzymology volume 152 (Berger), Ausubel et al., eds., Current Protocols (supplemented through 1999), and Sambrook et al., Moleeular Cloning - A Laboratory Manual (2nd ed., Vol. 1-3, 1989.
In a preferred embodiment, metastatic colorectal cancer proteins and modulators are administered as therapeutic agents, and can be formulated as outlined above.

Similarly, metastatic colorectal cancer genes (including bath the full-length sequence, partial sequences, or regulatory sequences of the metastatic colorectal cancer coding regions) can be administered in a gene therapy application. These metastatic colorectal cancer genes can include antisense applications, either as gene therapy (i.e., for incorporation into the genome) or as antisense compositions, as will be appreciated by those in the art.
Metastatic colorectal cancer polypeptides and polynucleotides can also be administered as vaccine compositions to stimulate HTL, CTL and antibody responses.. Such vaccine compositions can include, e.g., lipidated peptides (see, e.g.,Vitiello, et al., J. Clin.
Invest. 95:341 (1995)), peptide compositions encapsulated in poly(DL-lactide-co-glycolide) ("PLG") microspheres (see, e.g., Eldridge, et al., Molec. Immunol. 28:287-294, (1991);
Alonso et al., haccine 12:299-306 (1994); Jones et al., Vaccine 13:675-681 (1995)), peptide compositions contained in immune stimulating complexes (ISCOMS) (see, e.g., Takahashi et al., Nature 344:873-875 (1990); Hu et al., Clin Exp Immunol. 113:235-243 (1998)), multiple antigen peptide systems (MAPS) (see, e.g., Tam, Proc. Natl. Acad. Sci. U.S.A.
85:5409-5413 (1988); Tam, J. Immunol. Methods 196:17-32 (1996)), peptides formulated as multivalent peptides; peptides for use in ballistic delivery systems, typically crystallized peptides, viral delivery vectors (Perkus, et al., In: Coneepts in vaccine development (Kaufinann, ed., p. 379, 1996); Chakrabarti, et al., Nature 320:535 (1986); Hu et al., Nature 320:537 (1986); Kieny, et al., AIDSBiolTechnology 4:790 (1986); Top et al., J. Infect. Dis. 124:148 (1971); Chanda et al., Virology 175:535 (1990)), particles of viral or synthetic origin (see, e.g., Kofler et al., J. Immunol. Methods. 192:25 (1996); Eldridge et al., Sem. Hematol. 30:16 (1993); Falo et al., Nature Med. 7:649 (1995)), adjuvants (Warren et al., Annu. Rev. Immunol. 4:369 (1986);
Gupta et al., Vaccine 11:293 (1993)), liposomes (Reddy et al., J. Immunol.
148:1585 (1992);
Rock, Immunol. Today 17:131 (1996)), or, naked or particle absorbed cDNA
(LJlmer, et al., Science 259:1745 (1993); Robinson et al., Vaccine 11:957 (1993); Shiver et al., In: Concepts in vaccine development (Kaufinann, ed., p. 423, 1996); Cease & Berzofsky, Annu. Rev.
Immunol. 12:923 (1994) and Eldridge et al., Sem. Hematol. 30:16 (1993)). Toxin-targeted delivery technologies, also known as receptor mediated targeting, such as those of Avant Immunotherapeutics, Inc. (Needham, Massachusetts) may also be used.
Vaccine compositions often include adjuvants. Many adjuvants contain a substance designed to protect the antigen from rapid catabolism, such as aluminum hydroxide or mineral oil, and a stimulator of immune responses, such as lipid A, Bortadella pertussis or Mycobacterium tuberculosis derived proteins. Certain adjuvants are commercially available as, e.g., Freund's Incomplete Adjuvant and Complete Adjuvant (Difco Laboratories, Detroit, MI); Merck Adjuvant 65 (Merck and Company, Inc., Rahway, NJ); AS-2 (SmithKline Beecham, Philadelphia, PA); aluminum salts such as aluminum hydroxide gel (alum) or aluminum phosphate; salts of calcium, iron or zinc; an insoluble suspension of acylated tyrosine; acylated sugars; cationically or anionically derivatized polysaccharides;
polyphosphazenes; biodegradable microspheres; monophosphoryl lipid A and quil A.
Cytokines, such as GM-CSF, interleukin-2, -7, -12, and other like growth factors, may also be used as adjuvants.
Vaccines can be administered as nucleic acid compositions wherein DNA or RNA encoding one or more of the polypeptides, or a fragment thereof, is administered to a patient. This approach is described, for instance, in Wolff et. al., Science 247:1465 (1990) as well as U.S. Patent Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118;
5,736,524; 5,679,647;
WO 98/04720; and in more detail below. Examples of DNA-based delivery technologies include "naked DNA", facilitated (bupivicaine, polymers, peptide-mediated) delivery, cationic lipid complexes, and particle-mediated ("gene gun") or pressure-mediated delivery (see, e.g., U.S. Patent No. 5,922,687).
For therapeutic or prophylactic immunization purposes, the peptides of the invention can be expressed by viral or bacterial vectors. Examples of expression vectors include attenuated viral hosts, such as vaccinia or fowlpox. This approach involves the use of vaccinia virus, e.g., as a vector to express nucleotide sequences that encode metastatic colorectal cancer polypeptides or polypeptide fragments. Upon introduction into a host, the recombinant vaccinia virus expresses the immunogenic peptide, and thereby elicits an immune response. Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Patent No. 4,722,848. Another vector is BCG (B~cille Calinette Guerin). BCG vectors are described in Stover et al., Nature 351:456-460 (1991). A wide variety of other vectors useful for therapeutic administration or immunization e.g., adeno and adeno-associated virus vectors, retroviral vectors, Salm~nella typhi vectors, detoxified anthrax toxin vectors, and the like, will be apparent to those skilled in the art from the description herein (see, e.g., Shata et al., Mol Med Today 6:66-71 (2000);
Shedlock et al., J
Leukoc Biol 68:793-806 (2000); Hipp et al., In I~ivo 14:571-85 (2000)).
Methods for the use of genes as DNA vaccines are well known, and include placing a metastatic colorectal cancer gene or portion of a metastatic colorectal cancer gene under the control of a regulatable promoter or a tissue-specific promoter for expression in a metastatic colorectal cancer patient. The metastatic colorectal cancer gene used for DNA
vaccines can encode full-length metastatic colorectal cancer proteins, but more preferably encodes portions of the metastatic colorectal cancer proteins including peptides derived from the metastatic colorectal cancer protein. In one embodiment, a patient is immunized with a DNA vaccine comprising a plurality of nucleotide sequences derived from a metastatic colorectal cancer gene. For example, metastatic colorectal cancer-associated genes or sequence encoding subfragments of a metastatic colorectal cancer protein are introduced into expression vectors and tested for their immunogenicity in the context of Class I MIiC and an ability to generate cytotoxic T cell responses. This procedure provides for production of cytotoxic T cell responses against cells which present antigen, including intracellular epitopes.
In a preferred embodiment, the DNA vaccines include a gene encoding an adjuvant molecule with the DNA vaccine. Such adjuvant molecules include cytokines that increase the immunogenic .response to the metastatic colorectal cancer polypeptide encoded by the DNA vaccine. Additional or alternative adjuvants are available.
In another preferred embodiment metastatic colorectal cancer genes find use in generating animal models of metastatic colorectal cancer. When the metastatic colorectal cancer gene identified is repressed or diminished in metastatic tissue, gene therapy technology, e.g., wherein antisense RNA directed to the metastatic colorectal cancer gene will also diminish or repress expression of the gene. Animal models of metastatic colorectal cancer find use in screening for modulators of a metastatic colorectal cancer-associated sequence or modulators of metastatic colorectal cancer. Similarly, transgenic animal technology including gene knockout technology, e.g., as a result of homologous recombination with an appropriate gene targeting vector, will result in the absence or increased expression of the metastatic colorectal cancer protein. When desired, tissue-specific expression or knockout of the metastatic colorectal cancer protein may be necessary.
It is also possible that the metastatic colorectal cancer protein is overexpressed in metastatic colorectal cancer. As such, transgenic animals can be generated that overexpress the metastatic colorectal cancer protein. Depending on the desired expression level, promoters of various strengths can be employed to express the transgene. Also, the number of copies of the integrated transgene can be determined and compared for a determination of the expression level of the transgene. Animals generated by such methods find use as animal models of metastatic colorectal cancer and are additionally useful in screening for modulators to treat metastatic colorectal cancer.

Kits for Use in Diagnostic and/or Prognostic Applications For use in diagnostic, research, and therapeutic applications suggested above, kits are also provided by the invention. In the diagnostic and research applications such kits may include any or all of the following: assay reagents, buffers, metastatic colorectal cancer-specific nucleic acids or antibodies, hybridization probes and/or primers, antisense polynucleotides, ribozymes, dominant negative metastatic colorectal cancer polypeptides or polynucleotides, small molecules inhibitors of metastatic colorectal cancer-associated sequences etc. A therapeutic product may include sterile saline or another pharmaceutically acceptable emulsion and suspension base.
In addition, the kits may include instructional materials containing directions (i.e., protocols) for the practice of the methods of this invention. While the instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to Internet sites that provide such instructional materials.
The present invention also provides for kits for screening for modulators of metastatic colorectal cancer-associated sequences. Such kits can be prepared from readily available materials and reagents. For example, such kits can comprise one or more of the following materials: a metastatic colorectal cancer-associated polypeptide or polynucleotide, reaction tubes, and instructions for testing metastatic colorectal cancer-associated activity.
Optionally, the kit contains biologically active metastatic colorectal cancer protein. A wide variety of kits and components can be prepared according to the present invention, depending upon the intended user of the kit and the particular needs of the user.
Diagnosis would typically involve evaluation of a plurality of genes or products. The genes will be selected based on correlations with important parameters in disease which may be identified in historical or outcome data.

Table 1 Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey ExAccn UnigenelD Unigene Title Ratio BS_Mets Top 3 expressing cell lines 103989 AA314779 Hs.105484 ESTs;15.77 EB cells, HT29_cells, Weakly similar to LITHOSTATHINE HMEC

101169 L15533 Hs.423 pancreatitis-associated11.98 HMEC (total RNA), Fibroblasts protein 2, Fibroblasts 2 101880 M97925 Hs.72887 defensin;9.24 Fibroblasts 2, MB231 alpha 5; Paneth cell-specific cells, MB-MDA-453 129462 D84239 Hs.111732 IgG 8.57 EB_cells, OVCAR_cells, Fc binding protein ~ HS578T_cells 131676 C20785 Hs.30514 ESTs 7.43 HMEC (total RNA), HMEC, Fibroblasts 2 131861 D11925 Hs.184245 KIAA09297,15 HMEC, HMEC (total RNA), protein Msx2 interacting nuclea Fibroblasts 2 118823 N79237 Hs.50813 ESTs; 6.72 HMEC, HMEC (total RNA), Weakly similar to long chain Lu-AD-H23 fatty 101107 L08010 Hs.4158 regenerating6.33 BT474-cells, Fibroblasts islet-derived 1 beta (pancr 2, MB231 cells 103466 Y00339 Hs.155097 carbonic6.18 OVCAR cells, MCF7, 293T_cells anhydrase II

102306 U33317 Hs.711 defensin; 5.67 Fibroblasts 2, HMEC, alpha 6; Paneth cell-specific HT29_cells 126419 AA451775 Hs.129064 H 5.14 HS578T_cells, HMEC (total sapiens chromosome 19; cosmid RNA), HMEC

101198 L21998 Hs.315 mucin 2; 5.1 EB_cells, HT29-cells, intestinal/tracheal MB231 cells 107652 AA010195 Hs.52642 ESTs; 4.94 HMEC (total RNA), HMEC, Weakly similar to !!!! ALU EB_cells CLASS F

128145 AI498467 Hs.166669 ESTs;4.77 HS578T-cells, HMEC, Lu_Sf~H520 Weakly similar to sodium bicarbona 110660 H82117 Hs.28043 ESTs 4.54 HMEC, HS578T-cells, BT474-cells 111669 819305 Hs.110347 H sapiens4.52 HMEC, HS578T_cells, Caco2 mRNA for alpha integrin bindin 124867 868971 Hs.168500 ESTs 4.5 HMEC, HMEC (total RNA), HS578T_cells 127352 AA416577 Hs.189105 ESTs 4.41 HMEC, HMEC (total RNA), MB-MDA-435s 130736 T99385 Hs.18646 EST 4.29 HMEC, EB cells, HMEC
(total RNA) 128592 AA470056 Hs.113994 ESTs;4.18 HMEC (total RNA), HMEC, Weakly similar to alternatively Fibroblasts 2 sp 108092 AA045961 Hs.169355 ESTs; 4.04 HMEC (total RNA), Weakly similar to TRANSCRIPTION HMEC, Fibroblasts 2 RE

133373 S72487 Hs.73946 endothelial4.03 EB-cells, HMEC, HMEC
cell growth factor 1 (platel (total RNA) 100572 HG2271 Profilaggrin 4.03 HMEC (total RNA), HMEC, Fibroblasts 2 115775 AA424030 Hs.46627 ESTs 4.02 HMEC, HMEC (total RNA), EB cells 120811 AA346854 Hs.52788 fragile4.01 HMEC (total RNA), HMEC, X mental retardation; autosomal Fibroblasts 2 111919 839926 Hs.21031 ESTs 3.98 EB-cells, HMEC (total RNA), HMEC

117009 H85422 Hs.108556 ESTs 3.97 HMEC (total RNA), HMEC, Fibroblasts 2 101124 L10343 Hs.112341 protease3.89 PC3_cells, RPWE-2, Caco2 inhibitor 3; skin-derived (SKAL

106151 AA424958 Hs.33735 ESTs 3.88 EB_cells, HMEC, HMEC
(total RNA) 134733 U03644 Hs.89421 CBF1 3.88 EB_cells, HMEC, HMEC
interacting corepressor (total RNA) 131739 AA449749 Hs.31386 ESTs; 3.87 HS578T_cells, MB-MDA-435s, Highly similar to secreted HT29-cells apoptos 116311 AA490469 Hs.48752 ESTs 3.84 HS578T_cells, HMEC, LNCaP
cells 134174 U05259 Hs.79630 CD79A 3.83 DU145 cells, Lu~4D_H23, antigen (immunoglobulin-associated MB231 cells 106753 AA476944 Hs.7331 ESTs 3.82 LNCaP cells, Lu_SC_H345, DU145 cells 104842 AA039854 Hs.8065 H saptens3.78 HS578T_cells, A549_celfs, mRNA full length insert cDNA CALU6_cells c 129161 N27334 Hs.181780 ESTs 3.75 HMEC (total RNA), HMEC, BT474-cells 105675 AA284767 Hs.252808 ESTs;3.75 293T_cells, PRSC_con, Highly similar to pulmonary HT29_cells surfac 100547 HG2149 Mucin (Gb:M57417)3.75 HMEC (total RNA), HMEC, Fibroblasts 2 116857 H65841 Hs.186550 ESTs 3.73 HS578T_cells, 293TCells, HMEC

113222 T59670 Hs.10615 ESTs 3.7 HMEC, HS578T-cells, Caco2 118768 N74467 Hs.94304 EST 3.68 HMEC, HS578T_cells, OVCAR_cells 114542 AA055768 Hs.122576 ESTs 3.66 EB_cells, MCF7, LNCaP_cells 101640 M58459 Hs.180911 ribosomal3.62 DU145_cells, RPWE 2, protein S4; Y-linked A549_cells 107754 AA017462 Hs.187571 ESTs 3.6 HMEC (total RNA), Fibroblasts 2, Fibroblasts 2 104668 AA007312 Hs.183852 ESTs;3.58 HMEC (total RNA), HMEC, Weakly similar to polymerase Fibroblasts 2 [H.sa 135377 C21382 Hs.99766 H Sapiens 3,56 HMEC, HMEC (total mRNA; cDNA DKFZp564J0323 (from RNA), EB-cells 127083 244079 Hs,91608 otoferlin3.53 HMEC (total RNA), HMEC, Fibroblasts 2 102329 U35407 Hs.158084 peroxisome3.51 HMEC, HMEC (total RNA), receptor 1 EB_cells 117882 N50101 Hs.124724 ESTs; 3.47 HMEC (total RNA), HMEC, Weakly similar to coded for EB_cells by C.

126405 U46278 Hs.122489 ESTs 3.46 LNCaP cells, MCF7, DU145 cells 131378 AA463886 Hs.203910 small3.45 EB_cells, HMEC, HMEC
glutamine-rich tetratricopep6de (total RNA) r 111418 801084 Hs.19081 ESTs 3.43 HS578T_cells, EB_cells, Lu_AD 1123 135398 AA194075 Hs.99908 nuclear3.4 HS578T_cells, EB_cells, receptorcoactivator4 HMEC

108710 AA121960 zm24g9.s1 Stratagene pancreas (#93728) H

mRNA seq 3.4 EB_cells, HMEC, HMEC
(total RNA) 105437 AA252191 Hs.25199 ESTs; 3.38 EB_cells, LNCaP-cells, Highly similar to match to RPWE_2 ESTs AA

103448 X99133 Hs.204238 lipocalin3.38 PC3_cells, EB_cells, 2 (oncogene 24p3) HT29-cells 130436 M84526 Hs.155597 D component3.37 PRSC_con, EB cells, Lu~D
of complement (adipsin) H23 112309 855021 yj76d5.s1 Soares 3.36 EB_cells, HMEC, HMEC
breast 2NbHBst H sapien (total RNA) 103211 X73079 Hs.205126 polymeric3.35 MB231 cells, HT29_cells, immunoglobulin receptor Lu_SC_H69 109012 AA156576 Hs.191466 ESTs 3.21 EB_cells, HMEC, HMEC
(total RNA) 129989 AF005887 Hs,247433 activating3.19 HMEC (total RNA), HMEC, transcription factor 6 Lu AD_H23 113466 T86945 Hs,16304 ESTs 3.18 HMEC, MB231_cells, Caco2 103029 X54489 Hs.789 GR01 oncogene3.16 Lu_LC_H460, PC3_cells, (melanoma growth sGmulati Fibroblasts 2 109374 3.13 Caco2, A549_cells, MB231_cells Hs.210785 ESTs;
Highly similar to Ibd1 [H.sapiensj 131403 Hs.26455 ESTs 3.13 HS578T_cells, HMEC, MB231_cells 113420 Hs.15400 ESTs 3.11 HMEC (total RNA), HMEC, T83964 EB_cells 112532 Hs.28313 ESTs 3.11 HMEC, HMEC (total RNA), 869824 EB_cells 117905 Hs.231713 EST 3.11 HMEC, HS578T_cells, Caco2 125349 Hs.164480 ESTs 3.1 HS578T_cells, EB_cells, T87826 MB-MDA-435s 107072 Hs.177533 H sapiens mRNA; 3.1 Lu_SC H69, MB-MDA-453, AA609113cDNA DKFZp586N0318 (from MB231 cells 118389 Hs.182385 ESTs 3.05 HMEC, HMEC, LNCaP_cells 117653 Hs.194214 ESTs 3.04 HMEC, HMEC (to[al RNA), N38970 Fibroblasts 2 101082 Hs.80645 interferon regulatory3.04 EB cells, PRSC_con, DU145_cells L05072 factor 1 126105 Hs.167614 ESTs 3.03 HS578T_cells, HMEC (total H75323 RNA), HMEC

120006 Hs.10848 KIAA0187 gene 3.03 HMEC, HMEC (total RNA), W90108 product EB_cells 127191 EST113160 Gall bladder 3.02 HMEC, Lu~D_H23, Lu_S(ZH520 AA297581I H Sapiens cDNA

106899 Hs.21753 JM5 protein 3.02 EB_cells, HMEC (total AA490107 RNA), HMEC

112784 Hs.191290 ESTs 3.02 EB_cells, HMEC, Lu_AD_358 113613 Hs.17167 ESTs; Highly 3.02 HMEC (total RNA), EB_cells, T93337 similar to LRR FLI-I HMEC
intera 107631 Hs.95026 ESTs 3,02 Lu_SC H345, HS578T_cells, AA007230 Lu LC_H460 101923 HNL=neutrophil lipocalin3.01 PC3_cells, EB_cells, HT29_cells S75256 [human, ovarian 100695 Beta-1-Glycoprotein 11, 3,01 Fibroblasts 2, Lu~4D_H23, HG315T Pregnancy-Specif MB-MDA-435s 102523 Hs.15432 downregulated 2.98 PRSC_con, Fibroblasts U53445 in ovarian cancer 1 2, HMEC

121588 Hs.98242 ESTs 2,94 HMEC, HS578T_cells, BT474 AA416615 cells 103714 Hs.192943 ESTs 2,94 HS578T_cells, EB_cells, 104916 Hs.16542 ESTs 2.93 HMEC (total RNA), Fibroblasts AA056588 2, HMEC

109928 Hs.26331 ESTs 2.92 HMEC, MB231 cells, HS578T_cells 104586 Hs.20787 ESTs 2.92 Caco2, Lu_AD_358, Lu_AD

101236 Hs.47913 coagulation 2.91 HMEC, HS578T_cells, Caco2 L29433 factor X

134749 Hs.89485 carbonic anhydrase2.9 BT474_ce!Is, MCF7, HMEC
L10955 IV (total RNA) 124703 Hs.109108 solute camerfamily2.9 HMEC, HMEC (total RNA), 807294 22 (organic catioh MB-MDA-435s 114108 Hs.27038 ESTs; Moderately2.89 HMEC, HMEC (total RNA), 238431 similar to X-linked EB cells ret 107857 Hs.61208 ESTs 2.88 HS578T_cells, MB231 cells, 111586 Hs.15177 ESTs 2.88 HS578T_cells, Lu_LC_H460, 810759 PRSC con 127553 H Sapiens p60 katanin 2.87 EB_cells, MB-MDA-435s, AA282433mRNA; complete cds RPWE_2 129881 Hs.197728 ESTs; Weakly EB_cells, PC3_cells, HMEC
AA458952similar to ZINC FINGER
PROT 2,86 116852 Hs.38323 ESTs 2,85 HMEC, Caco2, HS578T_cells 133468 Hs.73931 major histocompa6bility2.82 MB-MDA~t35s, BT474 cells, X03068 complex; class HT29_cells 130998 Hs.21970 guanine nucleotide2.82 LNCaP cells, Lu_SC_H345, C00810 binding protein (G pr EB cells ' 124075 Hs.101643 ESTs 2.82 HMEC, HS578T_cells, HT29 H05741 cells 128108 Hs.129966 ESTs 2.82 HS578T_cells, Lu LC H460, AI247422 Lu_SC_H69 128096 Hs.164919 ESTs; Highly 2.8 MB231 cells, Lu~D_H23, 815413 similar to PROTEIN KINASE RPWE-2 C

126619 HSBA7E032 STRATAGENE musc 228861 Human skeletal cDNA clone A7E03, mRNA 2.77 HMEC, Lu~4D_H23, HMEC
seq. (total RNA) 114418 Hs.177313 ESTs 2.77 HS578T_cells, EB_cells, 120383 Hs.120234 ESTs 2.77 EB_cells, Fibroblasts AA228030 2, HMEC (total RNA) 126535 Hs.250723 ESTs; Weakly 2.76 Fibroblasts 2, PRSC_con, H73017 similar to atrophin-1 DU145_cells relat 119347 yc10d08.s1 Stratagene 2.76 EB_cells, Lu_AD_H23, Lu_SC_H69 T64349 lung (#937210) H s 126219 Hs.141438 ESTs; Moderately2.76 Lu-AD_H23, HMEC (total N36368 similarto similar to RNA), MB-MDA-435s C

125426 Hs.169355 ESTs; Weakly E 2.75 HMEC, HMEC (total 843963 similar to TRANSCRIPTION RNA), Lu_SC_H69 R

103005 Hs.2700 glycine receptor,2.74 HS578T_celis, HMEC, MB-MDA-453 X52008 alpha 2 109170 Hs.191472 ESTs 2.74 Fibroblasts 2, HMEC (total AA180352 RNA), MB-MDA-435s 101125 Hs.82749 transmembrane 2.73 Lu LC_H460, 293T_cells, L10373 4 superfam!ly member EB cells 130656 Hs.17411 KIAA0699 profein2.73 HMEC (total RNAj, HMEC, 220481 Fibroblasts 2 122933 Hs.107537 ESTs 2.72 HMEC, EB cells, HMEC (total AA476728 RNA) 126033 Hs.3807 ESTs; Weakly PR 2.71 Lu_SC_H345, Lu SC_H69, AA055978s!milar to PHOSPHOLEMMAN 293T_cells 111644 Hs.223649 EST; Moderately2.71 EB_cells, HMEC, HMEC (total 816539 similar to Cd-7 Metallo RNA) 133719 Hs.75736 apolipoprotein 2.71 Caco2, Fibroblasts 2, AA033790D MB-MDA-435s 127555 Hs.192857 ESTs 2.7 HMEC, HS578T_cells, HMEC
AA582324 (total RNA) 113321 Hs.13759 ESTs 2.69 HMEC (total RNA), Fibroblasts T70580 2, PRSC_con 109326 Hs.86414 ESTs 2.68 MB-MDA~t35s, HS578T_celis, AA210719 Lu_SC_H69 135003 Hs.92832 ESTs 2.68 HS578T_cells, EB_cells, H42527 PRSC_con 103650 H.sapiens mRNA for 5'UTR2.68 HMEC, HS578T_cells, PRSC_con 270220 for unknown pro 111507 Hs.191218 ESTs 2.67 HMEC (total RNA), HMEC, 807728 EB cells 117084 Hs.41829 ESTs 2.67 HS578T_cells, HMEC, MB231 H93081 cells 103975 Hs.176403 ESTs; Moderately2.67 DU145_cells, HS578T_cells, AA306264similar to !!!! ALU MB-MDA-435s SUB

132850 Hs.58215 ESTs; Moderately2.66 HS578T_cells, EB_celis, 889741 similar to rhotekin 293T_cells [M.

121599 Hs.98255 EST 2.61 HMEC (total RNA), HMEC, AA416770 EB_cells 124230 Hs.6655 ESTs 2.6 HMEC (total RNA), HMEC, H63111 Fibroblasts 2 114174 Hs.27264 ESTs; Moderately2.58 Caco2, MB-MDA-453, A549_cells 239055 similar to !!!! ALU
SUB

128469 Hs.258677 EST 2.57 Lu LC_H460, Lu_SC_H69, T23724 MB-MDA-435s 117399 Hs.43805 lipoma HMGIC 2.57 HMEC, HMEC (total RNA), N26480 fusion parfier like EB_cells 129279 Hs.184860 ESTs; Weakly 2.57 HS578T_cells, EB_cells, AA460551similar to EG:87B1.6 HT29_cells [D.mel 119817 Hs.159690 ESTs 2.57 HMEC, HMEC (total RNA), W74257 Lu_SC_H69 114445 Hs.250493 ESTs; Weakly 2.56 HMEC, HT29_cells, Lu LC_H460 AA019594similar to KIAA0390 [H.sapi 120651 Hs.99657 ESTs 2.55 HMEC, HMEC (total RNA), AA287286 Fibroblasts 2 105707 Hs.37617 ESTs; Weakly 2.55 HMEC (total RNA), EB_cells, AA291012similarto KIAA0727 protein BT474_cells 128483 Hs.5148 FLN29 gene product2.54 HMEC, HS578T_cells, MB231_cells 125890 Hs.116708 ESTs; Weakly 2.54 HMEC (total RNA), AA448739s!m!larto HYPOTHETICAL HMEC, OVCAR_cells PRO

134764 M74715 Hs.89560 iduronidase;2.54 BT474_cells, PRSC con, alpha-L- HT29_cells 113404 T82323 Hs.70337 immunoglobulin2.54 Caco2, HS578T_cells, superfamily; member 4 HMEC

129128 AA423854 Hs.108812 ESTs 2.54 BT474_cells, MB-MDA-035s, HMEC

101428 M19684 Hs.184929 protease2.54 HMEC, HT29_cells, HMEC
inhibitor 1 (alpha-1-antitrypsl (total RNA) 103206 X72755 Hs.77367 monokine 2.53 Flbroblasts 2, MB231 induced by gamma interferon cells, HMEC (total RNA) 132273 AA489716 Ns.43658 DKFZP586L1512.53 EB_cells, HMEC, HMEC
protein (total RNA) 108392 AA075124 zm86a1.s1 Stratagene ovarian cancer (#93 IMAGE:544776 3', mRNA seq 2.52 HMEC (total RNA), HMEC, HS578T_cells 119508 W37895 Hs.45519 ESTs 2.52 Lu_SC_H69, CALU6_cells, 293TCells 109828 F13763 Hs.19827 ESTs 2.52 PRSC_log, PRSC_con, HS578T_cells 135096 N89775 Hs.132390 zinc 2.51 HMEC, HS578T_cells, finger protein 36 (KOX 18) HT29-cells 130860 U66061 Hs.241395 protease;2.51 OVCAR_cells, MB231_cells, serine;1 (trypsin 1) PC3_cells 105725 AA292228 Hs.199791 STAT 2.51 HS578T_cells, HT29_cells, induced STAT inhibitor 3 HMEC

110427 H48579 Hs.36275 EST 2.51 HS578T_cells, Caco2, Lu LC_H460 123762 AA610013 Hs.244553 EST 2.51 HMEC (total RNA), HMEC, Fibroblasts 2 126406 AA034096 zi06f05.r1 Soares fetal_liver_spleen_1NF

IMAGE:430017 5', mRNA seq. 2.5 Lu_AD_H23, HS578T_cells, Lu-AD_358 129751 AA346065 Hs.111286 KlAA07142.5 HMEC, HS578T_cells, protein Fibroblasts 2 121704 AA418743 Hs.98306 ESTs 2.5 EB_cells, HMEC (total RNA), HMEC

112595 877783 Hs.22404 protease;2.5 Fibroblasts 2, EB_cells, serine;12 (neurotrypsin; moto PRSC_con 108499 AA083103 zn1 b12.s1 Stratagene hNT neuron (#937233 IMAGE:5477 3', mRNA seq 2.5 LNCaP-cells, MB-MDA-453, HMEC

131968 AA151333 Hs.36029 ESTs; 2.5 Fibroblasts 2, A549_cells, Highly similar to basic helix-loop 293T_cells 112665 885661 Hs.221447 ESTs 2.48 Lu_AD_H23, HMEC, Lu_LC-H460 115764 AA421562 Hs.91011 anterior2.48 EB cells, Caco2, MCF7 gradient 2 (Xenepus laevis) hom 105959 AA405540 Hs.7001 ESTs 2.48 OVCAR_cells, BT474_cells, Caco2 125804 879519 Hs.16899 ESTs 2.48 HMEC (total RNA), EB_cells, HMEC

110102 H16681 Hs.180950 guanine 2.46 HS578T_cells, HMEC, nucleotide binding protein (G OVCAR cells pr 104680 AA009809 Hs.37599 ESTs 2.46 HMEC, HS578T_cells, Caco2 132339 D80030 Hs.45127 chondroitin2.45 OVCAR._cells, 293TCells, sulfate proteoglycan 5 (neur HMEC (total RNA) 121712 AA419116 Hs.193663 ESTs; 2.45 Lu_S(~H520, Lu_AD_H23, Weakly similarto !!!! ALU SUBFAMI Lu_SC_H69 129226 M96843 Hs.180919 inhibitor2.44 MB-MDA~453, 293TCells, of DNA binding 2; dominant neg Caco2 128731 AF005271 Hs.104555 neuropeptide2.43 HMEC, HMEC (total RNA), FF-amide peptide precursor EB_cells 106670 AA461174 Hs.5943 ESTs 2.43 EB_cells, HS578T_cells, Lu_SC 1169 119306 T26914 Hs.132785 EAP30 2.43 EB_cells, HMEC (total subunit of ELL complex RNA), HMEC

133507 X74295 Hs.74369 integrin;2.42 Fibroblasts 2, Caco2, alpha 7 EB_cells 125713 AA367905 Hs.77356 transfemn2.41 HS578T_cells, Fibroblasts receptor (p90; CD71) 2, Lu_AD_H23 107438 W27841 Hs.17118 ESTs; 2.41 HMEC, HS578T_cells, Weakly similarto 80025.2 [C.elega MB231_cells 101784 M83186 Hs.114346 cytochrome2.41 Fibroblasts 2, PRSC
c oxidase subunit Vlla polype con, PRSC-log 134578 AA194724 Hs.182418 endonuclease2.4 EB_cells, HMEC, Lu-AD
G . 1123 125105 T95642 Hs.189759 ESTs 2.4 EB_cells, A549_cells, HS578T_cells 127087 AA380418 Hs.88012 SHP2 2.4 HMEC, HMEC (total RNA), interacting transmembrane adaptor EB_cells 113118 T47906 Hs.220512 ESTs 2.39 MB-MDA-435s, HS578T_cells, HMEC

104791 AA029046 Hs.30377 ESTs; 2.39 LNCaP_cells, OVCAR_cells, Moderately similarto CAMP inducib PC3_cells 115833 AA428269 Hs.125035 ESTs 2.38 Caco2, LNCaP_cells, CALU6-cells 132223 877451 Hs.4245 ESTs; Weakly2.38 HMEC, HMEC (total RNA), similar to similar to S. ce EB_cells 115836 AA428863 Hs.89388 ESTs 2.38 HS578T_cells, HMEC, PRSC_con 101891 S45630 Hs.1940 crystallin;2.38 HS578T_cells, OVCAR_cells, alpha B Lu_LC-H460 132894 D82422 Hs.5944 ESTs 2.37 Caco2, MB-MDA-453, HT29_cells 106939 AA496048 Hs.26570 ESTs 2.35 LNCaP_cells, 293TCells, EB_cells 131104 W27770 Hs.258721 ESTs 2.35 HMEC (total RNA), HMEC, HT29_cells 122355 AA443789 H5.189324 ESTs 2.34 HMEC (total RNA), HMEC, EB_cells 119343 T62873 yc3d2.s1 Stratagene lung (#93721) H sapi to contains Alu repetitive element;,2.34 HS578T_cells, Lu_SC-H69, mR HT29_cells 115442 AA284722 Hs.89121 H sapiens2.33 Lu-AD_H23, HMEC (total mRNA; chromosome 1 specific RNA), BT474 cells tr 134286 T69384 Hs.68398 period 2.33 HMEC, HMEC (total RNA), (Drosophila) homolog 1 MB231 cells 125465 AI375276 Hs.158732 ESTs 2.33 HMEC (total RNA), EB_cells, HMEC

127449 AI421866 Hs.75722 ribophorin2.33 Lu_AD_H23, HMEC (total II RNA), HMEC

110225 H23927 Hs.222381 ESTs 2.33 HS578T_cells, HMEC, Lu_LC_H460 119930 W86471 Hs.151624 hypocreGn2.32 HMEC, HMEC (total RNA), (orexin) receptor 2 EB_cells 125958 A1073357 Hs.12311 H sapiens2.32 MB231 cells, HMEC (total clone 23570 mRNA seq RNA), HMEC

119746 W70279 Hs.221189 ESTs; 2.32 HMEC, HS578T_cells, Weakly similar to 15-HYDROXYPROSTA MB231 cells 108874 AA134112 Hs.107187 H Sapiens DNA seq from cosmid ICK0721Q
o L12 LIKE protein in an intron 2.32 Caco2, PRSC_con, LNCaP_cells of the HS

127368 AA434362 Hs.193326 ESTs 2.32 HMEC (total RNA), HS578T_cells, HMEC

120437 AA243427 Hs.104311 ESTs 2.32 HMEC (total RNA), HMEC, MB-MDA-435s 119867 W80852 Hs.250696 KDEL 2.32 Fibroblasts 2, HS578T_cells, (Lys-Asp-Glu-Leu) endoplasmic MB-MDA-435s relic 131205 J02947 Hs.2420 superoxide2,32 PRSC-con, EB-cells, dismutase 3; extracellular Lu~4D_358 133710 X76057 Hs.75694 mannose 2.31 293TCells, LNCaP_cells, phosphate isomerase RPWE 2 104834 AA039331 Hs.16323 ESTs; 2.31 Caco2, HS578T_cells, Weakly similar to GAGE-7 [H.sapien HMEC
g 113186 T56048 Hs.189674 ESTs 2.31 HMEC, Fibroblasts 2, HMEC (total RNA) 113462 T86826 Hs.142528 ESTs 2.31 PC3_cells, HS578T_cells, HMEC

104743 AA021157 Hs.33619 ESTs 2.3 HMEC (total RNA), HMEC, OVCAR_cells 129667 Y00097 Hs.118796 annexin 2.3 PRSC_log, PRSC_con, A6 HS578T_cells 111573 810305 Hs.185683 ESTs 2.3 HMEC, HMEC (total RNA), EB cells 117523 N32626 Hs.145532 ESTs; 2.29 EB_cells, Fibroblasts Weakly similar to Gag polyprotein 2, HS578T_cells 115540 2.29 Fibroblasts 2, BT474_celis, AA349954 MB231_cells Hs,56281 ESTs;
Weakly similar to ASB-1 protein [H

101622 Hs.151513 mannosyl (alpha-1;3-)-glycoprotein2.29 PRSC_con, RPWE_2, PRSC
M55621 beta- log 103535 Hs.122607 B-cell CLLllymphoma2.28 Lu_SC_H69, Lu~4D_358, Y13620 9 Lu~D-H23 127482 Hs.155014 ESTs 2.28 HS578T_cells, 293TCells, AI337294 CALU6_cells 104297 Hs.106005 ESTs; Highly 2.27 EB_cells, DU145_celis, D31111 similar to NY-REN50 HT29_cells antige 112318 Hs.11067 ESTs 2.27 MB-MDA-453, LNCaP_cells, 855470 OVCAR-cells 101877 Hs.778 guanylate cyclase2.27 HT29_cells, BT474 cells, M97496 activator 1 B (retina) Caco2 100760 Major Histocompatibility2.26 MB-MDA-435s, MB231 cells, HG3576 Complex, Class BT474_celis 102362 Hs.75932 N-ethy!maleimide-sensitive2.26 LNCaP_cells, MB-MDA-453, U39412 factor attach Caco2 106142 Hs.239631 Golgi transport2.26 HMEC, HS578TCells, Caco2 AA424590complex protein (90 kDa) 101461 Hs.76422 phospholipase 2.26 LNCaPCells, BT474 cells, M22430 A2; group IIA (platelets; Caco2 119336 Hs.208238 ESTs 2.26 HS578T_cells, EB_cells, 127619 Hs.163787 ESTs 2.25 Lu_S(~H520, Lu_LC-H460, AA627122 Lu_SC_H69 104113 Hs.181202 ESTs; Weakly 2.25 MB-MDA~435s, Fibroblasts AA427510similar to Wiscott-Alddch 2, HMEC (total RNA) 131219 Hs.24395 small inducible2.25 Lu_S(~H520, BT474_cells, C00476 cytokine subfamily B Fibroblasts 2 (Cy 118915 Hs.54713 ESTs 2.25 HMEC (total RNA), HMEC, 127556 Hs.190228 ESTs 2.24 HS578T_cells, EB cells, 128700 Hs.103982 small inducible2.24 HMEC, HS578T_cells, Fibroblasts U59286 cytok!ne subfamily B 2 (Cy 113674 Hs.5753 !nositol(myo)-1(or4)-monophosphatase22,24 A549_cells, DU145_cells, T96374 Lu-AD-358 133085 Hs.646 carboxypeptidase 2.24 HS578T_cells, Fibroblasts M73720 A3 (mast cell) 2, HT29cells 106017 Hs.26268 ESTs 2.24 MB-MDA-053, OVCAR_cells, AA411882 293T_celis 100582 Peptide Yy 2.24 HMEC, HS578TCells, HMEC
HG2348 (total RNA) 134811 Hs.89761 ATP synthase; 2.23 Lu-S(~H520, LNCaP_cells, N66357 H+transporting; mitochond Lu~D-H23 102543 Hs.234776 oculocerebrorenal2.23 293T_cells, EB_cells, U57627 syndrome of Lowe LNCaP_celis 127357 zx39g11.r1 Soares_total_fetus-Nb2HF8_9w IMAGE:788900 5', mRNA 2.23 HS578T-cells, RPWE 2, seq. HMEC (total RNA) 135288 Hs.97876 ESTs 2.23 HS578T_cells, 293T_cells, AA402930 OVCAR_cells 105581 Hs.28891 ESTs; Weakly 2.23 BT474_cells, BT474_cells, AA278850similar to 1!!! ALU MB231 cells SUBFAMI

103812 Hs.124094 ESTs; Weakly 2.23 Lu SC_H345, Lu_AD_H23, AA137107similar to NFAT1-A [M.muscu PRSC-con 117016 Hs.52170 ESTs 2.22 Fibroblasts 2, Lu_LC-H460, H87171 HMEC (total RNA) 114607 Hs.129057 breast carcinoma2.22 BT474-cells, HT29_cehs, AA079342amplified seq 1 HT29 cells 134000 Hs.7833 selenium binding2.22 LNCaP_cells, MB-MDA-453, U29091 prote!n 1 BT474_cells 111069 Hs.22036 ESTs 2.22 HMEC, Lu_SC_H345, HS578T_cells 129048 Hs.108287 intercellular 2.21 Lu-AD_H23, HS578T-cells, L27670 adhesion molecule 4; Lu_S(~H520 Lands 124995 Hs.110044 ESTs 2.2 Caco2, MB-MDA-453, HT29_cells 116678 Hs.251736 ESTs 2.2 HS578T_cells, BT474_cells, F05063 293T_cells 118222 Hs.48501 EST 2.2 HS578T_cells, BT474 cells, N62263 MB231_cells 127888 Hs.143590 ESTs 2.19 BT474_cells, CALU6_cells, AI149662 MB231 cells 113790 Hs.26912 ESTs 2.19 HMEC, HMEC (total RNA), W33178 Fibroblasts 2 100097 H Sapiens Angelman Syndrome AF002224Gene, E6-AP

from promoter P1, 5'UTR 2.19 HS578T_cells, CALU6_cells, 293T cells 109151 Hs.73452 ESTs 2.19 CALU6_cells, Lu_AD_H23, AA176800 Lu_SC-H69 135368 Hs.9964 ribosomal prote!n;2.19 OVCAR_ce!is, A549_cells, AA086057mitochondrial; 812 Lu_AD-H23 109016 Hs.58069 ESTs; Highly 2.19 HS578T_cells, BT474 cells, AA156936similar to type II CAMP-dep A549-cells 124300 Hs.105959 ESTs; Weakly 2.18 Lu~D 358, Lu SC_H69, H92575 similar to !!!! ALU Lu_SC-H345 SUBFAMI

123450 Hs.111207 ESTs 2.18 HMEC (total RNA), HMEC, AA598913 MB-MDA-435s 117435 yw50b08.s1 Weizmann Olfactory2.18 LNCaP_cells, DU145_cells, N27628 Epithelium Lu_SC~H520 119860 Hs.58485 ESTs 2.18 HS578T_cells, MB231 cells, W80709 Caco2 123833 Hs.112889 ESTs 2.18 Lu_AD_H23, Lu_SGLH520, AA620717 Lu~D 358 107938 Hs.53115 ESTs 2.17 Caco2, 293TCells, 293TCells 119380 Hs.184407 ESTs 2.16 Lu-AD H23, Lu-AD_358, T83659 PRSC_con 114066 Hs.26920 ESTs 2,15 HMEC (total RNA), HMEC, 238152 EB-cells 128748 Hs.10475 ESTs 2.15 HMEC, HT29 cells, MB231 T59001 cells 130414 Hs.241392 small inducible2.15 HS578T_cells, PC3_cells, M21121 cytokine A5 (RANTES) A549_cells 123490 TAP binding protein (tapasin)2.15 HS578TCells, EB-cells, AA599723 Lu SC 1-169 112588 Hs.20226 ESTs 2.14 HMEC (total RNA), HMEC, 877302 Fibroblasts 2 110548 Hs.14706 ESTs 2.14 HMEC, HMEC (total RNA), H58715 HT29_cells 101581 Hs.198253 major histocompatibility2.14 MB-MDA-435s, HMEC, HMEC
M34996 complex; class 115248 Hs.194530 ESTs; Weakly 2.14 HT29_cells, BT474 cells, AA278887similarto unknown [H.sapie CALU6_cells 105619 Hs.24003 ESTs; Moderately2.14 Lu_S4H520, MB-MDA-435s, AA280810similar to LEYDIG CELL LNCaP_cells 128058 Hs.132449 ESTs 2.14 HS578T_cells, EB_cells, AI126617 HMEC (total RNA) 134573 Hs.171873 ESTs; Weakly EB_cells, MB231cells, AA442125similarto PUTATIVE STEROID2.14 Caco2 134863 Hs.183373 ATX1 (antioxidant2.14 Lu_SC_H345, HT29_cells, AA353903protein 1; yeast) homo BT474 cells 128811 Hs.169100 ESTs; Weakly 2.13 Caco2, Lu_SC H345, EB_cells H17317 similar to HPBRII-7 protein 112368 Hs,26653 EST 2.13 HMEC, HMEC (total RNA), 859371 Lu S(~H520 108395 zm86f6.s1 Stratagene AA075144ovarian cancer (#93 gb:X1664 TRANSLATIONALLY 2.13 HMEG (total RNA), CONTROLLED TUM HMEC, OVCAR_~Ils 129611 Hs.11614 ESTs 2.13 HMEC, HS578T_cells, Caco2 101253 Hs.99931 sarcoglycan; 2.12 HS578T_cells, OVCAR_cells, L34355 alpha (50kD dystrophin-asso CALU6_cells 126701 Hs.202590 ESTs; Weakly 2.12 EB_cells, Lu~ID_H23, AA515212similarto mucin glycoprote Lu~D_H23 111628 Hs.4014 KIAA0946 protein;2.12 A549_ce!Is, BT474 cells, 815825 Huntingtin interac8ng MB-MDA-435s 108675 Hs.61816 ESTs 2.12 Lu_AD_H23, MB-MDA-453, AA115240 PRSC_con 127131 Hs.105460 DKFZP56400823 2.12 EB_cells, Lu SC_H69, 244658 protein Lu_SC_H69 109590 Hs.27281 ESTs 2.12 HMEC, HS578T_celis, HMEC
F02465 (total RNA) 116539 Hs.242890 EST 2.12 Lu_AD_H23, Caco2, BT474 D12124 cells 112117 Hs.23789 ESTs 2.12 EB_cells, Lu-AD_H23, 845402 Lu_SCLH520 126367 AA477929 Hs.25584 ESTs 2.12 Lu SC H69, Lu~4D_H23, Lu_AD-358 135252 062966 Hs.97207 solute 2.11 MB-MDA-035s, 293Tcells, camerfamily 28 (sodium-coupled CALU6_cells 117565 N34301 Hs.248426 EST 2.11 HMEC, HS578T_cells, MB231 cells 129430 AA258842 Hs.197877 H 2.11 HS578T_cells, Lu~4D_358, Sapiens clone 23777 putative MB-MDA-035s transmemb 120256 AA169801 sema domain; 2.11 HMEC, HMEC (total RNA), immunoglobulin domain (Ig); EB-cells 134169 D20342 Hs.178137 transducer2.11 HMEC (total RNA), 293T_cells, of ERBB2;1 (TOB1) OVCAR_cells 130397 AA487452 Hs.155344 DNA 2.11 293T_cells, Caco2, Lu~D_H23 fragmentation factor, 45 kD;
alpha s 132859 D20925 Hs.5842 ESTs 2,11 HMEC (total RNA), Fibroblasts 2, HMEC

117633 N36404 Hs.44807 ESTs 2.11 HMEC, Caco2, HS578T_cells 125003 T59442 Hs.100445 ESTs 2.11 MB-MDA~t35s, HMEC (total RNA), HT29_cells 125329 AA825437 Hs.58875 ESTs 2.11 HS578T_cells, PRSC_con, PRSC_log 114065 238149 Hs.134015 uronyl2-sulfotransferase2.11 MB-MDA~t35s, 293T_cells, PRSC_con 120718 AA292747 Hs.97296 ESTs 2.11 HT29_cells, Lu-AD H23, Lu_SC H69 133869 T49444 Hs.77031 Sp2 transcription2.1 Lu LC H460, Lu~D 358, factor RPWE 2 135351 AA430179 Hs.9933 putative2.1 HS578T_cells, EB_cells, Ao-like transposon HMEC

110973 N51529 Hs.118047 ESTs 2.09 EB_cells, HS578T_cells, 131879 AA017161 Hs.33792 ESTs 2.09 HMEC (total RNA), MB231 cells, BT474 cells 116656 F03935 Hs.241640 EST 2.09 HS578T_cells, Lu_LC_H460, Lu_SC_H69 120311 AA194074 Hs.193401 ESTs 2.09 OVCAR_cells, HMEC (total RNA), HMEC

108024 AA040433 Hs.61898 DKFZP586N21242.09 HMEC (total RNA), BT474 protein cells, HT29 cells 105871 AA399633 Hs.24872 ESTs 2.09 Fibroblasts 2, A549-cells, HS578T_cells 120206 240805 Hs.91668 ESTs 2.09 BT474_cells, MB-MDA-453, EB_cells 112333 856222 Hs.26514 ESTs 2.09 Lu-AD H23, Fibroblasts 2, Lu_LC_H460 116746 H04811 Hs.79027 ESTs 2.08 MB-MDA-435s, HMEC (total RNA), Lu-SC-H345 121529 AA412257 Hs.98121 ESTs 2.08 HMEC, HMEC (total RNA), HS578T_cells 105592 AA279337 Hs.180549 ESTs;2.08 LNCaP cells, PRSC_log, Highly similarto 826660_1; PRSC_log partia 108582 AA088231 Hs.91732 ESTs 2.08 HS578T_cells, Lu SC
H345, Lu SC H69 123197 AA489250 Hs.59403 serine2.08 EB_cells, Lu_SC_H69, palmitoyltransferase; subunit Lu-SC-H345 II

134965 J05480 Hs.92 protein 2.08 LNCaP_cells, MB-MDA-035s, phosphatase 3 (formerly 2B); HMEC
cat 123856 AA620814 Hs.144959 ESTs 2.08 HS578T_cells, BT474_cells, BT474_cells 132058 AA251737 Hs.172818 Apg122.07 HS578T_cells, MCF7, (autophagy 12; S. cerevisiae)-like HMEC

126476 894666 Hs.195155 ESTs; 2.07 PRSC_log, Lu-LC-H460, Weakly similar to transporter RPWE 2 prot 106087 AA418740 Hs.21111 ESTs 2.07 OVCAR_cells, A549 cells, Lu~4D_H23 103802 AA122003 Hs.62954 ferri6n;2.07 HMEC, HMEC (total RNA), heavy polypeptide 1 HS578T_cells 125633 AA908225 Hs.126841 ESTs 2.07 EB_cells, Fibroblasts 2, Lu_SC_H69 112817 898491 Hs.14584 ESTs 2.07 HMEC, HMEC (total RNA), Fibroblasts 2 111050 N56984 Hs.74335 heat 2.07 LNCaP_cells, DU145-cells, shock 90kD protein 1; beta 293T-cells 133072 AA425294 Hs.64322 ESTs; 2.07 LNCaP_cells, MB-MDA-453, Weakly similar to Closely related Caco2 118270 N62868 Hs.48653 ESTs 2.07 HMEC (total RNA), HMEC, EB_cells 105035 AA128486 Hs.8859 ESTs 2.07 LNCaP_cells, PC3_cells, EB-cells 102337 036922 Human fork head 293T_cells, HMEC, HT29_cells domain protein (FKHR) mR 2.07 109687 F09380 Hs.182859 lifeguard2.06 BT474_cells, BT474_cells, Lu_AD-H23 109802 F10789 Hs.12439 ESTs 2.06 EB_cells, EB cells, Caco2 128103 AA905960 Hs.48516 ESTs 2.06 HT29-cells, HMEC (total RNA), HMEC

128278 A1018343 Hs.131275 ESTs 2.06 PRSC_con, Lu_SC H345, HS578T_cells 131873 H39997 Hs.33716 ESTs 2.06 HMEC (total RNA), HMEC, EB_cells 122683 AA455528 Hs.96772 ESTs 2.05 LNCaP_cells, Lu_AD-H23, HS578T_cells 128066 AA884838 Hs.189171 ESTs 2.05 HMEC, HMEC (total RNA), Fibroblasts 2 131451 N28028 Hs.26968 H Sapiens MB-MDA-435s, Lu LC H460, mRNA from chromosome 5q21-22; Lu_S(~H520 2.05 120887 AA365644 Hs.97043 ESTs 2.05 HS578T_cells, PRSC_can, HMEC

103966 AA303166 Hs.127270 ESTs 2.05 HMEC (total RNA), LNCaP_cells, PC3_cells 105861 AA399260 Hs.28454 ESTs 2.05 Fibroblasts 2, HMEC
(total RNA), EB_cells 104627 AA001976 Hs.19603 ESTs 2.05 HS578T_cells, HMEC, BT474_cells ' 108794 AA129468 Hs.203392 ESTs 2.04 HS578T_cells, HMEC, A549_cells 111896 838936 Hs.24894 H sapiens2,04 HS578T_cells, PC3_cells, clone 25248 mRNA seq 293TCells 101849 M94167 Hs.172816 neuregulin2.04 HMEC, HS578T_cells, 1 HMEC (total RNA) 119913 W85931 Hs.58785 ESTs 2.04 HMEC, BT474_cells, MB231 cells 130785 AA242826 Hs.19405 caspase2.04 HMEC, HS578T_cells, recruitment domain 4 BT474_cells 124702 806984 Hs.7745 ESTs; 2.03 Fibroblasts 2, PRSC_con, Weakly similarto TESTIS-SPECIFIC HMEC

106769 AA478001 Hs.225935 diacylglycerol2.03 PC3_cells, EB cells, 0-acyltransferase (mouse) HS578T_cells 132219 N48682 Hs.172971 ESTs 2.03 HT29_cells, PC3_cells, A549 cells 122033 AA431334 Hs.109297 ESTs 2.03 OVCAR_cells, A549_cells, Caco2 120461 AA251301 zs10b02.s1 NCI_CGAP_GCB1 H sapiens cDNA

contains Alu repetitive element;,2.03 HS578T_cells, EB_cells, mRNA EB_cells 134959 090550 Hs.91813 butyrophilin;2.03 HMEC, Fibroblasts 2, subfamily 2; memberA2 EB_cells 104909 AA055892 Hs.14543 ESTs 2.03 Lu-SC-H345, PC3_cells, DU145_cells 101950 S79219 Hs.80741 propionyl2.03 Lu_SC_H69, EB cells, Coenryme A carboxylase; alpha CALU6_cells 133878 D78947 Hs.7718 ESTs; 2.02 EB-cells, MCF7, MB231 Weakly similar to weak similarity cells 103459 X99894 Hs.32938 insulin 2.02 EB_cells, Lu-AD H23, promoter factor 1; homeodomain Lu~D_358 t 125507 AI436377 Hs.258590 tetraspanin2.02 A549_cells, Lu_SG~H520, TM4-B Lu_AD_H23 116657 F04014 Hs.65996 ESTs 2.01 HS578T_cells, HMEC, MB231 cells 112920 T10234 Hs.4275 ESTs 2.01 HS578T-cells, EB-cells, PRSC_con 105533 AA258572 Hs.6418 ESTs; 2.01 HS578T_cells, HMEC, Moderately similar to seven EB_cells transm 126762 AA064671 zm13b04.r1 SUatagene pancreas (#937208) similar to TR:G413842 6413842 2.01 RPWE_2, Lu_AD_H23, NONCLASSI Lu_AD_358 128999 837808 Hs.107765 ESTs 2.01 HS578T_cells, OVCAR_cells, EB_cells 133902 AA114858 Hs.7745 ESTs; Weakly similar to TESTIS-SPECIFIC 2 Fibroblasts 2, PRSC_con, DU145_cells Table 2 Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit-ID Complete_Title Ratio MetsIBS Top 3 expressing cell lines 101447 M21305 Hs.247946 Human 110.98EB_cells, Fibroblasts alpha satellite and satellite 2, A549_cells 3 ju 105039 AA130349 Hs.36475 ESTs 9.13 EB_cells, OVCAR_cells, Lu SC_H345 106094 AA419461 Hs.18127 ESTs 8.51 HT29_cells, MB-MDA-053, HS578T_celis 105777 AA348412 Hs.23096 ESTs 8.4 293T_cells, OVCAR_cells, EB-cells 129818 N54841 Hs.172572 ESTs 7.2 Lu SC H69, EB-cells, Lu_SC_H345 118475 N66845 Hs.165411 ESTs; 7 DU145_cells, EB cells, Weakly s!milar to !!!! ALU CLASS Caco2 B

112170 848744 Hs.192878 ESTs 6.91 293T_cells, DU145_cells, HT29_cells 114918 AA236813 Hs.72324 ESTs; 6.6 EB_cells, 293T_cells, Highly similarto unknown [H.sapie DU145_cells 104590 879750 Hs.83623 nuclear 6.58 293T_cells, OVCAR_cells, receptor subfamily 1; group I; HMEC
m 120625 AA285053 Hs.107168 ESTs 6.55 CALU6_cells, OVCAR_cells, EB_cells 115650 AA404564 Hs.47094 ESTs 6.43 EB_cells, LNCaP_cells, Lu_SC_H345 124568 N67086 Hs.102000 ESTs 6.35 PC3_cells, A549 cells, DU145_cells 134238 881509 Hs.184571 splicing 6.32 293T_cells, Lu SC-H345, factor, argininelserine-rich HMEC

114721 AA131450 Hs.103822 ESTs 6.13 Caco2, MB-MDA-435s, PRSC-log 106145 AA424791 Hs.5734 KIAA0679 6 OVCAR_cells, EB ceNs, protein 293T_cells 114610 AA081079 zn32h9.s1 Stratagene endothelial cell 93 IMAGE:549185 3', mRNA seq 5.97 PRSC_con, DU145_cells, HS578T_cells 130281 812777 Hs.15395 ESTs; Weakly 5.94 PRSC con, HT29_cells, similar to ARGINYL-TRNA SYN EB_cells 124690 805818 Hs.173830 ESTs 5.92 LNCaP_cells, EB cells, OVCAR_cells 113490 T88700 Hs.173374 ESTs 5.81 DU145_cells, PC3_cells, HMEC (total RNA) 104425 H88496 Hs.40583 ESTs 5.77 OVCAR-cells, HS578T_cells, A549 cells 118828 N79496 Hs.50824 EST 5.45 LNCaP_cells, OVCAR_cells, DU145_cells 129076 AA262179 Hs.169343 ESTs 5.35 293T_cells, BT474 cells, 109684 F09317 Hs.140885 ESTs; 5.34 Fibroblasts 2, Lu-SC_H69, Weakly similar to LINE-1 REVERSE DU145_cells T

104558 856678 Hs.88959 Human DNA
seq from clone 967N21 on chr part of KIAA0172; the gene for 5.32 EB_cells, PC3-cells, a novel Lu SC H345 109032 AA158234 Hs.72222 ESTs 5.23 HT29_cells, PC3_cells, Lu_AD 358 129350 050535 Hs.110630 Human 5.2 293T_cells, EB cells, BRCA2 region; mRNA seq CG006 DU145-cells 112662 885436 Hs.193150 ESTs 5.2 MB-MDA-435s, PRSC_con, MB-MDA~53 132902 AA490969 Hs.168147 ESTs 5.18 PC3-cells, LNCaP_cells, CALU6_cells 126872 AA136653 ESTs 5.04 EB_cells, Fibroblasts 2, A549-cells 122528 AA449804 Hs.250992 EST 5.04 Lu_SC H345, PRSC con, LNCaP-cells 102193 020758 Hs.313 secreted 5.02 Lu LC_H460, A549_cells, phosphoprotein 1 (osteoponGn; MB-MDA-435s 121332 AA404384 Hs.97921 ESTs 5.01 EB_cells, Lu SC-H69, DU145_cells 135357 AA235803 Hs.79572 cathepsin4.96 EB_cells, MCF7, DU145-cells D (lysosomal aspartyl protease 109141 AA176428 Hs.193380 ESTs 4.86 DU145_cells, PC3-cells, PRSC_log 135324 AA082041 Hs.9873 ESTs 4.83 EB_cells, Lu SC H345, HS578T_cells 124875 870506 Hs.207693 ESTs; 4.75 DU145_cells, OVCAR_celis, Weakly similar to 11!! ALU SUBFAMI LNCaP_celis 102380 040434 Hs.155981 mesothelin4.71 OVCAR cells, Lu.~4D_H23, 127956 AA826117 Hs.194013 ESTs 4.69 EB_cells, HS578T_celis, DU145_cells 125038 T78089 Hs.168887 ESTs 4.58 OVCAR cells, 293T_cells, DU145_cells 102515 052696 Humn adrenal Creb-rp4.57 Lu SC H345, Lu_SC-H69, hmlg (Creb-rp), com HT29_cells 109027 AA157818 Hs.238380 Human 4.57 PC3_cells, EB cells, endogenous retroviral protease Lu_S(~H520 mRN

115096 AA255991 Hs.175319 ESTs 4.57 OVCAR cells, 293T_cells, PC3 cells 123470 AA599106 Hs.194208 ESTs 4.55 LNCaP_cells, Lu_SC_H69, ~ 293T_cells 113219 T59257 Hs.194407 ESTs 4.55 A549_cells, 293T_cells, 293T_cells 123433 AA598661 Hs.112478 ESTs 4.55 EB_cells, OVCAR_~Ils, HT29_cells 135182 M28170 Hs.96023 CD19 antigen4.53 OVCAR_cells, DU145_cells, EB-cells 121721 AA419470 Hs.199961 ESTs 4.51 DU145-cells, LNCaP_cells, EB_cells 129126 H88486 Hs.108806 ESTs 4.45 LNCaP_cells, Caco2, EB cells 135232 AA342457 Hs.96800 ESTs; 4.43 LNCaP_cells, DU145_cells, Moderately similar to !!!! ALU OVCAR_cells SUB

124847 860044 Hs.106706 ESTs; 4.42 OVCAR_cells, CALU6_cells, Highly similar to BETA-CATENIN CALU6_cells [H.

110349 H40988 ESTs; Weakly similar4.39 DU145_cells, OVCAR-cells, to !1!! ALU SUBFAMI LNCaP cells 134402 025165 Hs.82712 frag!le 4.38 HS578T_cells, OVCAR_cells, X mental retardation; autosomal DU145_cells 115494 AA290603 Hs.256517 ESTs 4.36 Lu_SC h1345, OVCAR-cells, PC3_cells 119174 871234 yi54c08.s1 Soares placenta Nb2HP H sapie transcript, (rRNA); gb:S41458 ROD CGMP-BETA-SUBUNIT (HUMAN);conta!n 4.33 DU145_cells, OVCAR_cells, LNCaP_cells 121943 AA429265 Hs.126759 ESTs 4.3 EB_cells, HT29_cells, Lu SC_H69 110856 N33063 Hs.23291 ESTs; Weakly4.28 OVCAR...cells, EB_cells, s!milar to S164 [H.sapiens] Lu SC 1169 102474 049973 Human Tiggerl transposable4.28 DU145_cells, LNCaP_cells, element, comp OVCAR_cells 123458 AA598963 Hs.112499 KIAA06124.27 A549_cells, A549_cells, protein BT474_cells 116459 AA621399 Hs.64193 ESTs 4.22 Caco2, HS578T_cells, MB-MDA-435s 126301 N62371 Hs.100043 ESTs; 4.22 PC3_cells, DU145_cells, Weakly s!milar to Similar to Lu SC_H345 cutic 123461 AA598990 Hs.251119 EST 4.22 Lu_SC_H345, Lu_SC_H69, OVCAR_cells 130588 AA287735 Hs.16411 Human DNA seq from clone 1189824 on chro MLRQ subunit (EC 1.6.5.3; EC
1.6.99.3;

Tyrosine-protein Kinase FER (EC 4.2 EB_cells, LNCaP_cells, 2.7.1.1 MCF7 125756 W25498 Hs.81634 ATP synthase;4.2 HMEC, EB cells, DU145 H+transporfing; mitochond cells 135009 AA040507 Hs.251865 ESTs 4.19 293T_celis, EB_cells, DU145_cells 107001 AA598589 Hs.24492 ESTs 4.18 293T_cells, DU145_cells, EB cells 124896 882063 Hs.101594 EST 4.16 OVCAf~cells, Lu_SC H345, HMEC (total RNA) 119404 T92950 ye27c10.s1 Stratagene4.15 DU145_cells, PC3_cells, lung (#937210) H s Fibroblasts 2 125090 T91518 ye20f05.s1 Stratagene lung (#937210) H s contains Alu repetitive element;contain4.14 LNCaP_cells, DU145_cells, OVCAR_cells 117348 N24157 Hs.139615 ESTs 4.1 Lu_SC H345, Lu_SC_H69, PRSC_log 111389 N95837 Hs.169111 ESTs; 4.1 DU145_cells, MCF7, LNCaP_cells Weakly s!milarto L82A [D.melanoga 134977 AA464698 Hs.19390 ESTs; 4.09 OVCAR_celis, Fibroblasts Weakly similar to bullous pemph!go 2, Lu_SC_H69 124696 806273 Hs.186467 ESTs; 4.09 OVCAR_cells, Lu SC H345, Moderately similar to !!!! ALU PRSC con SUB

124090 H09570 Hs.143032 ESTs; 3.98 DU145_cells, OVCAR_cells, Weakly similar to neuronal thread Lu_SC H345 133992 846354 Hs.169832 zinc 3.98 HT29_cells, MB231 cells, finger protein 42 (myelo!d-specific BT474 cells 126009 H51652 Hs.242985 hemoglobin;3.96 Lu_SC H69, OVCAR_cells, gamma G EB_cells 114161 238904 Hs.22385 ESTs; 3.94 HS578T_cells, EB_cells, Weakly similar to KIAA0970 prote!n PRSC_con 109171 AA180356 Hs.73700 EST 3.94 293T_cells, MB-MDA-435s, A549_cells 122007 AA430629 Hs.98564 ESTs 3.93 PC3_cells, A549_cells, OVCAR_cells 131936 AA094865 Hs.179972 Interferon;3.9 CALU6_cells, EB cells, alpha-inducible prote!n (clo Lu SC H69 128668 AA194849 Hs.103422 ESTs 3.9 Lu_AD H23, EB_cells, Lu_SC_H69 124977 T33859 Hs.190452 KIAA03653.89 293T_cells, DU145 cells, gene product EB_cells 107048 AA600012 Hs.10669 ESTs; 3.89 PC3_cells, HS578T_cells, Moderately similar to KIAA0400 DU145_cells [H.

105358 AA236034 Hs.25362 ESTs 3.89 Caco2, EB cells, CALU6 cells 135106 AA599037 Hs.9456 SWIISNF 3.86 EB_cells, LNCaP_cells, related; matrix assocd; actin Caco2 de 106686 AA463215 Hs.29896 ESTs; 3.85 OVCAR_cells, DU145_cells, Weakly similar to proline-rich EB_cells pro 132093 AA400091 Hs.39421 ESTs 3.85 OVCAR_cells, OVCAR_cells, LNCaP_cells 128651 AA446990 Hs.103135 ESTs 3.84 EB_cells, LNCaP_cells, OVCAI~cells 102459 048936 Human am!loride-sensitive3.84 HT29_cells, BT474 cells, epithelial sod Lu_SC H69 113732 T98288 Hs.193295 ESTs; 3.82 DU145_cells, OVCAR_cells, Weakly sirriilar to !!11 ALU LNCaP_cells SUBFAMI

116000 AA448710 Hs.41327 ESTs 3.82 DU145_cells, MB-MDA-453, Lu SC H69 120748 AA303153 Hs.237994 EST; 3.82 DU145_cells, DU145_cells, Weakly similar to !11! ALU SUBFAMIL Lu SC 1-1345 116318 AA490830 Hs.58570 deleted3.79 MB-MDA-453, CALU6_cells, in cancer 1; RNA helicase HDBIDI EB-cells 114366 241747 Hs.469 succinate 3.78 DU145_celis, Fibroblasts dehydrogenase complex; subunit 2, Caco2 107248 D59894 Hs.34782 ESTs 3.75 LNCaP_cells, DU145_cells, EB_cells 132713 AA286906 Hs.55335 ESTs 3.75 OVCAR_cells, EB cells, Lu SC H345 102222 024683 Hs.159386 Immunoglobulin3.73 EB_cells, OVCAR cells, heavy variable 4-4 293T_cells 108201 AA057518 Hs.63394 ESTs 3.72 293T_celis, DU145 cells, EB cells 119940 W86779 Hs.171807 DKFZP586B03193.71 EB_celis, Caco2, DU145_cells protein 106508 AA452590 Hs.30348 ESTs 3.67 EB_celis, LNCaP_cells, 293T_cells 114360 241592 Hs.22129 hypothetical3.67 HT29 cells, Lu_S(~H520, protein Lu_S(~H520 100991 J03764 Hs.82085 plasminogen3.67 Fibroblasts 2, HS578T_cells, activator!nh!b!tor; type I MB231 cells 107580 AA002091 Hs.175476 ESTs; 3.67 OVCAR_cells, LNCaP_cells, Weakly similar to !1!! ALU SUBFAMI Lu-SC_H345 111685 821408 Hs.106095 ESTs 3.66 OVCAR_cells, A549 cells, 293T_cells 128336 AI242720 Hs.146043 ESTs; 3.66 Lu_SC_H345, Cam2, OVCAR_cells Weakly similar fo alternatively sp 130868 AA004900 Hs.171917 ESTs; 3.61 EB_cells, HS578T_cells, Weakly smir to smlrto glycerophos LNCaP_cells 116802 H44061 Hs.194026 ESTs 3.6 Lu_SC_H345, OVCAR_cells, DU145_cells 130753 246632 Hs.189 phosphodiesterase3.6 Lu_SC_H69, Lu_AD_H23, 4C; CAMP-spec!fic (dun Lu_SC H345 123074 AA485117 Hs.105653 ESTs 3.6 293T_cells, MB231 cells, Fibroblasts 2 114317 241038 Hs.469 succinate 3.6 DU145_cells, HS578T_cells, dehydrogenase complex; subunit CALU6_cells 134194 AA233231 Hs.79828 ESTs 3.59 BT474 cells, MB231 cells, HT29 cells 127752 AA808388 Hs.211167 ESTs 3.59 Lu_S(~H520, MB-MDA~435s, DU145_cells 123526 AA608657 ESTs; Moderately3.59 DU145_cells, OVCAR_cells, s!milar to !!!1 ALU SUB LNCaP_cells 127917 AA211895 Hs.118831 EST; 3.58 Lu_SC_H345, OVCAR cells, Highly similar todJ1163J1.2.1 PRSC_con [H.s 105941 AA404427 Hs.10669 ESTs;ModeratelysimilartoKIAA0400[H.3.58 PC3_celis, DU145_cells, HS578T_cells 124694 806108 Hs.135258 ESTs 3.56 Lu_AD 1123, Lu_SGLH520, Lu AD 358 105656 AA282571 Hs.203772 FSHD 3.56 DU145 cells, EB_cells, region gene 1 A549 cells 111168 N66951 Hs.238380 Human 3.55 PC3_cells, EB_cells, endogenous retroviral protease MB231 cells mRN

133254 AA156670 Hs.180780 H sapiens3.54 OVCAR_cells, DU145_cells, agrin precursor mRNA; partial PC3_cells 132640 033821 Tax1 (human T-cell3.53 MB231_celis, CALU6_cells, leukemia virus type I BT474-cells 116562 D25807 Hs.90145 ESTs 3.52 MB231 cells, BT474_cells, Lu_SC_H345 126045 N80361 Hs.14248 ESTs 3.51 DU145 cells, Lu SC_H345, OVCAR_cells 122878 AA465341 Hs.99640 ESTs 3.47 HT29_cells, OVCAR_cells, HMEC

105220 AA210695 Hs.17212 ESTs 3.47 MB-MDA~t35s, HT29_cells, HT29_cells 127001 AA731636 Hs.59319 ESTs; 3.45 LNCaP_cells, DU145_cells, Weakly similar to !!!! ALU SUBFAMI Lu SC_H345 112693 888741 Hs.91065 ESTs; 3.44 EB_cells, LNCaP_cells, Moderately similar to proliferatio DU145-cells 104935 AA063280 Hs.35552 ESTs 3.43 LNCaP_cells, CALU6_cells, 293T_celis 128710 J04813 Hs.104117 cytochrome3.41 HT29_celis, A549_cells, P450; subfamily IIIA (niphedi Fibroblasts 2 131996 D86956 Hs.36927 heat shock3.4 EB_cells, PC3_cells, 105kD Lu SC H345 119229 T03229 H sapiens (clone 3.4 DU145_cells, Lu SC H345, 104) retinoblastoma 1 g EB_cells 128046 AA873285 Hs.137947 ESTs 3.39 EB_cells, LNCaP_cells, DU145_cells 105175 AA186804 Hs.25740 ESTs; 3.39 PC3_cells, MCF7, DU145_cells Weakly s!m!lar to ubiquitous TPR m 132349 Y00705 Hs.181286 serine 3.38 Caco2, EB_cells, Lu_SC_H69 protease inhibitor, Kazal type 101559 M32053 Human H19 RNA gene,3.37 Lu_SC_H69, MCF7, OVCAR_cells complete cds 116389 AA599011 troponin T1; 3.36 DU145_cells, LNCaP_cells, skeletal; slow CVCAR_cells 130641 AA182001 Hs.17155 ESTs 3.36 DU145 cells, MB-MDA-435s, HS578T_ceils 109362 AA214615 Hs.194348 ESTs 3.33 HT29_cells, Fibroblasts 2, BT474_cells 106278 AA432292 Hs.23388 ESTs; 3.33 EB cells, Fibroblasts Moderately similar to 7777 ALU 2, BT474 cells SUB

127241 AA321849 Hs.248340 H Sapiens 3.32 LNCaP_cells, DU145_cells, mRNA; cDNA DKFZp564J2116 (from EB_cells 133339 N64588 Hs.71252 ESTs 3.32 DU145 cells, EB_cells, Caco2 113260 T64896 Hs.237992 ESTs 3.32 Lu_SC 11345, LNCaP_cells, Lu_SC_H69 133349 N75791 Hs.7153 L-3-hydroxyacyl-Coenryme Caco2, EB_cells, OVCAR_cells A dehydrogenase 3.31 107149 AA621159 Hs.23284 ESTs 3.29 HS578T_cells, DU145_celis, PRSC_con 133195 AA350744 Hs.181409 KIAA10073.29 EB_celis, Lu_AD 1-123, protein Lu_AD 358 111302 N73838 Hs.15049 ESTs 3.29 DU145_cells, EB_cells, HS578T_cells 106414 AA447971 Hs.28827 ESTs 3.28 A549_cells, OVCAR_celis, PC3_cells 121768 AA421561 Hs.251664 insulin-like3.28 Caco2, PRSC con, PRSC
growth factor 2 (somatomedi log 117176 H98670 Hs.49753 ESTs; 3.28 PRSC_log, CALU6_cells, Weakly similar to hypothetical OVCAR-cells pro 131320 AA171948 Hs.145696 splicing3.28 EB_cells, LNCaP_cells, factor (CC1.3) DU145_cells 100700 HG3227-H Guanine Nucleotide-Binding3.27 EB_cells, RPWE 2, Lu~4D_H23 Protein Hsr1 134275 AA132328 Hs.3688 acid-inducible3.26 EB cells, DU145-cells, phosphoprotein LNCaP_cells 117667 N39214 Hs.44708 Ser Thr 3.26 LNCaP_cells, DU145_cells, protein kinase related to the MB-MDA-453 my 124889 878604 Hs.101570 ESTs 3.25 Lu_AD h123, Lu_SC_H69, Lu-SC_H345 126631 W95117 Hs.193337 ESTs 3.25 Lu SC H345, OVCAR_cells, Lu_SC-H69 105643 AA282069 Hs.173802 KIAA06033.24 Caco2, EB_cells, 293T_cells gene product 132718 AA056731 Hs.554 Sjogren 3.24 CALU6_cells, OVCAR_cells, syndrome antigen A2 (60kD; ribon A549 cells 116417 AA609309 Hs.239302 ESTs; 3.24 A549_cells, CALU6_cells, Weakly similar to !!!1 ALU SUBFAMI 293T_cells 108039 AA041341 Hs.46670 ESTs 3.24 293T_cells, EB cells, Caco2 114116 238496 Hs.103283 KIAA05943.23 DU145_cells, OVCAR_cells, protein EB_cells 124514 N58045 Hs.142737 ESTs 3.22 EB cells, Caco2, Lu_SC~H520 110802 N26651 Hs.252748 ESTs 3.22 LNCaP cells, MB-MDA-435s, 106920 AA490899 Hs.24462 ESTs 3.22 DU145 cells, EB_cells, OVCAR_cells 123523 AA608588 Hs.193634 ESTs 3.21 DU145 cells, LNCaP cells, OVCAR_cells 131564 AA491465 Hs.28792 ESTs 3.2 HS578T_celis, HMEC (total RNA), HMEC

119423 T99544 Hs.173734 ESTs; 3.2 EB_cells, DU145_cells, Weakly similar to 1!II ALU CLASS Caco2 B

128736 F03934 Hs.104607 ESTs 3.19 PC3_cells, Lu-Sf~H520, Lu SC H69 101511 M27826 Hs.238380 Human 3.18 PC3_cells, DU145_cells, endogenous retroviral protease Lu_Sf~H520 mRN

114509 AA043551 Hs.95249 ESTs 3.18 EB_cells, Lu-SC_H345, DU145-cells 124196 H52617 Hs.144167 ESTs 3.17 BT474 cells, MB231 cells, HMEC

129095 L12350 Hs.108623 thrombospondin3.17 Fibroblasts 2, PRSC_con, 2 PRSC_log 116457 AA621367 Hs.119683 ESTs 3.17 293T_cells, Lu_SC_H345, CALU6-cells 117040 H89112 yw25e5.s1 Morton 3.16 OVCAR_cells, 293T cells, Fetal Cochlea H sapiens EB cells 129112 N32521 Hs.108738 ESTs 3.16 EB-cells, Fibroblasts 2, MB231 cells 130418 J03242 Hs.251664 insulin-like3.16 Caco2, PRSC_con, PRSC_log growth factor 2 (somatomedi 131199 880048 Hs.234433 ESTs; 3.15 PC3_cells, EB-cells, Weakly similar to transporter OVCAR cells prot 110357 H41529 Hs.33549 ESTs; 3.15 Lu-SC FI345, PRSC_con, Highly similar to sulfonylurea Lu_AD H23 rec 130068 AA608903 Hs.106220 KIAA03363.15 OVCAR cells, CALU6_cells, gene product HS578T_cells 127423 T47546 Hs.119252 tumor 3.15 EB_cells, PRSC-con, LNCaP_cells protein;translationally-controlle 105028 AA126719 Hs.25282 ESTs 3.14 LNCaP_cells, PC3 cells, EB_cells 102349 U37547 Hs.75263 apoptosis3.14 DU145_cells, HS578T_cells, inhibitor 1 LNCaP_cells 105126 AA157814 Hs.36288 ESTs 3.13 EB cells, HS578T-cells, LNCaP-cells 115465 AA286941 Hs.43691 ESTs 3.12 EB cells, DU145_cells, 293T-cells 133246 AA086452 Hs.68731 triadin3.12 Lu_SGLH520, Lu-AD_H23, PRSC log 122698 AA456112 Hs.99410 ESTs 3.12 DU145 cells, OVCAR-cells, A549_cells 123553 AA608841 Hs.111977 ESTs 3.12 EB-cells, Caco2, DU145_cells 133437 857419 Hs.7370 ESTs 3.11 HS578T_cells, 293T_cells, Caco2 104956 AA074880 Hs.120975 ESTs; 3.11 OVCAR_cells, Fibroblasts Weakly similar to hypothetical 2, Caco2 pro 116314 AA490588 Hs.43118 ESTs 3.11 EB_cells, MB-MDA-435s, HT29_cells 120562 AA280036 Hs.173912 eukaryotic3.11 LNCaP_celis, DU145 cells, translation initiation factor EB_cells 108770 AA127845 Hs.71027 EST 3.11 Lu LC_H460, Lu SC_H345, Lu_AD 358 129791 F02778 Hs.173887 KIAA08763.1 Lu SC 11345, Lu SC_H69, protein PRSC_log 115783 AA424487 Hs.72289 ESTs; 3.09 Lu_AD 358, EB_cells, Weakly similar to LIV-1 protein PC3_cells [H

107630 AA007218 Hs.60178 ESTs 3.07 Lu_SC_H345, CALU6_cells, Lu_SC-H69 124339 H99093 Hs.6179 H sapiens 3.07 293T_cells, MB-MDA~453, mRNA; cDNA DKFZp586K2322 (from Caco2 122314 AA442257 Hs.192076 ESTs 3.07 293T_cells, LNCaP cells, PC3_cells 104589 879299 Hs.241160 ESTs; 3.07 293T_cells, DU145_cells, Moderately similar to Il!! ALU EB_cells SUB

115687 AA410508 Hs.183765 ESTs; 3.06 Caco2, EB_cells, MB231 Moderately smlrto ORF derived cells frm 123796 AA620390 Hs.247444 ESTs 3.06 Lu_SC_H345, LNCaP_cells, DU145 cells 106483 AA451676 Hs.30299 1GF-II 3.06 OVCAR_cells, HMEC (total mRNA-binding protein 2 RNA), HMEC

133318 AA256168 Hs.70838 ESTs 3.05 OVCAR_cells, LNCaP_cells, 293T_cells 117244 N20979 Hs.1757 L1 cell adhesion molecule (hydrocephalus thumbs) syndrome; spastic paraplegia3.05 MB231 cells, MCF7, CALU6_cells 1) 130797 AA430050 Hs.180948 KIAA07293.05 EB_cells, DU145_cells, protein DU145_cells 128959 D79791 Hs.107381 ESTs; 3.05 LNCaP_cells, HS578T_cells, Weakly similar to F38A5.1 [C.elega Lu-S(~H520 120481 AA252703 Hs.191754 ESTs 3.04 EB_cells, Fibroblasts 2, PRSC_con 126649 AA856990 Hs.125058 ESTs 3.03 OVCAR_cells, LNCaP_cells, 293T-cells 106970 AA504835 Hs.24252 ESTs 3.03 EB_cells, OVCAR_cells, 293T_cells 126488 N34935 Hs.25633 ESTs; 3.03 Lu_AD 358, MCF7, MB231_cells Highly similar to ARF GTPase-activ 119498 W37226 Hs.55573 ESTs 3.01 293T_celis, HS578T_cells, CALU6_celis 129967 H99653 Hs.138618 ESTs 3.01 Lr~SC_H345, Lu_SC_H69, PRSC_log 130698 AA037357 Hs.188212 ESTs 3.01 OVCAR_cells, LNCaP_cells, DU145_cells 111018 N54067 Hs.3628 mitogen-activated3.01 PC3 cells, Caco2, Fibroblasts protein kinase kinase 2 123196 AA489250 Hs.59403 serine 3 Lu SC H345, BT474_cells, palmitoyltransferase; subunit Lu_SC_H69 II

133229 AA203433 Hs.6834 KIAA1014 3 OVCAR_cells, 293T_cells, protein EB_cells 130405 H88359 Hs.155396 nuclearfactor(erythroid-derived2)-lik3 PRSC_con, EB_cells, DU145_cells 107881 AA025567 Hs.61273 H sapiens3 Lu_SGLH520, MCF7, t_u~D_358 chromosome 19; cosmid 832811 116589 D59570 Hs.17132 ESTs 3 EB_cells, A549_cells, HS578T_cells 105479 AA255546 Hs.23467 ESTs 2.99 Lu SC 11345, PC3 cells, OVCAR_cells 115560 AA393812 Hs.50575 ESTs; 2.99 EB_cells, Lu_SC_H69, Moderately sim!lar to Ill! ALU Fibroblasts 2 SUB

130166 AA350690 Hs.151411 KIAA09162.98 LNCaP_cells, EB_cells, protein 293T_cells 123355 AA504773 Hs.160657 ESTs 2.98 PRSC_con, PRSC_log, PRSC_log 109546 F01449 Hs.26954 ESTs 2.97 Lu_SC_H345, HT29 cells, BT474_cells 129001 AA448946 Hs.107812 ESTs; 2.97 EB cells, Lu~ID 1123, Weakly similar to proline-rich Lu~4D_358 pro 102259 028369 Hs.82222 sema domain;2.97 EB_cells, MB231 cells, !mmunoglobulin domain (Ig); OVCAR_cells 105583 AA278907 Hs.24549 ESTs 2.96 EB_cells, DU145 cells, 293T_cells 131859 M90657 Hs.3337 transmembrane2.96 A549_cells, PC3_cells, 4 superfamily member 1 DU145_cells 114533 AA053401 Hs.177526 ESTs 2.96 293T_cells, Lu_LC_H460, PC3_cells 110220 H23543 Hs.27090 ESTs 2.95 PRSC_log, Lu_SC_H345, MB231 cells 124917 891241 Hs.75470 hypothetical2.95 Lu_SC_H345, Lu SC H69, protein; expressed in osteo PRSC_log 127111 AA805726 Hs.220509 ESTs 2.94 HS578T_cells, 293T_cells, 293T_cells 134882 N73762 Hs.90638 ESTs 2.94 EB-cells, MB-MDA-453, Fibroblasts 2 121788 AA423968 Hs.178113 ESTs; 2.94 HT29_cells, CALU6_cells, Moderately sim!lar to kinesin HMEC
like 128530 AA504343 Hs.183475 H Sapiens2.94 DU145_cells, Lu_SC_H345, clone 25061 mRNA seq Caco2 128435 AI301201 Hs.147112 ESTs 2.93 EB_cells, Lu_SQ,H520, PRSC_con 113782 W15580 Hs.15342 phosphate 2.93 EB_cells, Lu_AD H23, cytidylyltransferase 1; cholin PRSC_log 127569 AA588536 Hs.191783 ESTs 2.93 EB_cells, HS578T_cells, Lu_AD 358 109642 F04465 Hs.22394 ESTs; Weakly similar to weak similarity protein US)1 [C.elegans] 2.92 PC3_cells, EB_cells, OVCAR cells 114615 AA083812 Hs.159456 DKFZP566F1232.92 A549 cells, HS578T_cells, prote!n PRSC con 126808 AA086320 zn52d12.s1 Stratagene2.92 Lu SC H69, Lu_SC_H345, muscle 937209 H sa EB_cells 113947 W84768 Hs.141742 ESTs 2.92 DU145_cells, Fibroblasts 2, MCF7 129455 W27301 Hs.187991 DKFZP564A1222.91 OVCAR_cells, DU145_cells, protein CALU6-cells 107772 AA018587 Hs.40515 ESTs; 2.91 OVCAR_cells, EB_cells, Weakly similarto !!!! ALU SUBFAMI PC3_cells 127159 AA284097 Hs.237955 RAB7; 2.91 293T_cells, OVCAR_cells, member RAS oncogene family PC3-cells 124792 844357 Hs.132784 ESTs; 2.91 DU145_cells, DU145_cells, Weakly similar to cDNA EST EMBL:TO CALU6_cells 109751 F10210 Hs.6679 H sapiens 2.91 EB_cells, Lu_SC
mRNA; cDNA DKFZp586A0424 (from H69, 293T_cells 128926 AA481403 Hs.107213 ESTs; 2.9 CALU6-cells, EB_cells, Highly s!milar to NY-REND antigen OVCAIZcells 106637 AA459961 Hs.250824 ESTs 2.9 EB_cells, Caco2, MB-MDA~35s 132164 084573 Hs.41270 procollagen-lysine;2.9 DU145_cells, HS578T_cells, 2-oxoglutarate 5-dio A549_cells 128099 AA905327 ESTs 2.9 MCF7, HMEC (fotal RNA), 293T_cells 104818 AA034947 Hs.24831 ESTs 2.9 EB_cells, Lu_LC_H460, 293T_cells 126050 H27267 Hs.75860 hydroxyacyl-Coenryme A dehydrogenasel3-k -Coenryme A hydratase (Uifunctional2.89 LNCaP_cells, DU145_cells, pro OVCAR_cells 116696 F09780 Hs.66124 EST 2.89 CALU6_cells, 293T_cells, 293T_cells 135204 AA421146 Hs.183418 cell 2.89 PC3_cells, EB_cells, division cycle 2-like 1 (PITSLRE LNCaP_cells pr 134946 AA406534 Hs.193053 ESTs; 2.88 EB_cells, LNCaP_cells, Weakly s!milar to hiwi [H.sapiens] Caco2 114975 AA250850 Hs.13944 adrenergic;2.88 EB_cells, EB_cells, beta; receptor kinase 2 EB_cells 113792 W35212 Hs.17691 ESTs; Weakly2.88 MB-MDA-435s, Lu_SC_H69, sim!lar to env protein [H.s CALU6_cells 102322 034962 Hs.54473 cardiao-spectfic2.88 293T_cells, HT29-cells, homeo box Lu_AD_H23 125642 A1096849 Hs.25274 ESTs; 2.88 PC3_cells, CALU6_cells, Moderately sim!lar to putative 293T_cells sev 100288 D43951 Hs.153834 Human 293T_cells, LNCaP_cells, mRNA for KIAA0099 gene; complete EB_cells c2.88 105878 AA400184 Hs.24656 KIAA09072.88 OVCAR_cells, DU145 cells, prote!n 293T_cells 125262 W88755 Hs.108514 ESTs; 2.88 DU145_cells, HS578T_cells, Highly similarto Trio [H.sapiens] MB231 cells 114419 AA011448 Hs.106532 ESTs; 2.88 EB cells, Lu-AD H23, Weakly similar to transposon Fibroblasts 2 130639 D59711 Hs.17132 ESTs 2.87 EB_cells, A549_cells, OVCAR_~Ils 130972 AA370302 Hs.21739 H Sapiens 2.87 293T_cells, A549_cells, mRNA; cDNA DKFZp58611518 (from Lu_LC_H460 126906 H66949 Hs.168069 ESTs; 2.87 Lu-SC_H345, Lu_SC_H69, Highly s!milar to CALCIUM-BINDING LNCaP_cells 121807 AA424507 Hs.247478 H sapiens Mut S homolog 5 gene; partial 1C7; LST-1; lymphotoxin beta; 2.87 Lu_SC H69, HT29_cells, tumor necr RPWE_2 105474 AA255440 Hs.219614 F-box 2.87 Lu_AD 1-123, Caco2, protein FBL11 EB_cells 122348 AA443695 Hs.231476 ESTs 2.87 HT29_cells, Lu_5C_H69, BT474_cells 116368 AA521186 Hs.94217 ESTs 2.86 MB-MDA-453, OVCAR_cells, Lu SC_H69 135143 AA102644 Hs.69559 KIAA10962.86 PC3_cells, EB_cells, prote!n 293T_cells 106711 AA464741 Hs.143187 Human 2.86 EB_cells, Lu_AD 1123, DNA from chromosome 19-spec!fic Lu LC_H460 co 128583 L32832 Hs.101842 AT-binding2.85 LNCaP_cells, Caco2, transcription factor 1 EB_cells 132139 AA213410 Hs.111554 ADP-ribosyla6on2.85 A549_cells, HS578T_cells, factor like 7 Caco2 114484 AA034378 Hs.252351 HERV-H 2.85 PC3_cells, Lu_SQ,H520, LTR-associating 2 MB231 cells 124620 N74051 Hs.194092 ESTs; 2.85 Lu_SC_H345, MB231_cells, Weakly similar to !!!! ALU SUBFAMI Fibroblasts 2 100403 D85527 H Sapiens mRNA for 2.84 Lu_AD 358, Lu,~D_358, LIM domain, partial c MB231 cells 129795 AA448627 Hs.125163 ESTs; 2.84 Lu_SC_H345, OVCAR_cells, Weakly s!milarto 1!!! ALU SUBFAMI PC3_cells 128258 T70214 Hs.183548 ESTs 2.84 DU145_cells, DU145_cells, OVCAR_cells 102662 070321 Hs.130227 tumor 2.84 EB_cells, Lu_AD_H23, necrosis factor receptorsuperfami Fibroblasts 2 132232 AA252030 Hs.42640 ESTs 2.84 EB_cells, OVCAR_cells, Lu_SC_H345 106111 AA421638 Hs.6451 ESTs 2.83 EB_cells, Lu LC_H460, OVCAR_cells 123963 C13961 Hs.210115 EST 2.83 DU145_cells, LNCaP_cells, Lu_SC_H345 122783 AA459895 Hs.98988 ESTs 2.83 EB_cells, MCF7, Lu_SC_H69 112788 896586 Hs.163630 ESTs 2.82 DU145_cells, Lu_SC_H345, EB_cells 120823 AA347546 Hs.185780 ESTs 2.82 HT29_cells, HMEC (total RNA), BT474_cells 100378 D80009 Hs.10848 KIAA0187 2.82 Caco2, PC3_cells, OVCAR_cells gene product 114617 AA114163 Hs.188877 ESTs 2.81 DU145_cells, MCF7, EB_cells 108085 AA045602 Hs.62863 ESTs; 2.81 EB_cells, Lu_AD_H23, HT29_cells Moderately similar to serinelthreo 104938 AA064627 Hs.18341 ESTs; 2.81 PC3_cells, HS578T_cells, Highly similar to CGI-72 protein OVCAI~.cells [

128743 AA237013 Hs.2730 heterogeneous2.8 OVCAR_cells, LNCaP cells, nuclear ribonucleoprotein Caco2 124314 H94877 Hs.215766 GTP-binding2.8 LNCaP_cells, DU145_cells, protein Caco2 134227 D79986 Hs.80338 KIAA0164 2.8 LNCaP_cells, A549_cells, gene product EB-cells 122922 AA476268 zw44h1.s1 Soares total_fetus_Nb2HF8 9w H

contains Alu repetitive element;contain2.79 Lu_SC_H345, OVCAJ~cells, Lu SC_H69 126096 H42968 Hs.155606 paired 2.78 Lu~D_H23, Lu SC FI69, Lu mesoderm homeo box 1 LC H460 129295 AA424782 Hs.110121 SEC7 2.78 Lu_AD_H23, EB_cells, Lu_SC
homolog H345 116155 AA460957 Hs.76053 DEADIH 2,78 EB_cells, OVCAR_cells, (Asp-Glu-Ala AspIHis) box polypep 293T_cells 105911 AA401809 Hs.189910 ESTs 2.77 293T_cells, HS578T_cells, DU145_cells 119232 T03475 Hs.258624 EST 2.77 EB cells, Lu~4D_H23, Lu_AD

131168 AA482007 Hs.23788 ESTs; 2.77 EB cells, Lu_LC 1-1460, Weakly similar to homology with MCF7 is 106048 AA416697 Hs.15330 ESTs 2.76 OVCAR_cells, Lu SC_H345, 293T_cells 124352 N21626 Hs.102406 ESTs 2.76 MCF7, MB-MDA-453, CALU6_cells 129349 D86974 Hs.110613 KIAA02202.76 DU145_cells, HT29_celfs, proteih Lu_SC_H69 106120 AA423808 Hs.8765 RNA helicase-related2.76 OVCAR_cells, EB_cells, protein 293T_cells 100643 HG2755-H T-Plastin 2.75 293T_cells, PC3_cells, HS578T_cells 128500 U60521 Hs.100641 caspase 2.75 Lu-AD 358, Lu_SC_H69, Lu-SC
9; apoptosis-related cysteine H345 pr 126090 844789 Hs.119486 ESTs; 2.75 Lu_SC FI69, Lu_SC_H345, Weakly similar to rostral cerebell BT474_cells 127064 243709 HSC1JA091 normalized2.75 Caco2, A549_cells, HT29 infant brain cDNA H cells 132989 AA480074 Hs.394 adrenomedullin2.75 EB_cells, OVCAR_cells, DU145_cells 108888 AA135606 Hs.189384 ESTs; 2.75 OVCAR_cells, LNCaP_cells, Weakly similar to 1!1! ALU SUBFAMI DU145 cells 119579 W42429 Hs.150607 ESTs 2.74 293T_cells, DU145_cells, PC3_cells 100387 D83777 Hs.75137 KIAA0193 2.74 CALU6_cells, DU145_cells, gene product Caco2 114744 AA135407 Hs.252351 HERV-H2.74 PC3_cells, Lu_SfLH520, LTR-associating 2 RPWE_2 129092 AA011243 Hs.63525 poly(rC)-binding2.74 EB cells, MCF7, DU145_cells protein 2 125360 AA677978 Hs.189741 ESTs 2.74 Lu_AD 358, Lu_AD 358, PRSC_log 107874 AA025305 Hs.25218 ESTs; 2.74 Lu_SC_H345, Lu_LC_H460, Weakly similar to reverse transcri HT29_cells 114086 238266 Hs.12770 H sapiens EB_cells, LNCaP_cells, PAC clone DJ0777023 from 7p14- BT474_cells 2.74 116180 AA463902 Hs.94964 ESTs 2.73 Lu_SC FI69, PRSC_con, Lu_AD_H23 126027 M61982 ESTs 2.73 LNCaP_cells, DU145_cells, A549_cells 116339 AA496257 Hs.72165 ESTs; 2.73 EB cells, DU145_cells, Weakly similarto 826984_1 [H.sapi OVCAR-cells 105387 AA236951 Hs.108636 chromosome2.72 PC3_cells, EB_cells, Caco2 1 open reading frame 9 111359 N91273 Hs.27179 ESTs 2.72 EB_cells, LNCaP-cells, 293T_cells 106680 AA461458 Hs.24789 ESTs 2.72 PC3_cells, Lu_SC_H345, Caco2 118598 N69136 Hs.214343 ESTs 2.72 MB-MDA-453, 293T_cells, BT474-cells 107913 AA027161 Hs.59523 ESTs; 2.71 EB_cells, MCF7, Lu_SC_H345 Highly similar to G1 TO S PHASE
TR

134315 AA136269 Hs.81648 ESTs; 2.71 EB_cells, DU145_cells, Weakly similarto S164 [H.sapiens] HMEC

135233 AA127463 Hs.9683 protein-kinase;2.71 EB_cells, OVCAR_cells, interferon-inducible dou Caco2 112932 T15470 Hs.189810 ESTs 2.7 293T_cells, Lu_AD_H23, PC3_cells 119053 811501 yf28f1.s1 Soares fetal liverspleen 1NFL

contains Alu repetitive element;,2.7 Lu_SC_H345, Lu_SC_H69, mRNA DU145_cells 131206 AA044078 Hs.24210 ESTs 2.7 Caco2, Lu SC H345, HS578T_cells 126759 AA063642 ESTs; Highly 2.7 LNCaP_cells, Lu_SC_H345, similar to (defline not ava Lu_SC_H69 131060 AA160890 Hs.22564 myosin 2.7 LNCaP_cells, MCF7, HT29_cells VI

132135 N69101 Hs.40730 ESTs 2.7 EB_cells, 293T_cells, OVCAR_cells 120835 AA348446 Hs.96906 ESTs 2.7 Fibroblasts 2, CALU6 cells, RPWE_2 113815 W45311 Hs.14756 ESTs 2.7 EB_cells, PC3_cells, DU145 cells 133234 T90092 Hs.6853 ESTs; Weakly2.69 Lu SC H345, OVCAR_cells, similar to !!!! ALU SUBFAMI DU145_cells 126819 AA305536 Hs.161489 ESTs 2.69 EB_cells, DU145_cells, Caco2 125198 W69474 Hs.225550 ESTs 2.69 Lu_SC h1345, Lu_AD_H23, Lu_AD FI23 108394 AA075144 zm86f6.s1 Stratagene ovarian cancer (#93 gb:X1664 TRANSLATIONALLY CONTROLLED 2.69 HMEC, HMEC (total TUM RNA), Fibroblasts 2 134456 X59405 Hs.83532 membrane 2.69 EB_cells, LNCaP_cells, cofactor protein (CD46; trophob DU145_cells 111720 823739 Hs.23585 KIAA1078 2.68 PC3_cells, HMEC (total protein RNA), OVCAR_cells 114617 AA084148 Hs.110659 ESTs 2.68 DU145_cells, LNCaP_cells, OVCAR_cells 127787 AA731764 ESTs; Weakly 2.68 HT29_cells, Lu_SC_H345, similar to !!!1 ALU CLASS C M8231 cells 101437 M20681 Hs.7594 solute 2.68 Caco2, Lu LC H460, Fibroblasts tamer family 2 (facilitated 2 glu 133761 AA477223 Hs.75922 brain 2.68 EB_cells, Lu~D_H23, Lu_SC-H345 protein 13 105869 AA399574 Hs.19086 ESTs 2.68 PC3_cells, MCF7, M8231_cells 125191 W67257 Hs.138871 ESTs; 2.68 OVCAR_cells, DU145_cells, Weakly similar to Illl ALU CLASS LNCaP_cells B

116238 AA479362 Hs.47144 DKFZP586N08192.67 OVCAR cells, DU145_cells, protein LNCaP_cells 124770 840555 Hs.120429 ESTs 2.67 Lu_AD_H23, Lu_SC_H69, PRSC_con 101764 M80563 Hs.81256 S100 calcium-binding protein A4 (calcium murine placental homologj 2.67 A549_cells, MB231_cells, OVCAR_cells 130897 AA063428 Hs.21022 adaptor-related2.67 EB_cells, Lu~4D_H23, HMEC
protein complex 3; beta 133303 H61046 Hs.237352 EST 2.66 Lu_SC 11345, Lu_SC_H69, PRSC_con 124724 812405 Hs.112423 H sapiens 2.66 Lu SC_H345, BT474 mRNA; cDNA DKFZp586J1420 (from cells, OVCAR_cells 123697 AA609601 Hs.221224 ESTs 2.66 OVCAR_cells, 293T_cells, Lu_SC_H69 111548 809170 Hs.258707 ESTs 2.66 293T_cells, CALU6_cells, A549_cells 107005 AA598679 Hs.194215 ESTs 2.66 Lu_SC_H345, OVCAR_cells, Lu~D_H23 105569 AA278399 Hs.20596 ESTs 2.65 ' MCF7, HT29_cells, BT474_cells 132687 A8002301 Hs.54985 KIAA03032.65 HMEC (total RNA), HMEC, protein LNCaP_cells 104105 AA422123 Hs.42457 ESTs 2.65 Lu SC H345, Lu_SC_H69, DU145_cells 121335 AA404418 Hs.144953 ESTs 2.65 EB_cells, Fibroblasts 2, DU145_cells 124853 861693 Hs.172330 ESTs; 2.64 Lu_SC_H69, 293T_cells, Weakly s!milar to Wiskott-Aldrich EB_cells 124253 H69742 Hs.102201 ESTs 2.64 DU145_cells, OVCAR_cells, Lu_SC 11345 123044 AA481549 Hs.165694 ESTs 2.64 EB cells, Lu_SC_H69, Lu_SC_H345 129535 AA6t)8852 Hs.112603 EST 2.64 EB cells, Lu~D 1123, Flbroblasts 131397 AB002336 Hs.26395 erythrocyte2.64 EB_cells, DU145_cells, membrane protein band 4.1-li Caco2 130175 X75593 Hs.151536 RAB13; 2.64 Fibroblasts 2, PRSC_con, member RAS oncogene family HS578T_cells 127507 AI188445 Hs.152618 ESTs 2.63 EB_cells, Lu_AD_H23, Lu_LC_H460 105377 AA236702 Hs.24371 ESTs 2.63 Caco2, EB_cells, CALU6 cells 114671 AA112679 Hs.252291 ESTs; 2.63 EB_cells, DU145-cells, Weakly similar to !!!I ALU SUBFAMI Caco2 133726 W19983 Hs.75761 SFRS protein2.63 EB_cells, Lu-AD_H23, Lu_SC_H69 kinase 1 132380 H68018 yr76h05.r1 Soaresfetal liver spleen 1NF

IMAGE:211257 5', mRNA seq. 2.62 EB_cells, Lu-AD-H23, Lu SC_H69 127986 AI370418 Hs.192050 ESTs; 2.62 DU145_cells, OVCAR_cells, Weakly similar to !!!! ALU CLASS LNCaP_cells A

116208 AA476333 Hs.42532 ESTs 2.61 DU145 cells, PRSC_con, Fibroblasts 2 130946 AA069456 Hs.21490 KIAA04382.6 LNCaP_cells, DU145-cells, gene product HS578T_cells 106687 AA463234 Hs.119387 KIAA07922.59 EB_cells, MB-MDA-453, gene product Caco2 101551 M31606 Hs.196177 phosphorylase2.59 LNCaP_cells, EB_cells, kinase; gamma 2 (testis) MB-MDA~153 114479 AA032084 Hs.124841 ESTs; 2.59 DU145_cells, Caco2, OVCAR_cells Moderately similar to transformati 111863 837495 Hs.23578 ESTs 2.59 HT29-cells, MB231 cells, Lu_SQH520 129018 AA029973 Hs.107979 small 2.59 A549_cells, EB-cells, membrane protein 1 HS578T-cells 107058 AA600357 Hs.239489 TIA1 2.58 DU145-cells, Lu_SC_H345, cytotoxic granule-assoc!ated EB cells RNA-b!

126175 AA056181 Hs.17311 DKFZP434N1612.58 Lu SC-H345, DU145_cells, protein LNCaP_cells 131979 D52154 Hs.172458 iduronate2.58 DU145 cells, PC3_cells, 2-sulfatase (Hunter syndrome) A549-cells 126122 H80181 ESTs 2.58 DU145 cells, OVCAR_cells, LNCaP_cells 106961 AA504110 Hs.18063 ESTs 2.58 HMEC, DU145_cells, DU145_cells 114730 AA133527 Hs.126925 ESTs; 2.58 DU145 cells, LNCaP_cells, Weakly similar to The KIAA0138 MCF7 gen 117342 N24020 Hs.132913 ESTs 2.58 HS578T_cells, DU145 cells, LNCaP_cells 131622 AA424813 Hs.29692 ESTs 2.57 PRSC-con, PRSC_log, HS578T_cells 104904 AA055560 Hs.13179 ESTs; 2.57 Lu-SC 1-1345, Lu_SC-H69, Moderately s!milar to 1!!! ALU BT474 cells SUB

117359 N24848 Hs.114062 ESTs; 2.57 HS578T_cells, PRSC-con, Weakly similar to T15B7.2 [C.elega EB_cells 123331 AA497013 Hs.188740 ESTs; 2.57 Lu_SC_H69, Caco2, PRSC_con Weakly similar to !!!1 ALU SUBFAMI

125324 807785 yf15c06.r1 Soares fetal liver spleen 1NF

contains Alu repetitive element;contain2.57 EB cells, Lu_AD 1123, Fibroblasts 2 129813 T33462 Hs.12600 ESTs 2.57 Lu SC 11345, 293TCells, Lu-SC-H69 100265 D38521 Hs.75935 KIAA0077 2.57 EB_cells, LNCaP_cells, protein PC3-cells , 134890 T40902 Hs.90786 ATP-binding2.57 A549-cells, DU145_cells, cassette; sub-family C (CFTR EB_cells 133582 AA421874 Hs.75087 Fas-activated2.56 EB-cells, Lu~,D 1-123, serinelthreonine kinase Lu-AD_358 135011 H73161 Hs.92991 ESTs; 2.56 EB_cells, LNCaP_cells, Weakly similar to C13F10.4 [C.eleg MB-MDA-453 107226 D58185 Hs.21945 ESTs 2.56 Lu SC H345, Lu SC_H69, HMEC (total RNA) 126042 H62441 Hs.157082 H sapiens HMEC (total RNA), HMEC, PAC clone DJ0988G15 from 7q33- RPWE 2 2.56 114472 AA028924 Hs.177407 ESTs; 2.56 Lu SC H345, Lu SC H69, Weakly similar to !!!! ALU SUBFAMI DU145 cells 126291 N42090 yy05b07.r1 Soares HMEC, HMEC (total RNA), melanocyte 2NbHM H sap 2.56 PC3_cells 113349 T79021 Hs.14438 ESTs; 2.56 HT29_cells, PRSC_log, Moderately sim!lar to histamine Lu_SC_H345 N-105769 AA347485 Hs.25477 ESTs; 2.56 Lu-AD H23, RPWE 2, Lu_St~H520 Moderately sim!lar to rig-1 protei 110918 N46423 Hs.24283 ESTs 2.56 EB cells, CALU6_cells, DU145-cells 117170 H98153 Hs.42500 ADP-ribosylation2.56 OVCAR-cells, EB_cells, factor-like 5 LNCaP_cells 105159 AA173981 Hs.30490 CD2-associated2.55 LNCaP_cells, EB cells, protein DU145_cells 105726 AA292328 Hs.9754 activating2.55 MCF7, EB_cells, MB-MDA-053 transcription factor 5 132079 H67964 Hs.38694 ESTs 2.55 EB_celis, DU145 cells, HS578T_cells 131813 X51757 Hs.3268 heat shock2.55 Lu-AD H23, MB231 cells, lOkD protein 6 (HSP70B') Fibroblasts 2 133538 L14837 Hs.74614 tightjunction2.54 DU145_celis, Caco2, A549_cells protein 1 (zona occludens 124981 T40849 Hs.114034 maternal2.54 EB-cells, Caco2, LNCaP_cells G10 transcript 122028 AA431306 Hs.98722 ESTs 2.54 Fibroblasts 2, BT474_cells, HMEC (total RNA) 122487 AA448332 Hs.80598 transcription2.54 Lu_SC H345, MCF7, MB-MDA-453 elongation factorA (SII);

119315 T41152 Hs.90485 ESTs 2.54 Lu SC_H345, MB-MDA-435s, PRSC_con 107957 AA031948 Hs.57548 ESTs 2.54 A549_cells, RPWE_2, DU145_cells 122457 AA447780 Hs.96418 ESTs 2.54 DU145_cells, EB_cells, A549-cells 103572 225749 Hs.75538 ribosomal2.54 EB-cells, CALU6_cells, protein S7 DU145_cells 124395 N29963 Hs.193977 ESTs 2.54 HMEC (total RNA), HMEC, 116024 AA451748 Hs.83883 Human DNA seq from clone 718J7 on chromo phosphoenolpyruvate carboxykinase2.53 LNCaP_cells, RPWE 2, MB-MDA-453 1; ES

134361 D43682 Hs.82208 acyl-Coenzyme2.53 LNCaP_cells, CALU6_cells, A dehydrogenase; very long DU145_cells 130420 U60975 Human hybrid receptor2.53 EB_cells, HMEC (total gp25 precursor mRN RNA), Caco2 100336 D63478 Hs.8127 KIAA0144 2.53 BT474_cells, HT29_cells, gene product Lu.AD_358 105519 AA258063 Hs.23438 ESTs 2.53 EB_cells, Caco2, MB-MDA-435s 124684 802401 Hs.221078 ESTs 2.53 Lu_SC_H345, OVCAR_cells, Lu_SC_H69 105852 AA398933 Hs.172613 solute2.52 LNCaP_cells, DU145_cells, tamer family 12 (potassiumlchlo EB_cells 105012 AA116036 Hs.9329 chromosome2.52 CALU6_cells, Caco2, DU145_cells 20 open reading frame 1 126534 W39128 Hs.247901 Human DNA seq from clone 8B1 on chromoso -CELL MEMBRANE GLYCOPROTEIN PC-1;the 2.52 BT474_cells, LNCaP_cells, ge Lu-AD h123 135334 AA053134 Hs.241558 ariadne-22.52 293T_cells, CALU6 cells, (D. melanogaster) homolog (all DU145_cells 128538 844214 Hs.101189 ESTs 2.52 EB_celis, Lu_AD_H23, Lu-SC_H345 109865 H02566 Hs.191268 H sapiens 2.52 DU145_cells, LNCaP_cells, mRNA; cDNA DKFZp434N174 (from OVCAR_cells 118579 N68905 small inducible 2.51 Lu SC H345, LNCaP_cells, cytokine A5 (RANTES) Lu SC_H69 117590 N34904 ESTs; Moderately 2.51 Lu_SC_H345, DU145_cells, similarto !!!! ALU SUB Lu_SC_H69 104340 F15201 ESTs 2.51 Lu_SC H345, PRSC_con, PRSC_log 122455 AA447744 Hs.99141 EST 2.51 Caco2, Lu_SC H69, 293TCells 109339 AA211901 Hs.86430 ESTs 2.51 EB_cells, DU145_cells, CALU6_cells 123258 AA490929 Hs.105274 ESTs 2.51 EB_cells, Lu~D_H23, Lu SC_H69 118467 N66763 Hs.43080 ESTs 2.51 CALU6 cells, HS578T_cells, OVCAR-cells 106044 AA416546 Hs.149436 k!nesin2.51 EB_cells, Caco2, DU145_cells family member5B

107480 W58057 Hs.74304 periplakin2.5 Caco2, OVCAR_cells, HMEC
(total RNA) 111760 826892 Hs.221434 ESTs 2.5 Lu_AD H23, EB_cells, Lu~D_358 132474 N68018 Hs.180930 TBP-associated2.5 LNCaP_cells, EB_cells, factor 172 DU145_cells 103423 X97249 Hs.123122 FSH primary2.5 HS578T_cells, Lu SC_H345, response (LRPR1; rat) homolo PC3_cells 123488 AA599708 Hs.187764 ESTs; 2.49 OVCAR_cells, Lu_SC H345, Weakly similar to 1!!1 ALU SUBFAMI DU145_cells 100475 D90276 Hs.12 carcinoembryonic2.49 MB-MDA-453, 293T_cells, antigen-related cell ad CALU6 cells 112003 842547 Hs.172551 ESTs 2.49 EB cells, Lu~D_H23, Lu-SC_H345 114315 241027 Hs.26297 ESTs 2.49 Lu_SC 1-169, OVCARCeIIs, Lu_AD_H23 105291 AA233311 Hs.28752 ESTs 2.49 EB_cells, CALU6-cells, DU145_cells 135354 AA188934 Hs.99367 ESTs 2.49 MB-MDA-453, Lu_SC H69, 293T_cells 107521 X78262 H.sap!ens mRNA 2.49 Lu-SC_H345, Lu-SC_H69, for TRE5 PRSC_con 108373 AA074393 Hs.61950 ESTs;Weaklysimilartonuclearprotein2.49 MCF7, MB-MDA-453, Lu_SC_H345 108836 AA132061 Hs.222727 ESTs; 2.48 DU145_cells, Lu_SC_H345, Weakly similarto ubiquitous Lu SC H345 TPR m 110386 H45516 Hs.33268 ESTs 2.48 PC3_cells, OVCAR_celis, Lu_SQ.H520 129658 M22348 Hs.131255 ubiquinol-cytochrome2.48 LNCaP_cells, CALU6 cells, c reductase binding PC3_cells 134283 H12661 Hs.8107 H Sapiens 2.48 HMEC (total RNA), mRNA; cDNA DKFZp586B0918 (from HS578T_cells, HMEC

101844 M93425 Hs.62 protein tyrosine2.48 DU145-cells, EB_cells, phosphatase; non-recept CALU6_cells 133461 M33318 Hs.183584 cytochrome2.48 EB_celis, Lu-AD H23, Lu_AD
P450; subfamily IIA (phenobar 358 103545 214000 Hs.35384 ring finger2.47 HT29_cells, Lu-S(~H520, prote!n 1 BT474-cells 128440 N76763 ESTs 2.47 EB_cells, Lu_AD H23, Lu-AD_358 134992 H05625 Hs.92414 ESTs 2.47 Lu-SC H345, CALU6_cells, Lu SC-H69 116295 AA489016 Hs.91216 ESTs; 2.47 MB-MDA-453, 293T_cells, Highly sim!lar to partial CDS; MB-MDA-435s hum 107004 AA598675 Hs.239475 ESTs 2.47 LNCaP_cells, Caco2, OVCAR_cells 132137 AA282312 Hs.4076 CTD (carboxy-terminal2.46 Lu SC H69, HMEC, EB-cells domain; RNA polyme 126390 W28286 Hs.100090 tetraspan2.46 EB_cells, DU145 cells, 3 LNCaP_cells 113050 T26366 Hs.22711 EST; Weakly 2.46 Lu-LC_H460, EB-cells, similar to 60S RIBOSOMAL PRO Lu~D-358 101667 M60858 Hs.79110 nucleolin2.46 PC3-cells, 293T_cells, A549-cells 108569 AA085398 zn7e3.s1 Stratagene hNT neuron (#937233) IMAGE:546748 3', mRNA seq 2.45 HT29_cells, BT474 cells, Lu_S1~H520 117186 H98988 Hs.42612 ESTs 2.45 EB cells, Lu-AD_H23, Lu~D-358 129091 AA044622 Hs.183755 Human K-A 2.45 EB-cells, Lu~4D FI23, Chromosome 16 BAC clone CIT987S Lu-AD_H23 128468 T23625 Hs.258674 EST 2.45 Lu_AD_H23, EB cells, Lu-SC_H69 117498 N31726 Hs.44268 ESTs; 2.45 Lu SC-H69, DU145_cells, Highly similar to myelin gene OVCAR_cells expr 105407 AA243478 Hs.5206 ESTs 2.45 EB cells, 293TCells, PC3_celis 128941 855763 Hs.107287 ESTs 2.44 EB cells, LNCaP_cells, . A549-cells 116486 C14128 Hs.251980 EST 2.44 MB-MDA-435s, HS578T_cells, 293T-cells 134869 T35288 Hs.90421 ESTs; 2.44 EB_cells, Lu~D_H23, Lu-AD-358 Moderately similar to !!1! ALU
SUB

130664 809049 Hs.17625 ESTs 2.44 PC3_cells, EB-cells, A549_cells 107985 AA035638 Hs.71968 H sapiens 2.44 PRSC_con, PRSC_log, mRNA; cDNA DKFZp564F053 (from Caco2 110300 H37820 Hs.124147 ESTs 2.44 MB-MDA-453, Caco2, OVCAR-cells , 113471 T87174 Hs.16341 ESTs; 2.44 Caco2, OVCAR_cells, LNCaP_cells Moderately s!m!larto !!!1 ALU
SUB

131474 U28749 Hs.2726 high-mobility2.44 CALU6 cells, OVCAR_cells, group (nonhistone chromoso 293T-cells 120791 AA342802 Hs.194031 ESTs 2.44 Lu_AD_H23, Lu_Sf~H520, PRSC_con 133733 AA416973 Hs.75798 Human DNA seq from clone 1183121 on chro to predicted fly and worm prote!ns.2.43 EB_cells, Caco2, DU145_cells Con 119977 W88579 Hs.124744 ESTs 2.43 HT29-cells, HMEC (total RNA), HMEC

134921 W60186 Hs.169487 Kreisler2.43 LNCaP-cells, HS578T cells, (mouse) maf-related leucine MB-MDA-053 zip 132295 H66351 Hs.181042 Dmx-like2.43 Lu_SC_H69, BT474 cells, 1 Lu_S(~H520 133395 AA491296 Hs.72805 ESTs 2.43 EB_cells, LNCaP_cells, ~ OVCAR_cells 106728 AA465355 Hs.153768 U3 2.43 EB_cells, Lu_AD H23, PC3_cells snoRNP-associated 55-kDa protein 116370 AA521256 Hs.236204 ESTs; EB_cells, A549_cells, Moderately similarto NUCLEAR 293TCells PORE 2.43 113936 W81552 Hs.83623 nuclear 2.43 293TCells, OVCAR_cells, receptorsubfam!ly 1; group I; Fibroblasts 2 m 128862 861297 Hs.106673 eukaryotic2.43 EB_ce!Is, DU145_cells, translation in!tiation factor DU145-cells 111614 812581 Hs.191146 ESTs 2.43 HMEC (total RNA), Fibroblasts 2, MB-MDA-435s 111993 842241 Hs.106359 ESTs 2.43 A549_cells, DU145_cells, ; CALU6_cells 131554 AA100026 Hs.28669 ESTs; E 2.43 EB_cells, LNCaP_celis, Weakly similar to PROTEIN-TYROSIN Caco2 130983 N71215 Hs.21862 NCK-associated2.42 EB_cells, Caco2, A549_cells protein 1 131654 AA497050 Hs.30204 ESTs 2.42 MCF7, MB-MDA-035s, Lu_SC_H345 105014 AA121123 Hs.191374 ESTs 2.42 EB_cells, Lu_AD-H23, Lu_LC_H460 106300 AA435840 Hs.19114 high-mobility2.42 EB_cells, Lu_SC_H345, group (nonhistone chromoso A549_cells 102386 U40998 Hs.81728 unc119 2.42 OVCAR_cells, EB_cells, (C.elegans) homolog DU145_cells 112517 868589 Hs.23721 ESTs 2.42 Caco2, MCF7, DU145_cells 125375 H72971 KIAA0277 gene product2.42 Lu_SC H345, OVCAR_cells, Lu_SC_H69 123808 AA620552 Hs.25682 ESTs; 2.42 EB_cells, LuJtD 1-123, Weakly similar to PHOSPHATIDYLETHA Lu_SC_H69 114950 AA243503 Hs.11801 adenosine2.42 MB-MDA~453, HT29_cells, A2b receptor pseudogene Lu_LC H460 129906 H39216 Hs.239970 ESTs; 2.41 Lu_SC_H345, Fibroblasts Weakly similar to ZNF91L [H.sapien 2, DU145_cells 103408 X95876 Hs.198252 G protein-coupled2.41 RPWE_2, PRSC_log, Lu SC_H345 receptor9 129703 AA401348 Hs.179999 ESTs 2.41 EB_celis, 293T_cells, DU145_ceils 105693 AA287104 Hs.181368 U5 2.41 293T_cells, CALU6 cells, snRNP-specific protein (220 A549_cells kD); orth 106532 AA453628 Hs.37443 ESTs 2.41 EB_celis, OVCAI~cells, Caco2 132132 AA010933 Hs.4055 core 2.41 HMEC, HMEC (total RNA), promoter element binding protein EB_cells 111409 800311 Hs.18798 EST; 2.41 Lu_SC H345, Lu SC_H69, Weakly s!milar to llll ALU PRSC_con SUBFAMIL

133813 M26657 Hs.250711 dipepGdyl2.41 HT29_cells, BT474_cells, carboxypeptidase 1 (angiotens MB231 cells 127240 AA888387 Hs.243845 ESTs;2.41 Lu_SC_H345, DU145_cells, Moderately sim!lar to 1!!! LNCaP_cells ALU SUB

104975 AA086071 Hs.50758 chromosome-associated2.41 OVCAR cells, DU145_cells, polypeptide C PC3_cells 118078 N54321 Hs.47790 EST 2.41 EB cells, Fibroblasts 2, HMEC (total RNA) 115840 AA429253 Hs.58103 A kinase2.41 OVCAR-cells, EB_cells, (PRKA) anchor prote!n 9 PC3_cells 101186 L20298 Hs.179881 core-binding2.4 EB_cells, DU145_cel!s, factor, beta subun!t CALU6_cells 113098 T40936 Hs.8349 ESTs 2.4 Caco2, HT29_cells, EB_cells 115185 AA259140 Hs.60238 ESTs 2.4 Lu_SC H69, EB cells, Caco2 113778 W15263 Hs.5422 ESTs 2.4 Caco2, MB-MDA-035s, LNCaP-cells 128261 A1061213 Hs.13179 ESTs; 2.4 DU145_cells, LNCaP_cells, Moderately similarto !!!1 ALU OVCAR_cells SUB

132210 AA235013 Hs.42322 A kinase2.4 Caco2, DU145_cells, PRSC_log (PRKA) anchor protein 2 112561 872427 Hs.129873 ESTs; 2.4 Lu_Sf~H520, Lu_AD_H23, Weakly similarto CYTOCHROME EB_cells 127598 AA610677 Hs.168851 ESTs 2.4 LNCaP cells, DU145_cells, OVCAR_cells 106664 AA460969 Hs.7510 mitogen-activated2.4 OVCAR cells, 293T_cells, protein kinase kinase A549 cells 131367 AA456687 Hs.26057 ESTs 2.4 EB-cells, MB-MDA-453, 293T_cells 103163 X67683 H,sapiens mRNA 2.39 EB_cells, Lu~D_H23, Lu_AD-358 for keratin 4 109639 F04444 Hs.6217 ESTs; 2.39 EB_cells, Lu_SC H345, Weakly similarto 1!1! ALU SUBFAMI Lu-SC-H69 112007 842671 Hs.140853 EST; 2.39 MB-MDA-435s, Lu_SC 11345, Weakly similar to !!!! ALU Lu_AD_H23 SUBFAMIL

100023 AFFX control: BioC-3 2.39 Caco2, Lu-AD_358, LNCaP_cells 119923 W86214 Hs.184642 ESTs 2.39 EB-cells, HS578T_celis, DU145_cells 127705 AJ003307 AJ003307 Selected2.39 Lu-AD_H23, Lu_SC_H345, chr 21 cDNA library H Lu LC_H460 130362 AA182658 Hs.179817 DKFZP586F02222.39 EB_cells, DU145_cells, protein PC3-cells 100168 D14874 Hs.394 adrenomedullin2.39 Fibroblasts 2, Caco2, HS578T_cells 134261 AA227678 Hs.8084 Human DNA seq from clone 465N24 on chr 1 Contains two novel genes; ESTs;2.39 PRSC_con, MB-MDA-453, GSSs an LNCaP_cells 103392 X94563 H.sapiens dbUacbp2.38 EB_cells, Lu~4D_H23, gene exon 1 & 2 Lu_SC_H69 129888 U81001 Hs.131891 Human 2.38 LNCaP_cells, Lu SC_H69, SNRPN mRNA; 3' UTR; partial Lu_LC_H460 seq 130119 T12649 Hs.251653 tubulin;2.38 Lu~4D H23, Lu LC H460, beta; 2 Lu_LC_H460 118136 N57710 Hs.233952 proteasome2.38 293T_cells, OVCAR-cells, (prosome; macropain) subunit; HS578T_cells 131163 H80107 Hs.23754 ESTs 2.38 Lu_AD_H23, Lu SC_H69, Lu-SC-H345 115964 AA446622 Hs.74313 ESTs 2.38 EB_cells, LNCaP_cells, DU145_cells 135026 H59730 Hs.93231 ESTs 2.37 EB_cells, 293T_cells, Lu_SC_H69 133300 D51401 Hs.70333 ESTs 2.37 OVCAR cells, Caco2, CALU6_cells 129948 H69281 Hs.13643 ESTs 2.37 EB_celis, Lu~D_H23, Lu-SC-H345 112505 867923 Hs.23368 ESTs 2.37 DU145_cells, OVCAR-cells, 293T_cells 130715 T98227 Hs.171952 occludin2.37 Caco2, LNCaP cells, DU145_cells 120301 AA192163 Hs.104085 EST 2.37 Lu~D_H23, EB-cells, PRSC_c0n 128062 AA379500 Hs.193155 ESTs 2.37 EB-cells, LNCaP_cells, DU145_cells 127154 AA789101 Hs.198860 ESTs;2.37 HS578T_cells, MCF7, Lu Weakly similar to !!!1 ALU SC-H69 SUBFAMI

102814 U90716 Hs.79187 coxsackie2.37 OVCAR-cells, DU145_cells, virus and adenovirus receptor Lu_SC H345 120239 241691 Hs.65919 ESTs 2.37 EB cells, DU145_cells, LNCaP_cells 106829 AA481883 Hs.31236 ESTs; 2.37 EB cells, DU145 cells, Weakly similarto Unknown [H.sapie OVCAR_cells 132681 AA435762 Hs.54894 ESTs; 2.37 EB_cells, LNCaP_cells, Highly similarto unknown [H.sap!e PRSC_con 108845 AA132946 Hs.68864 ESTs 2.36 Lu~D 1123, Lu_AD_358, Lu-S(~H520 133226 T85327 Hs.169552 ESTs 2.36 Caco2, MB-MDA-053, MCF7 106789 AA478726 Hs.26373 ESTs; 2.36 MB-MDA-453, Caco2, OVCAR_cells Moderately similar to !11!
ALU SUB

119236 T10166 Hs.237297 ESTs 2.36 EB_celis, 293' cells, LNCaP_cells 106619 AA459255 Hs.23956 ESTs 2.36 LNCaP_cells, A549_cells, Caco2 109178 AA181600 Hs.62741 ESTs 2.36 Lu_SC_H345, LNCaP_cells, EB_cells 112724 891753 Hs.17757 ESTs 2.36 Caco2, EB_cells, DU145_cells 112655 885069 Hs.141139 ESTs 2.36 Fibroblasts 2, Lu~D_H23, Lu_LC H460 132820 AA454988 Hs.57621 ESTs 2.36 EB_cells, OVCAf~;cells, HS578T_cells 106155 AA425309 Hs.33287 nuclearfactorIIB2.36 OVCAR_cells, Lu_SC_H345, 114632 AA084742 Hs.194380 ESTs;2.35 Lu_SC_H345, Lu-LC H460, Weakly similar to 1!!! ALU Lu-AD-H23 SUBFAMI

134776 J05582 Hs.89603 mucin 2.35 DU145_cells, Lu-AD H23, 1; transmembrane Lu-AD_358 101192 L20859 Hs.78452 solute 2.35 PC3_cells, CALU6 cells, tamer family 20 (phosphate MB-MDA-435s tran 130349 W16686 Hs.171825 bas!c 2.35 A549 cells, DU145 cells, helix-loop-helix domain containing HT29_cells 106389 AA446949 Hs.6236 ESTs 2.35 LNCaP_cells, PC3_cells, DU145 cells 109637 F04426 Hs.23131 k!nesin 2.35 MB-MDA-435s, A549_cells, fam!ly member C3 Lu_LC_H460 101483 M24486 Hs.76768 procollagen-proline;2.35 PC3_cells, HS578T_cells, 2-oxoglutarate 4-di EB_cells 131751 H18335 Hs.31562 ESTs 2.35 DU145 cells, MB231_cells, HMEC

131050 X13967 Hs.2250 leukemia 2.35 Lu_AD H23, PC3_cells, inhibitory factor (cholinergic PRSC-log 130097 N21159 Hs.14845 forkhead2.34 EB_ce!ls, LNCaP_cells, box 03A LNCaP_cells 134533 AA013468 Hs.241493 natural2.34 EB_cells, HT29_cells, killer-tumor recognition seq HMEC

134839 D63479 Hs.115907 diacylglycerol2.34 Lu_LC-H460, Caco2, DU145_cells kinase; delta (130kD) 115690 AA410894 Hs.44159 ESTs 2.34 PC3-cells, EB_cells, OVCAR_cells 129079 N91011 Hs.108502 ESTs 2.34 Lu_AD h123, Lu SC_H69, Lu~D_358 123517 AA608525 Hs.243059 EST 2.34 Lu_SC 11345, PC3 cells, MB-MDA-435s 126239 AA527215 Hs.75879 ribosomal2.34 BT474_cells, Lu LC_H460, protein L19 Lu_AD 1-123 124440 N46435 ESTs 2'.34Lu_SC_H69, HT29_cells, MB-MDA-435s 111468 805809 Hs.205481 ESTs 2.34 Lu_AD_H23, PRSC_log, Lu_SQ.H520 129560 H18428 Hs.113613 ESTs; 2.34 Lu_SC_H69, Lu_SC_H345, Moderately similarto !!!1 ALU LNCaP_cells SUB

104857 AA043219 Hs.19058 ESTs 2.34 Lu_AD_H23, Lu-SC_H345, Lu_SC_H345 109647 F04587 Hs,28241 ESTs 2.34 HS578T_cells, A549_cells, CALU6_cells 117160 H97817 Hs.183302 ESTs 2,34 EB_cells, Fibroblasts 2, Lu_SC-H69 112352 858974 Hs.167343 ESTs 2.34 EB_cells, Lu_SC_H345, HT29_cells 113653 T95745 Hs.187433 ESTs 2.34 MB-MDA~35s, MB-MDA-453, Lu_SC_H345 131606 W56804 Hs.29385 AFG3 (ATPase2.34 OVCAR_cells, Fibroblasts family gene 3; yeast)-like 2, MB-MDA-435s 101525 M29536 Hs.12163 eukaryoflc2.34 EB_cells, Caco2, DU145_cells translaflon inflation factor 125921 AA775029 Hs.122591 ESTs 2.33 293T_cells, PRSC_log, Lu_SC_H345 125775 AA213555 Hs.29205 alpha 2,33 EB_cells, DU145_celis, integrin binding protein 63 LNCaP_cells 108743 AA126917 Ns.71074 ESTs 2.33 Lu-AD_H23, Lu~4D_358, Lu_LC_H460 133735 AC002045 Hs.251928 nuclear2.33 LNCaP_cells, Lu_SC_H69, pore complex interacting protein DU145 cells 120403 AA234916 Hs.243851 ESTs 2.33 MB231 cells, Lu_SC_H345, Lu_SC_H69 134998 802207 Hs.92679 ESTs; 2.33 LNCaP_cells, BT474_cells, Weakly similar to microtubule-base MCF7 108456 AA079326 Hs.143654 ESTs 2.33 HT29_cells, Lu-AD H23, 130552 M86667 Hs.179662 nucleosome2.33 EB_cells, A549_cells, assembly protein 1-like 1 DU145_cells 111114 N63391 Hs.9238 ESTs 2.33 Caco2, EB_cells, MB-MDA-453 127767 AI269498 Hs.125543 ESTs; 2.33 CALU6_cells, 293T_cells, Moderately similar to TADA1 PC3_cells protei 106546 AA454725 Hs.21056 H Sapiens OVCAR cells, Caco2, mRNA from chromosome 5q21-22; LNCaP_cells 2.33 122379 AA446110 Hs.250989 EST 2.33 BT474 cells, Fibroblasts 2, MB-MDA~135s 133650 D84294 Hs.118174 tetraUicopepflde2,33 Lu SC_H345, EB cells, repeat domain 3 EB_cells 106434 AA449099 Hs.8151 ESTs; 2,33 EB-cells, LNCaP_cells, Weakly similar to atopy related Caco2 au 905297 AA233451 Hs.183858 transcripflona!2.33 EB_cells, LNCaP_cells, intermediary factor 1 Caco2 115976 AA447442 Hs.86327 ESTs 2.33 EB_cells, 293T_cells, Lu_SC H69 105788 AA351031 Hs.23965 solute 2.33 EB-cells, Lu-AD h123, carrier family 22 (organic anon Lu_SC H345 113774 W04550 Hs.9927 H Sapiens 2.32 OVCAR_cells, EB_cells, mRNA; cDNA DKFZp564D156 (from Lu_SC_H69 -ESTs; Weakly similar to b3418.1 2.32 Lu_SC 1-1345, Lu_AD_H23, [H.sapie PRSC_con 110617 H68772 Hs.35820 102234 U26312 Hs,8123 chromobox CALU6_cells, LNCaP_cells, homolog 3 (Drosophila HP1 gamm2.32 A549 cells 114777 AA151699 Hs.184519 ESTs; 2.32 HT29 cells, Fibroblasts Weakly similar to !!!! ALU SUBFAMI 2, Lu SC_H345 125518 820148 Hs.193851 ESTs 2.32 HT29 cells, HMEC (total RNA), MB231 cells 130814 AA256695 Hs.19813 ESTs 2.32 MB-MDA-035s, Lu_SC 1169, PRSC_log 123473 AA599143 ESTs; Moderately2.32 LNCaP_cells, DU145_cells, s!milar to !!!! ALU SUB Lu_SC_H345 134310 AA313414 Hs.8148 H sapiens2.32 PC3_cells, LNCaP_cells, clone 24856 mRNA seq; complete OVCAR_cells 119192 885375 Hs.237262 EST 2.32 Lu SC H69, PRSC_log, PRSC_con 114391 AA004876 Hs.133100 ESTs 2.32 PC3_cells, 293T_cells, 293T_cells 119133 849144 Hs.119756 ESTs 2.32 PRSC_log, 293T_cells, 293T_cells 109710 F09792 Hs.12929 ESTs 2.32 Lu_AD Fi23, Lu_SC_H69, Lu_SC_H345 116726 F13681 Hs.42309 ESTs 2.32 MCF7, BT474 cells, MB-MDA~f53 133206 832993 Hs.6762 ESTs; Weakly2.31 DU145_cells, 293T_cells, similar to similar to leucy EB-cells 135163 AA125988 Hs.199955 ESTs 2,31 Lu SC_H345, LNCaP_cells, DU145 cells 111219 N68836 Hs.19247 ESTs 2.31 OVCAR cells, LNCaP_cells, 293T_cells 110283 H29565 Hs.12271 ESTs 2.31 BT474 cells, MB231 cells, MB-MDA~453 103772 AA092473 Hs.8123 chromohox CALU6_cells, MCF7, DU145_cells homolog 3 (Drosophila HP1 gamm2.31 122766 AA459386 Hs.194058 ESTs; 2.31 HT29_cells, BT474 cells, Weakly similar to atypical PKC HMEC
spe 120886 AA365566 Hs.132736 ESTs; 2.31 DU145_cells, A549_cells, Weakly similar to allograft Lu LC_H460 inflam 123512 AA600248 Hs.142245 HERV-H2.31 PC3_cells, 293T_cells, LTR-associaflng 3 DU145-cells 106644 AA460239 Hs.12680 ESTs 2.31 HS578T_cells, MB231 cells, Lu_S(~H520 127359 H72971 KIAA0277 gene product2.31 Lu_SC-H345, DU145-cells, OVCAR_cells 105919 AA402494 Hs.3990 ESTs 2.31 HS578T_cells, DU145 cells, LNCaP-cells 125241 W86291 Hs.121593 ESTs 2.3 HMEC, HMEC (total RNA), EB cells 104624 AA001936 Hs.184721 ESTs 2.3 DU145_celis, PC3_cells, PRSC_log 128765 AA101767 Hs.10494 ESTs 2.3 EB_cells, HMEC (total RNA), Lu_LC-H460 108360 AA071539 zm74b6.s1 Stratagene neuroepithelium (#9 HYDROXYSTEROID DEHYDROGENASEIDELTA-5-DEL 2.3 HT29_celis, RPWE-2, Lu_AD-H23 115682 AA410300 Hs.44618 ESTs 2.3 HT29 cells, Lu_S(~H520, Lu-AD H23 134528 M23161 Hs.84775 Human 2.3 EB_cells, CALU6_celis, t<ansposon-like element mRNA A549_cells 111091 N59858 Hs.33032 H sap!ens 2.3 LNCaP-cells, DU145_cells, mRNA; cDNA DKFZp434N185 (from PRSC_log 134044 AA262475 Hs.78746 phosphodiesterase2.29 DU145_cells, A549_cells, 118229 N62339 Hs.180532 heatshock90kD2.29 MCF7, DU145_cells, EB_cells protein 1; alpha 110188 H20522 Hs.20969 ESTs 2.29 Fibroblasts 2, MB-MDA-435s, Lu_LC H460 125073 T87185 Hs.193638 ESTs; 2.29 EB_cells, Lu SC 1-1345, Weakly similar to !!!! ALU CLASS Lu_SC_H69 C

111495 807210 Hs.19913 ESTs 2.29 CALU6_cells, EB cells, 124024 F03077 Hs.106672 ESTs 2.29 HS578T_cells, RPWE_2, Lu_AD 358 128230 AA984074 Hs.176757 ESTs 2.29 LNCaP_cells, DU145_cells, OVCAR_cells 125471 AA477571 Hs.152601 UDP-glucose2.29 DU145_celis, PRSC_con, ceramide glucosyltransferase PRSC_log 120734 AA299949 EST12545 Uterus 2.28 Lu~D_H23, Lu SC_H345, tumor I H Sapiens cDNA 3 Lu SC H69 134349 AA406373 Hs.8208 ESTs 2.28 DU145_cells, PC3_cells, LNCaP_cells 123412 AA521443 Hs.187763 ESTs 2.28 BT474_cel!s, BT474_cells, Lu SC_H69 116297 AA489042 Hs.59498 ESTs 2.28 EB_cells, 293T_cells, 104476 N33807 Hs.223014 protease;2.28 LNCaP_cells, MCF7, PC3_cells serine;15 101004 J04101 Hs.248109 vets 2.28 HT29_cells, MB-MDA-435s, avian erythroblastosis virus HMEC (total RNA) 109991 H09813 Hs.12896 KIAA1034 2.28 EB_cells, CALU6_cells, protein 293T_cells 118934 N92571 Hs.54808 ESTs 2.28 HS578T_cells, 293T_celis, A549_cells 125096 T94328 Hs.194533 ESTs 2.28 Lu SC_H345, Lu_SC_H69, 293T_cells 117514 N32226 Hs.124058 ESTs 2.28 CALU6_celis, HMEC, Lu_AD

132792 AA401903 Hs.242985 hemoglobin;2.28 OVCAR_cells, Lu_SC_H69, gamma G MCF7 129009 AA131421 Hs.107884 ESTs 2.28 HS578T_cells, CALU6_cells, Caco2 111658 816981ESTs 2.28 MB-MDA-035s, 293T_cells, Hs.15276 A549_cells 112322 855757EST 2.28 Lu SC_H345, Lu_SC_H69, Hs.26457 LuJaD 358 133477 W69310PTK2 protein tyrosine2.28 EB cells, PC3_cells, Hs.740 kinase 2 DU145_cells 132149 T10822ESTs 2.28 LNCaP_cells, EB_cells, Hs.4095 PC3_cells 115119 AA256524Human DNA seq from Hs.46847 clone 30M3 on chromos yeast and archaea 2.27 A549_cells, EB_cells, bacterial genes; LNCaP_cells and 102130 U15009small nuclear ribonucleoprotein2.27 LNCaP_cells, Caco2, EB
Hs.1575 D3 polyp cells 114343 241424ESTs 2.27 HT29_cells, OVCAR_cells, Hs.21259 Fibroblasts 2 106746 AA476436ESTs 2.27 Lu_AD 358, RPWE-2, Lu~4D_H23 Hs.7991 119359 T71021ESTs; Highly similar2.27 Lu_SC_H69, 293TCells, Hs.93334 to WS basio-helix-I DU145_cells 106301 AA435867kinesin family member3B2.27 OVCAR_cells, LNCaP_cells, Hs.168212 EB-cells 130280 L13738activated p21cdc42Hs2.27 MB-MDA~53, DU145_celis, Hs.153937 kinase DU145_cells 119724 W69468ESTs 2.27 PC3_cells, HT29-cells, Hs.47622 A549_cells 108960 AA150199DKFZP586D0919 protein2.27 EB_cells, HS578T_cells, Hs.49378 Lu_AD 358 103489 Y08614exponin 1 (CRM1; 2.26 EB_cells, CALU6_cells, Hs.79090 yeast; homology DU145_cells 107711 AA015736ESTs 2.26 EB_cells, Lu~4D_H23, Hs.220687 Lu~4D_358 131950 W84704ESTs 2.26 HS578T_cells, OVCAR_cells, Hs.35380 MB-MDA-435s 107093 AA609600ESTs 2.26 LNCaP_cells, OVCAR_cells, Hs.10018 DU145 cells 113649 T95641ESTs; Weakly similar2.26 Lu-AD H23, Lu_SC_H69, Hs.16400 to Hrs [H.sapiens] PRSC log 105255 AA227498ESTs 2.26 HS578T_cells, 293T-cells, Hs.3623 Lu SC_H345 130094 H43286gamma-aminobutyric 2.26 Fibroblasts 2, MB231 Hs.167017 acid (GABA) B recepto cells, 293T_cells 111874 837959ESTs 2.26 CALU6_cells, Lu_S(~H520, Hs.13358 293T-cells 107890 AA026030ESTs; Weakly similar2.26 HT29-cells, MB-MDA~453, Hs.61311 to CALPAIN 2; LARGE PC3-cells 124628 N74702ESTs 2.26 293T_cells, CALU6-cells, Hs.102834 CALU6-cells 119707 W67569ESTs; Weakly similarto2.26 293T_cells, OVCAR-cells, Hs.44143 SNF2alpha protei Lu_SC_H345 106737 AA470080ESTs; Moderately 2.26 LNCaP-cells, DU145-cells, Hs.36237 similar to CGI-34 MB-MDA~135s prate 117305 N22798EST 2.26 HT29-cells, BT474 cells, Hs.43248 Fibroblasts 2 134470 X54942CDC28 protein kinase2.26 DU145_cells, CALU6_cells, Hs.83758 2 LNCaP_cells 130734 T99337KIAA1052 protein 2.26 Lu_AD_H23, Lu_SC-H345, Hs.18624 Lu SC_H69 128561 869227ESTs 2.26 Lu-SC_H345, DU145 cells, Hs.101489 OVCAR-cells 100670 HG2992-HBeta-Hexosaminidase,2.26 HT29_cells, BT474 cells, Alpha Polypeptide, Lu_SC_H345 115953 AA443958ESTs 2.26 Caco2, 293T-cells, DU145-cells Hs.90960 129612 H17476ESTs; Highly similar2.25 CALU6-cells, LNCaP-cells, Hs.11615 to map kinase phosp PC3 cells 111362 N91973deoxyribonuclease 2.25 Lu SGLH520, Lu-AD_H23, Hs.23595 III; dnaQimutD RPWE 2 (E. col 116275 AA485453intedeukin 13 receptor,2.25 OVCAR_cells, 293TCells, Hs.250911 alpha 1 DU145_cells 114461 AA024848ESTs 2.25 EB_cells, Lu-AD_H23, Hs.126705 Lu_AD_H23 134083 AA278393ESTs 2.25 293T_cells, EB_cells, Hs.79013 OVCAR_cells 132470 224724H.sapiens polyA 2.25 EB_cells, HS578T_cells, Hs.4934 site DNA Caco2 114718 AA131328zo8d1.s1 Stratagene neuroepithelium SW:COXZ MOUSE P45 2.25 MB-MDA-435s, HT29_cells, CYTOCHROME C OXIDASE Lu_SC hi69 P

129499 840395lecithin-cholesterol2.25 HMEC (total RNA), Fibroblasts Hs.242908 acyltransferase 2, HMEC

124758 838422ESTs 2.25 293T_cells, RPWE_2, Lu_LC
Hs.169168 H460 130301 X83127potassium voltage-gated2.25 EB_cells, OVCAR_cells, Hs.172471 channel; shaker- A549-cells 131263 838334regulator of G-protein2.25 Lu-AD_H23, EB_cells, Hs.24950 signalling 5 Lu-SC_H69 107159 AA621340ESTs; Weakly similar2.25 LNCaP_cells, HMEC, EB_cells Hs.10600 to ORF YKR081c [S.c 133262 N72009ESTs 2.24 Lu_SC H345, DU145_cells, Hs.206710 LNCaP_celis 132985 AA093619KIAA0717 protein 2.24 EB_cells, Lu~ID-H23, Hs.62113 LuJ~D 358 114172 239043ESTs; Weakly similar2.24 293T_cells, CALU6_cells, Hs.21421 to cysteine desulfu Lu_S(~H520 127847 AA913387ESTs 2.24 LNCaP_cells, DU145_cells, Hs.126717 Lu_SC 1169 106499 AA452244ESTs 2.24 Lu_SC_H345, MB-MDA-453, Hs.16727 Lu_SC-H69 105095 AA150088KIAA0917 protein 2.24 DU145_ceils, LNCaP_ceils, Hs.27023 CALU6-cells 108876 AA134361ESTs 2.24 EB_cells, Lu-SC H345, Hs.191453 Lu-AD H23 121971 AA429667ESTs 2.24 Lu_AD FI23, 293T-cells, Hs.120405 CALU6_cells 114334 241342ESTs 2.24 DU145_cells, PC3-cells, Hs.22941 EB_celis 114565 AA063001SH2 domain protein 2.24 Lu LC_H460, MCF7, HMEC
Hs.103527 2A (total RNA) 115766 AA421761ESTs 2.24 Fibroblasts 2, MB-MDA-435s, Hs.77603 MB231-cells 130989 AA608546ESTs 2.24 PC3-cells, LNCaP_celis, Hs.21906 DU145 cells 116304 AA489461H Sapiens mRNA for 2.24 BT474_celis, EB_cells, Hs.64742 KIAA0540 protein; LNCaP-cells par 111154 N66545ESTs 2.24 OVCAR_cells, MB-MDA-435s, Hs.29169 HMEC

105561 AA262881ESTs; Weakly similar2.23 HS578T_cells, A549_cells, Hs.16029 to alternatively HMEC
sp 105939 AA404421ESTs 2.23 EB_cells, LNCaP_cells, Hs.12258 DU145cells 126379 A1085342Homer, neuronal 2.23 HS578T_cells, PC3 cells, Hs.166146 immediate early RPWE 2 gene; 3 106610 AA458882ESTs; Moderately 2.23 DU145_cells, MCF7, Lu_SC_H345 Hs.4832 similar to Lasp-1 prote 132786 AA424545H Sapiens mRNA expressed2.23 EB_cells, Lu_AD H23, Hs.56851 in placenta Fibroblasts 2 107206 D20728ESTs 2.23 BT474_cells, Fibroblasts Hs.30767 2, MB-MDA~t35s 133708 842172synaptophysin 2.23 Lu_SC-H345, CALU6_cells, Hs.75667 Lu_SC_H69 135123 AA227567target of myb1 (chicken)2.23 BT474_cells, MB231 cells, Hs.9482 homolog EB cells 132156 AA157401S-adenosylhomocysteine2.23 DU145_cells, 293TCells, Hs.4113 hydrolase-like LNCaP_cells 116934 H75624ESTs 2.23 CALU6_cells, Lu_SC_H345, Hs.39662 Lu_LC Ii460 133660 887373ym88e05.r1 Soares adult brain N2b4HB55Y

IMAGE:166016 5', 2.23 DU145_cells, A549_cells, mRNA seq. PC3_celis 119468 W23633 2.23 293T_cells, MB-MDA-453, Hs.125043 OVCAR_celis ESTs 101247 L33801glycogen synthase 2.23 LNCaP_cells, EB_cells, Hs.78802 kinase 3 beta MB-MDA-435s 126008 AA253460zs06f04.s1 NCI_CGAP_GCB1 2.23 HT29_cells, PRSC_log, H sapiens cDNA Fibroblasts 2 122938 AA477119zu37c7.s1 Soares ovary tumor NbHOT
H sap TR:G288289 6288289 2.23 PC3_cells, MCF7, MITOCHONDRIAL D-LOOP MB-MDA~t35s 114148 238604 Hs.184777 ESTs; Moderately similar to OPIOID BINDI
MOLECULE PRECURSOR [H.sapiens] 2.23 HS578T_cells, Fibroblasts 2, Lu_SC_H345 103433 X98001 Hs.78948 Rab geranylgeranyltransferase;2.22 LNCaP_cells, EB_cells, beta subu 293T-cells 132954 AA027112 Hs.216194 ESTs 2.22 EB_cells, Lu_AD H23, Fibroblasts 2 133228 N90029 Hs.6831 H sapiens2.22 293T_cells, PC3_cells, clone 1400 unknown protein DU145 cells mRN

103891 AA242887 Hs.124186 ring 2.22 EB_cells, Lu_SC H69, finger protein 2 Lu_SC_H345 124883 875630 Hs.177242 ESTs 2.22 EB_cells, Lu_AD Fi23, ~ Lu_SC H345 109921 H05734 Hs.30559 2.22 Lu_S(~H520, 293T_cells, ESTs RPWE_2 127306 AI305162 Hs.193687 ESTs 2.22 MCF7, HT29_cells, MB-MDA-053 102707 U77456 Hs.78103 nucleosome2.22 Caco2, EB_cells, CALU6_cells assembly protein 1-like 4 106193 AA427625 Hs.23272 ESTs 2.22 293TCells, EB_cells, A549-cells 118819 N79045 Hs.50800 ESTs; 2.22 Lu SC H345, Lu SC_H69, Weakly similar to 111! ALU DU145 cells SUBFAMI

134326 U16306 Hs.81800 chondroitin2.22 HS578T_cells, PRSC_log, sulfate proteoglycan 2 (vers CALU6_cells 112241 851248 Hs.16027 ESTs 2.22 293T_cells, HMEC (total RNA), HMEC (total RNA) 123693 AA609591 Hs.112728 ESTs 2.22 HT29_cells, HMEC (total RNA), BT474_cells 129052 AA496297 Hs.182740 ribosomal2.22 EB_cells, Lu_AD Vi23, protein S11 Lu_AD_358 122481 AA448271 Hs.99126 ESTs 2.21 Lu_AD 1123, HT29_cells, Lu~D_358 128895 837753 Hs.106985 ESTs 2.21 EB_cells, Lu-AD H23, Lu_SC_H345 124691 805835 Hs.110153 ESTs; 2.21 EB_cells, LuJ~ID_H23, Weakly similar to B-CELL GROWTH Lu-AD-358 FA

131556 AA442853 Hs.2869 cyclin-dependent2.21 HT29_cells, Lu LC H460, kinase 5; regulatory su Lu_SC H69 128869 AA424570 Hs.106736 ESTs 2.21 EB-cells, Lu-AD H23, Lu-SC_H69 107114 AA610089 Hs.11776 U41U6-associated2.21 MCF7, Lu_SC_H345, DU145_cells RNA splicing factor 106255 AA431191 Hs.161489 ESTs 2.21 EB_cells, Caco2, DU145_cells 130724 AA370091 Hs.179680 ESTs 2.2 EB_cells, Lu~4D_H23, Lu_SC_H69 105483 AA255874 Hs.23458 ESTs 2.2 LNCaP cells, DU145_cells, PC3_cells 118970 N93503 Hs.54961 stoned 2.2 293T_cells, HS578T_cells, BfTFHA-alphalbeta-Pike factor OVCAR_cells 120805 AA346041 Hs.96844 ESTs 2.2 HT29_cells, HS578T_cells, 293T_cells 106158 AA425382 Hs.6553 ESTs 2.2 CALU6 cells, PC3_cells, EB cells 102121 U14391 Hs.82251 myosin 2.2 A549_cells, EB-cells, IC Caco2 109446 AA232125 Hs.87062 ESTs 2.2 HT29_cells, Lu LC H460, CALU6 cells 129515 AA490882 Hs.112227 ESTs 2.2 Lu_SC FI345, BT474 cells, Caco2 113128 T49325 Hs.8977 ESTs 2.2 Lu_S(~H520, Lu_AD_H23, Lu~4D 358 127289 A1041014 Hs.220752 ESTs 2.2 EB_cells, Lu-AD H23, Lu-AD H23 129912 AA047344 Hs.107213 ESTs;2.2 CALU6_cells, A549_cells, Highly similar to NY-REN-6 EB cells antigen 115700 AA411685 Hs.67709 ESTs 2.2 OVCAR_cells, EB-cells, Caco2 106267 AA431873 Hs.4988 H sapiens2.2 Lu-SC~H520, EB_cells, clone 24711 mRNA seq PC3 cells 112881 T03593 Hs.182814 ESTs 2.19 A549_cells, OVCAR_cells, 293TCells 116902 H70739 yu69f11.s1 Weizmann Olfactory Epithelium IMAGE:239085 3' similar to contains2.19 LNCaP_cells, DU145_cells, LTR PC3 cells 105621 AA280865 Hs.6375 H sapiens 2.19 HMEC, Caco2, HMEC
mRNA; cDNA DKFZp564K0222 (from (total RNA) 126991 831652 Hs.821 biglycan 2.19 Fibroblasts 2, Lu_SC_H69, HS578T cells 125466 808234 Hs.180461 ESTs 2.19 Lu~4D 358, Lu~ID 1123, Lu_S(~H520 108491 AA082973 zn7g1.s1 Stratagene hNT neuron (#937233) to gb:M3672 6S RIBOSOMAL PROTEIN 2.19 Lu_AD 358, RPWE
L7A (H 2, Lu LC-H460 109978 H09356 Hs.22528 ESTs 2.19 PRSC-log, Lu-SC_H345, Lu_SC_H69 106990 AA521354 Hs.24758 ESTs - 2.19EB_cells, LNCaP_cells, OVCAR-cells 122362 AA443919 Hs.96840 ESTs 2.19 EB-cells, Lu-AD 358, PRSC_con 125367 A1016490 Hs.81964 SEC24 2.19 HT29 cells, Lu SC H69, (S. cerevisiae) related gene Lu-AD H23 famil 110716 H97188 Hs.35096 ESTs 2.19 DU145 cells, Fibroblasts 2, PRSC con 129297 811267 Hs.180570 H Sapiens2.19 293T_cells, MB-MDA-435s, chromosome 19; cosmid F22329 A549_cells 104992 AA102652 Hs.22753 ESTs; 2.18 MCF7, MB-MDA-453, Lu_St~H520 Weakly similar to coded for by C.

119896 W84738 Hs.137319 ESTs 2.18 293T_cells, 293T_cells, OVCAR_cells 118594 N69022 Hs.49599 ESTs 2.18 Lu SC H69, Lu_AD H23, Lu SC_H345 129786 H98977 Hs.246109 ESTs 2.18 293TCells, 293T-cells, 293T_cells 104325 D81608 Hs.150675 polymerase2.18 PC3_cells, Lu_SC_H345, (RNA) II (DNA directed) polyp LNCaP-cells 123022 AA480909 aa28f10.s1 NCI_CGAP_GCB1 H sapiens cDNA

Alu repetitive element;contains2.18 OVCAR cells, DU145_cells, element LNCaP_cells 133572 W94333 Hs.7499 translocase2.18 Caco2, LNCaP_cells, of inner mitochondrial membr Lu_SG~H520 133363 AA479713 Hs.71962 ESTs 2.18 EB_cells, Lu_AD H23, Fibroblasts 2 135361 AA053319 Hs.167700 ESTs 2.18 EB_cells, 293T_cells, Caco2 128319 AA808904 Hs.115095 ESTs; 2.18 Lu-SC 11345, OVCAR_cells, Weakly similar to RHO-RELATED
GTP-DU145_cells 128660 AA011597 Hs.177398 ESTs 2.18 EB cells, Lu~D-H23, Lu-S(~H520 114877 AA235618 Hs.205125 ESTs 2.18 DU145_cells, 293T_cells, OVCAR_cells 125925 H28737 ESTs; Moderately 2.18 Lu SC_H69, Lu_SC H345, similarto !!!1 ALU SUB HS578T_cells 113427 T85105 Hs.15471 ESTs 2.18 EB cells, Lu_AD H23, Lu_SC-H69 117500 N31909 Hs.44278 ESTs 2.18 PRSC_con, Lu-SC H345, PRSC_log 131384 F13608 Hs.26226 ESTs 2.18 293T-cells, LNCaP_cells, OVCAR_cells 134499 U70370 Hs.84136 paired-like2.18 Caco2, BT474_cells, homeodomain transcription fa MB231 cells 128154 AA922969 Hs.127100 ESTs 2.17 MB-MDA-453, MB-MDA-453, Lu_SC_H345 134585 T48154 Hs.168655 H sapiens2.17 LNCaP_cells, 293TCells, mRNA for H-2K binding factor-2 PRSC_log 104987 AA101723 Hs.16683 ESTs 2.17 EB_cells, MCF7, DU145_cells 132992 AA091017 Hs.6226 ESTs 2.17 Caco2, LNCaP_cells, DU145 cells 135311 M36089 Hs.98493 X-ray 2.17 HMEC (total RNA), Fibroblasts repair complementing defective 2, HMEC
rep 113171 T54613 Hs.9761 EST 2.17 HT29_cells, PRSC_con, Lu_S(~H520 117736 N46999 Hs.46648 ESTs 2.16 PRSC_log, OVCARCeIIs, A549_cells 125181 W58461 Hs.12396 ESTs 2.16 LNCaP_cells, DU145_cells, 293T_cells 120187 240251 Hs.56974 ESTs 2.16 LNCaP_cells, MB-MDA-453, HMEC (total RNA) 100308 D50532 Hs.54403 macrophage2.16 HT29 cells, Lu_AD H23, lectin 2 (calcium dependent) Lu~4D_H23 110960 N50887 Hs.26549 ESTs; 2.16 Caco2, A549_cells, LNCaP_cells Weakly similar to KIAA0449 protein 113608 T93113 ESTs; Moderately 2.16 Lu SC_H69, CALU6_cells, similarto Illl ALU SUB 293TCells 107538 221089 Hs.50094 ESTs; 2.16 HS578T_cells, 293T_cells, Weakly similar to KALIRIN [R.norve DU145_cells 128703 S76992 Hs.104005 vav 2 2.16 RPWE_2, Lu_SC_H69, HT29_cells oncogene 126065 AI366484 ESTs 2.16 293T_cells, CALU6_cells, A549_cells 130000 AA465727 Hs.124084 ESTs; 2.16 DU145_cells, LNCaP_cells, Weakly similar to !I!1 ALU SUBFAMI OVCAR_cells 120407 AA235040 Hs.107283 ESTs 2.16 EB cells, 293Tcells, A549-cells 121199 AA400371 Hs.97792 ESTs 2.16 Lu-AD-358, Lu~D_H23, A549_cells 114963 AA243867 Hs.193055 ESTs 2.16 DU145_cells, PRSC_con, LNCaP_cells 100343 D63874 Hs.189509 high-mobility2.15 CALU6_cells, MB-MDA-453, group (nonhistone chromoso Caco2 125077 T88822 yd32f5.s1 Soaresfetal2.15 Lu~4D_H23, Lu_SC_H69, liver spleen 1NFL Lu_SC_H345 117286 N22181 yw36d12.s1 Morton 2.15 293T_cells, Lu_SC Fi345, Fetal Cochlea H sapien Lu SC_H69 132876 AA130603 Hs.169683 ESTs; 2.15 EB cells, LNCaP_cells, Moderately similar to !1!! ALU HS578T_cells SUB

133834 AA147510 Hs.154737 serine2.15 DU145_cells, EB_cells, protease; umbilical endothelium Caco2 126908 AA169866 ESTs; Weakly 2.15 DU145-cells, LNCaP_ceNs, similar to ttll ALU SUBFAMI OVCAR_cells 106900 AA490142 Hs.6193 ESTs 2.15 Fibroblasts 2, Lu-AD-H23, PRSC-con 129398 AA437374 Hs.234573 H sapiens2.15 MCF7, DU145_cells, LNCaP_cells mRNA forTL132 114512 AA044274 Hs.165215 ESTs 2.15 Lu_AD 358, MB-MDA-453, HS578T-cells 134381 U56637 Hs.184270 capping 2.15 LNCaP_cells, EB cells, protein (actin filament) muscle PC3-cells 118848 N80671 Hs.220255 ESTs 2.14 EB-cells, DU145_cells, 115526 AA342049 Hs.69606 ESTs 2.14 293TCells, Caco2, Lu_SC

123460 AA598981 Hs.251122 EST 2.14 Lu SC H345, DU145_cells, 119812 W73951 Hs.58348 ESTs; 2.14 293T-cells, HS578T_cells, Weakly similar to CORNIFIN A CALU6_celis [H.sa 105263 AA227926 Hs.6682 ESTs 2.14 A549 cells, HMEC (total RNA), EB_cells 129242 W81679 Hs.5174 ribosomal 2.14 293T_cells, CALU6_celis, protein S17 HMEC (total RNA) 132348 AA037285 Hs.170311 heterogeneous2.14 A549_cells, HT29_cells, nuclear ribonucleoprotein Lu_S(~H520 114425 AA015763 Hs.132812 ESTs 2.14 293TCells, HS578T_celis, PRSC_con 127759 AI369384 arylsulfatase 2.14 DU145 cells, LNCaP_celis, D EB-cells 134069 U29607 Hs.78935 methionine2.14 Lu-SC-H345, DU145_cells, aminopeptidase; eIF-2-associa MCF7 116158 AA461187 Hs.61762 ESTs 2.14 Lu_SC FI69, MCF7, MB-MDA-453 125627 835166 Hs.14881 ESTs 2.14 HT29_cells, Fibroblasts 2, BT474_cells 118684 N71364 Hs.109510 ESTs 2.14 OVCAR cells, PRSC_con, HS578T_cells 119419 T97977 Hs.60260 ESTs 2.14 Lu~,D 1123, Lu_SGLH520, Lu-SGLH520 133097 N67515 Hs.6479 ESTs; Weakly2.14 EB_celis, Lu_AD_H23, similar to KIAA0872 protein Lu~D_358 112121 845445 Hs.252723 H sapiens 2.13 Lu_AD 1-123, Lu-AD_358, mRNA; cDNA DKFZp434D115 (from BT474-cells 114894 AA236019 Hs.188803 ESTs 2.13 MB-MDA~f53, MCF7, Lu_S(LH520 124087 H08773 y194d5.s1 Soares 2.13 Lu_SC 1169, Fibroblasts infant brain 1NIB H sap 2, HMEC (total RNA) 111902 839191 Hs.109445 KIAA10202.13 Caco2, 293T-cells, Lu_SC
protein H69 119943 W86835 Hs.14158 copine 2.13 LNCaP_cells, PC3_cells, III HS578T_cells 109276 AA196306 Hs.86045 ESTs 2.13 Lu-SC-H345, Lu_SC-H69, Lu LC H460 117351 N24581 Hs.43230 ESTs 2.13 HS578T_cells, CALU6_cells, PRSC_con 116046 AA453461 Hs.94491 H sapiens2.13 LNCaP cells, Caco2, EB
clone 23585 mRNA seq cells 112785 896478 Hs.16586 ESTs 2.13 EB_cells, LullD_H23, Lu_SC-H69 115835 AA428576 Hs.41371 ESTs 2.13 EB_cells, Lu-SC-H345, OVCAR_cells 127499 T49891 Hs.119252 tumor 2.13 EB_cells, PRSC_con, LNCaP_cells protein;translationally-controlle 129951 AA019475 Hs.74615 platelet-derived2.13 EB cells, Lu-AD_H23, growth factor receptor, Lu SC_H69 124270 H79560 Hs.107840 ESTs 2.13 OVCAR_cells, 293T-cells, 293T_cells 133766 D52420 Hs.184326 cell 2.12 CALU6 cells, DU145-cells, division cycle 10 (homologous PC3_cells to CD

109248 AA194720 Hs.189996 ESTs; 2.12 HT29_cells, MB231 cells, Highly similarto sec61 homolog HMEC (total RNA) [H

106724 AA465226 Hs,28631 ESTs 2.12 EB-cells, 293T_cells, DU145-cells 100571 HG2264-H Atpase, Ca2+Transporting,2.12 EB_celis, Lu_AD_H23, Plasma Membra Lu SC_H69 133017 AA450187 Hs.178518 ESTs 2.12 OVCAR_cells, PC3_celis, 293T_cells 124313 H94650 Hs.108002 ESTs 2.12 MB-MDA-453, Lu_SC-H345, HT29_cells 113059 T26925 Hs.172684 vesicle-associated2.12 MB-MDA-053, PC3_cells, membrane protein 8 (e LNCaP_cells 113241 T63313 Hs.226136 ESTs; 2.12 HMEC (total RNA), BT474_cells, Moderately similarto 1!1! ALU HMEC
SUB

111952 840782 Hs.21296 ESTs 2.12 HT29_cells, PC3_cells, A549 cells 113965 W$6519 Hs.19631 ESTs 2.12 PC3_celis, EB_cells, LNCaP_cells 108059 AA043944 Hs.62663 ESTs 2.12 EB_celis, OVCAR_cells, 293T_cells 124235 H63994 Hs.221134 ESTs 2.12 Fibroblasts 2, MB-MDA-453, PRSC_con 106400 AA447621 Hs.31257 ESTs 2.12 DU145_cells, EB_cells, Caco2 119590 W44798 Hs.55876 ESTs 2.12 PRSC_log, Lu_SC_H69, Lu_SC H345 112434 863068 Hs.159793 EST 2.11 HS578T_cells, LNCaP_cells, OVCAR_cells 122731 AA457549 aa92b1.s1 Stratagene fetal retina 93722 gb:X5275_ma3 LEUKOSIALIN PRECURSOR 2.11 MB-MDAlf53, RPWE
(HU 2 MCF7 115348 AA281562 Hs.88860 ESTs 2.11 EB_cells, Lu~D_H23, Fibroblasts 128873 AA226768 Hs.109463 ESTs; 2.11 MB-MDA-435s, EB_cells, Weakly similar to predicted LNCaP_cells using 133742 T54301 Hs.75844 ESTs 2.11 EB_cells, CALU6_cells, DU145_cells 102099 U11870 Hs.194778 intedeukin2.11 Lu_AD_358, PC3_cells, 8 receptor; alpha PRSC_con 125840 H05787 Hs.12064 ubiquitin2.11 EB_cells, LNCaP_celis, specific protease 22 Caco2 105501 AA256604 Hs.31930 ESTs 2.1 Fibroblasts 2, HS578T_cells, MB-MDA-435s 111576 810334 Hs.15489 ESTs 2.1 Lu_SC_H69, PRSC_log, Lu_SC H345 104275 C02170 Hs.39387 ESTs; 2.1 HT29_cells, MB231 cells, Weakly similar to weak similarity Lu_SC_H69 117803 N48620 Hs.28483 pregnancy2.1 HT29_cells, HMEC, RPWE
specific beta-1-glycoprotein 2 122725 AA457407 Hs.152204 transmembrane2.1 Lu_SC_H69, Lu_LC Fi460, protease; serine 2 Lu SC_H345 120987 AA398233 Hs.111894 KIAA01082.1 Fibroblasts 2, PRSC con, gene product MCF7 105932 AA403305 Hs.12185 ESTs; 2.1 LNCaP_cells, MCF7, OVCAR_cells Weakly similar to myosin phosphata 118398 N64706 Hs.137282 ESTs 2.1 Lu_SC Vi345, HT29_cells, HMEC

103679 286000 Human DNA seq from PAC 151814 on chromos receptor subtype 3 (SSTR3), tRNA,2.1 CALU6_cells, A549 cells, ESTs, Lu_SC_H345 130303 L-40392 Hs.180789 H sapiens2.1 PC3_cells, DU145 cells, (clone S164) mRNA; 3' end of LNCaP cells c 122815 AA461080 Hs.139446 ESTs 2.1 HT29_cells, BT474_cells, MB231 cells 105598 AA279439 Hs.20594 ESTs; 2.1 EB_cells, Lu_SC H345, Weakly similarto misato [D.melano LNCaP_cells 124869 869088 Hs.28728 ESTs; Weakly2.1 HT29_cells, BT474_cells, similarto F55A12.9 [C.eleg MB231 cells 129599 F10720 Hs.180804 ESTs 2.1 HS578T_cells, HT29_cells, HT29_cells 110338 H40359 Hs.177256 ESTs 2.09 MCF7, A549_cells, MB-MDA-435s 134092 H17490 Hs.7905 ESTs; Highly2.09 EB_cells, Fibroblasts similar to sorting nexin 9 2, HS578T_celis 133002 AF006082 Hs.62461 ARP2 2.09 EB_cells, HS578T_cells, (actin-related protein 2; yeast) A549 cells ho 115570 AA398343 Hs.94943 ESTs 2.09 Lu SC h1345, PC3_cells, LNCaP_cells 120055 W93299 Hs.59363 ESTs; Weakly2.09 HMEC (total RNA), HS578T_cells, similar to cytokeratin 20 [ HS578T_cells 116332 AA491208 Hs.62620 ESTs 2.09 EB_cells, Lu_AD_H23, Lu-SC_H69 105415 AA243768 Hs.4232 ESTs; 2.09 LNCaP_cells, Lu~4D_H23, Highly similar to match to ESTs MB-MDA~t53 116607 D80354 Hs.256321 EST 2.09 LNCaP_cells, DU145_cells, 126731 AA593973 Hs.232217 ESTs; 2.09 MB231 cells, HT29_cells, Weakly similarto !!!I ALU SUBFAMI HMEC

102276 U30999 Hs.10247 activated 2.09 PC3_cells, HS578T_celis, leucocyte cell adhesion molecu DU145 cells 113666 T96077 Hs.17738 EST 2.09 Lu-AD FI23, Lu~D_H23, Lu-S(LH520 101183 L19779 Hs.795 H2A histone 2.09 LNCaP_cells, MCF7, OVCAR_cells family; member 0 112177 849025 Hs.22996 ESTs 2.09 Lu_AD 1123, Lu-AD-358, Lu SC H69 115038 AA252360 Hs.87968 ESTs 2.08 BT474 cells, MB231 cells, HT29_cells 109638 F04432 Hs.17904 ESTs 2.08 EB_cells, DU145-cells, PC3_cells 109592 F02475 Hs.26370 ESTs 2.08 Lu~D_H23, Lu_S(LH520, Lu LC H460 133740 U68142 Hs.170160 RAB2; 2.08 LNCaP_cells, MB-MDA-453, member RAS oncogene family-like EB cells 126716 AA031700 Hs.251962 ESTs 2.08 HS578T_cells, Fibroblasts 2, Lu_SC_H69 124055 F10904 Hs.100516 H sapiens2.08 Lu_SC H345, OVCAR_cells, clone 23605 mRNA seq DU145_cells 113283 T66813 Hs.12947 EST 2.08 EB_cells, Lu_SC_H69, Lu~D_H23 120097 W95068 Hs.59621 ESTs 2.08 HS578T_cells, A549_cells, CALU6_cells 102066 U08471 Hs.352 folate receptor2.08 EB-cells, Lu-AD-H23, 3 (gamma) Lu~4D_358 108712 AA121993 zm24d11.s1 Stratagene pancreas (#93728) similarto gb:Y433 GLUTATHIONE 2.08 Lu_S(LH520, HT29 PEROXIDAS cells, BT474_cells 134453 X70683 Hs.83484 SRY (sex 2.08 EB cells, Lu SC H345, determining region Y)-box 4 Lu SC 1-169 103883 AA232836 Hs.87363 ESTs 2.08 HT29 cells, 293T_celis, 293T_cells 105313 AA233856 Hs.16930 ESTs 2.08 DU145_cells, MB-MDA-435s, HS578T_cells 113669 T96148 Hs.17762 ESTs 2.08 EB_cells, Lu_S(LH520, Fibroblasts 2 120380 AA227904 Hs.104223 ESTs 2.08 293T_celis, CALU6-cells, A549-cells 121045 AA398554 Hs.181012 double-stranded2.08 293T_cells, PC3_cells, RNA-binding zinc finger OVCAI~cells 104949 AA070735 Hs.146090 ESTs 2.08 Lu-SC-H69, Lu-SC-H345, 118751 N74210 Hs.50454 EST 2.08 Lu_AD H23, Lu_SC_H69, Lu_SC_H345 112399 860920 Hs.26419 H Sapiens 2.08 EB_cells, Lu-AD-H23, clone 24510 mRNA seq Lu_SC_H69 129994 AA599443 Hs.38194 ESTs; 2.08 DU145_cells, EB_cells, Moderately similar to !!ll ALU HS578T_cells SUB

116402 AA600054 Hs.65302 ESTs 2.08 HT29 cells, BT474_cells, Lu-AD_H23 125307 240583 Hs.101259 ESTs 2.08 HMEC, HMEC (total RNA), EB_cells 105047 AA132453 Hs.15396 ESTs 2.08 Caco2, HT29_cells, LNCaP_cells 128659 T95280 Hs.103315 trinucleotide2.08 EB_cells, Lu~,D_H23, repeat containing 1 Lu_SC_H69 122301 AA437378 Hs.98791 ESTs 2.08 Lu SC FI345, Lu AD H23, Lu AD 358 121974 AA429804 Hs.229675 EST 2.08 HS578T_cells, 293T_celis, OVCAR_cells 116905 H71420 ys8c12.s1 Soaresfetal liver spleen 1NFL

3' similar to contains Alu repetitive2.08 Lu_AD 1-123, EB_celis, a PRSC_con 106703 AA463979 Hs.21264 KIAA07822.08 EB_cells, Caco2, PRSC_con protein 121908 AA427858 Hs.98534 EST 2.07 293T_cells, Lu_SC_H345, CALU6_cells 135119 T23992 Hs.94769 ESTs; Moderately2.07 HS578T_cells, PRSC_con, similar to RAS-RELATED OVCAR_cells 103558 219574 Hs.2785 keratin 2.07 RPWE_2, HMEC (total RNA), 124209 H57317 Hs.193433 ESTs 2.07 Fibroblasts 2, OVCAR_cells, 293T_cells 133936 AA045083 Hs.77719 gamma-glutamyl2.07 Fibroblasts 2, MB-MDA-453, carboxylase PRSC_con 116246 AA479961 Hs.42913 ESTs; 2.07 EB_cells, LNCaP_cells, Highly similarto ubiquitin-conjug LNCaP_cells 123230 AA490134 Hs.105308 EST 2.07 Lu_AD-H23, Lu_SC_H69, Lu_SC_H345 127378 AA452696 zx39b05.r1 Soares_total_fetus Nb2HF8_9w to contains Alu repetitive element;cont2.07 HS578T_cells, LNCaP_cells, EB_cells 110464 H53013 Hs.221901 ESTs 2.07 Fibroblasts 2, Lu_S(~,H520, Lu_SQ-H520 135191 X07619 Hs.169876 cytochrome P450; subfamily IID (debrisoq polypeptide 7a (pseudogene) 2.07 Lu_AD_H23, Lu SC_H69, Lu~D_358 101267 L36818 Hs.75339 inositol 2.07 Lu_SC_H345, OVCAR_cells, polyphosphate phosphatase-like Caco2 105185 AA191495 Hs.189937 ESTs 2.07 Lu_SC_H69, Lu~D_H23, Lu_SC_H345 125366 H60192 Hs.76853 ESTs; Weakly2.07 DU145_celis, Lu LC_H460, similar to human homolog of Lu AD 358 117472 N30131 Hs.93738 DKFZP434M0982.07 EB_cells, Lu-SC_H69, protein 293T_cells 114235 239710 Hs.25341 ESTs 2.07 DU145_cells, BT474_cells, Lu_SC_H69 109081 AA165268 Hs.72488 ESTs 2.07 Lu_SC 1169, Lu_SC_H345, PC3_cells 112596 878212 Hs.163705 ESTs 2.07 MB-MDA-435s, Lu_St~H520, 109254 AA194940 Hs.85956 ESTs; 2.07 HS578T_cells, 293T_cells, Weakly similar to line-1 protein OVCAR_cells 105898 AA401144 Hs.27354 ESTs 2.07 EB_~Ils, 293T_cells, PRSC_con 116290 AA488691 Hs.57969 phenylalanine-tRNA2.06 Lu_AD_H23, Lu_SC_H345, synthetase PRSC_Iog 122529 AA449828 Hs.99229 ESTs 2.06 DU145_cells, HS578T_cells, 293T_cells 104612 899199 Hs.173063 transducin-like2.06 MB-MDA-435s, 293T_cells, enhancer of split 2; hom 293T_cells 116465 AA621650 Hs.41045 ESTs; 2.06 MB231_cells, HT29_cells, Weakly similar to KIAA0734 protein Lu_AD_358 123155 AA488414 Hs.76127 hect (homologous to the E6-AP (UBE3A) ca domain (RLD) 1 2.06 DU145_cells, CALU6 cells, PC3_cells 126752 A1073373 Hs.183275 ESTs 2.06 LNCaP_celis, EB_cells, DU145_cells 126455 N80749 Hs.111515 ESTs; 2.06 CALU6 cells, PRSC log, Weakly similar to predicted OVCAR_cells using 129339 877869 Hs.28506 ESTs 2.06 EB_cells, BT474 cells, Lu-AD_H23 115021 AA252028 Hs.39168 ESTs 2.06 Lu_S(~H520, Fibroblasts 2, EB_celis 129054 T67231 Hs.168289 succ!nate2.06 Caco2, LNCaP_cells, EB_cells dehydrogenase complex; subunit 101261 L35545 Hs.82353 endothelial2.06 EB_cells, RPWE_2, DU145_cells cell protein Clactivated pro 132697 AA281951 Hs.5518 H sap!ens 2.06 OVCAR_cells, LNCaP_cells, mRNA; cDNA DKFZp566J2146 (from DU145 cells 124380 N26536 Hs.84999 ATPase; 2.06 Caco2, Caco2, 293T_cells Cu++transporting; beta polypept 103967 AA303711 Hs.144700 ephrin-B12.06 HT29_cells, HMEC (total RNA), HMEC

119403 T92935 Hs.119908 ESTs; 2.06 HMEC, EB_cells, HMEC (total Highly similar to nucleolar RNA) protei 125755 866080 Hs.191268 H sap!ens 2.06 LNCaP_cells, DU145-cells, mRNA; cDNA DKFZp434N174 (from OVCAR_ce!Is 101843 M93405 Hs.170008 methylmalonate-semialdehyde LNCaP_cells, MB-MDA-453, dehydrogenas 2.05 EB cells 113032 T24024 Hs.7387 DKFZP564B1162.05 EB_cells, A549 cells, A549-cells protein 112563 872632 Hs.29282 ESTs 2.05 MCF7, HS578T_cells, PRSC-con 126432 AA583825 Hs.235860 ESTs 2.05 MB231 cells, HT29_cells, Fibroblasts 2 101636 M57763 Hs.89474 ADP-ribosylationfactor62.05 DU145-cells, LNCaP_cells, PC3 cells 125174 W51835 Hs.231082 EST 2.05 EB_cells, Fibroblasts 2, Lu_AD H23 106168 AA425943 Hs.82208 acyl-Coenryme2.05 OVCAR_cells, PC3_cells, A dehydrogenase; very long EB
cells 135343 AA236796 Hs.9914 follistatin2.05 _ HMEC (total RNA), PC3_cells HMEC

105267 AA227956 Hs.25348 follistatin-like2.05 HMEC, RPWE_2, HMEC (total 3 (secreted glycoprotei RNA) 134331 AA452020 Hs.234156 ESTs; 2.05 EB-cells, CALU6_cells, Weakly sim!lar to CGI-128 protein A549-cells 121634 AA417012 Hs.28921 ESTs 2.05 HS578T_cells, EB cells, Lu_SC-H345 131394 872637 Hs.26343 ESTs 2.05 EB_cells, Lu_SC H69, Lu~ID_H23 111526 808260 Hs.20131 ESTs 2.05 Lu_AD H23, Lu_SC_H69, BT474 cells 125049 T79840 Hs.111798 ESTs 2.05 HT29_cells, LuJ~D_H23, Lu_SC_H345 120433 AA237077 Hs.180777 H sap!ens 2.05 DU145_cells, CALU6_cells, mRNA; cDNA DKFZp564M0264 (from PC3_cells 129498 AA449789 Hs.75511 connective2.05 HS578T_cells, PRSC_log, tissue growth factor PRSC con 127805 AA740921 Hs.1197 heat 2.05 DU145_cells, LNCaP_cells, shock lOkD protein 1 (chaperon!n OVCAR_~Ils 109275 AA196287 Hs.20303 ESTs; 2.05 EB_cells, MB-MDA-053, Fibroblasts Moderately similar to !!!! ALU 2 SUB

120683 AA290987 Hs.49657 ESTs; 2.04 Lu_AD 358, Lu-S(~H520, Weakly similar to contains similar Lu LC_H460 135415 X60655 Hs.99967 even-skipped2.04 Lu~ID_H23, RPWE 2, Lu-S(~H520 homeo box 1 (homolog of Dro 132925 AA252759 Hs.238296 DKFZP434A0332.04 293T-cells, HS578T_cells, protein LNCaP cells 101875 M97287 Hs.74592 special 2.04 EB-cells, Lu SC 1169, 293T-cells AT-rich seq binding protein 1 (b 101463 M22490 Hs.68879 bone morphogenetic2.04 PRSC-con, HT29_cells, MB231 prote!n 4 cells 129177 T95005 Hs.209587 ESTs 2.04 293T_cells, MB-MDA-435s, Lu-SC_H69 130726 W88946 Hs.18508 putative 2.04 HT29 cells, Fibroblasts glycine-Nacyltransferase 2, MB-MDA-435s 105549 AA262417 Hs.5415 ESTs 2.04 DU145_cells, OVCAR-cells, PC3-cells 124543 N63706 Hs.104573 ESTs 2.04 Caco2, 293T_cells, DU145_cells 123062 AA482069 Hs.100847 ESTs 2.04 Lu_AD 358, HT29_cells, HT29 cells 109464 AA232857 Hs.87100 ESTs 2.04 DU145_cells, Lu~4D_H23, LNCaP_celis 129619 AA610116 Hs.11663 tetraspan2.04 BT474 cells, Caco2, LNCaP_cells NET-6 protein 127545 AA935809 Hs.115899 ESTs 2.04 BT474 cells, MB-MDA-435s, 133068 873427 Hs.235712 ESTs 2.04 Caco2, OVCAR_cells, MCF7 113609 T93263 Hs.16875 ' ESTs; 2.04 EB_cells, Lu_SC H345, PRSC
Weakly s!milar to hypothetical con pro 106645 AA460270 Hs.27695 midline2.04 A549 cells, 293T_cells, 1 (OpitzIBBB syndrome) Caco2 126256 221124 HSAAADNVE TEST1, Fibroblasts 2, Fibroblasts Human adultTestis tiss2.04 2, MCF7 129697 800841 Hs.172069 DKFZP434C2122.04 HT29_cells, Lu_SC~H520, protein BT474_cells 126730 T19477 A1426R Heart H 2.04 EB_cells, Lu~ID_H23, Lu-SC_H69 Sapiens cDNA clone A1426, 125244 W86466 Hs.132756 ESTs; 2.04 EB_cells, Lu-AD_H23, Lu_LC_H460 Weakly s!milar to, KIAA0591 protein 134762 M91036 Hs.242985 hemoglob!n;2.04 MB231 cells, Lu_AD_358, gamma G HT29_cells 119564 W38206 Accession not listed2.04 BT474_cells, HT29_cells, in Genbank Lu_AD-H23 132523 AB002332 Hs.50722 clock 2.04 PC3 cells, OVCAR_celis, (mouse) homolog PRSC_log 127758 AI337031 Hs.180195 ESTs 2.04 293T_celis, MB-MDA~f35s, A549_celis 126471 AA158755 Hs.175652 ESTs; 2.04 EB_cells, Lu~D 358, Lu Weakly similar to !!!! ALU SUBFAMI LC_H460 110911 N45120 Hs.22305 ESTs 2.03 Lu_AD 1123, RPWE 2, Lu_LC

122317 AA442742 Hs.8693 ESTs; 2.03 EB_cells, Fibroblasts 2, Weakly similar to !!!! ALU SUBFAMI Lu_SC_H345 100253 D38024 Hs.247951 Humn 2.03 Lu_AD ti23, Lu~D_358, Lu_S(,ZH520 facioscapulohumeral muscular dystro 120431 AA236884 Hs.247323 H Sapiens2.03 Lu SC H69, EB_cells, Lu_SC_H345 mRNA for G4 protein (G4 gene;

122449 AA447638 Hs.104977 ESTs 2.03 Lu SC H345, Lu_SC_H345, Lu_Sf~H520 100961 J00148 Accession not listed2.03 HT29 cells, BT474_cells, in Genbank HMEC

130908 W86389 Hs.21122 ESTs; 2.03 293T_cells, Lu_SC 11345, Moderately sim!larto KIAA0438 OVCAR_cells [H.

102643 U67849 Human beta-galactoside2.03 HT29_cells, 293T_cells, alpha2,6-sialyltr Lu_SC H345 127932 AA398510 Hs.133148 ESTs 2.03 ~ EB_cells, Lu-SC_H345, Lu_SC_H69 109207 AA190906 Hs.204692 ESTs 2.03 Lu_SGLH520, Lu_SC_H345, Lu_SC_H69 102598 U62962 Hs.106673 eukaryotictranslation2.03 EB_cells, DU145_cells, initiation factor MCF7 124470 N51702 Hs.101392 ESTs 2.03 HT29_cells, Fibroblasts 2, HMEC (total RNA) 104961 AA076672 Hs.33905 ESTs 2.03 Caco2, LNCaP_cells, EB_cells 124164 H30667 Hs.7535 ESTs; Highly2.03 CALU6_cells, CALU6_cells, similar to COBW-like platen A549_cells 126468 AA242853 Hs.237856 ESTs; 2.03 MB231 cells, BT474 cells, Moderately similar to CAMP inducib Fibroblasts 2 129683 W05348 Hs.158196 DKFZP434B1032.03 HT29_cells, MB-MDA-435s, protein Lu_AD_H23 105350 AA235737 Hs.186571 ATPase;2.03 MB-MDA~453, Lu_SGLH520, Na+IK+~ansporting; alpha 3 pol Lu_AD_358 129794 AA447772 Hs.14520 eukaryotic2.03 EB_cells, Lu_AD 358, Uanslation initiation factor Lu~4D_H23 115664 AA405974 Hs.54673 tumor 2.03 Lu_AD 358, HT29-cells, necrosis factor (ligand) superfami HT29_cells 119096 841672 Hs.91471 ATPase 2.03 HT29_cells, MB231 cells, type IV; phospholipid transportin BT474_cells 133866 L36151 Hs.171625 phosphaGdylinositol2.03 293T-cells, DU145_cells, 4-kinase; catalytic LNCaP_cells 132055 N69440 Hs.38132 ESTs 2.03 Lu SC_H345, MB-MDA-453, MB-MDA-435s 125691 A1034361 Hs.135150 lung 2.03 Lu_SC 1-1345, LNCaP_cells, type-I cell membrane-associated DU145_cells gly 121376 AA405699 Hs.166232 ESTs;Moderatelys!milartoSODIUM-AND

TRANSPORTER 2 [H.sap!ens] 2.03 LNCaP_cells, HT29_celis, 105289 AA233178 Hs.103000 KIAA08312.02 PC3 cells, Lu~D-H23, protein MB231 cells 100967 J02621 Hs.251064 high-mobility2.02 MCF7, DU145_cells, OVCAR-cells group (nonhistone chromoso 124430 N38913 Hs.221575 ESTs 2.02 MB-MDA-435s, Fibroblasts 2, EB_cells 128322 AI306331 Hs.133296 ESTs 2.02 HT29_cells, MB-MDA~t35s, Lu_SC_H345 131077 X91809 Hs.22698 G alpha 2.02 Lu~D_H23, RPWE_2, MCF7 interacting protein 108033 AA040923 Hs.92200 KIAA04802.02 MCF7, Fibroblasts 2, gene product DU145_cells 107550 AA001045 Hs.46783 ESTs 2.02 DU145 cells, PC3_cells, OVCAR_cells 109475 AA233159 Hs.87131 ESTs 2.02 HT29_cells, MB-MDA-435s, Lu_SC-H69 111400 800144 Hs.189771 ESTs 2.02 HT29_cells, Fibroblasts 2, HMEC

117516 N32495 Hs.151560 ESTs 2.02 HT29-cells, HMEC (total RNA), Fibroblasts 2 120506 AA257955 Hs.173705 ESTs;2.02 MCF7, Fibroblasts 2, Weakly similar to !!!! ALU LNCaP_cells CLASS C

130850 N39306 Hs.20237 DKFZP566C1342.02 EB_cells, Lu_AD H23, protein Lu_LC-H460 123118 AA486571 Hs.105696 ESTs;2.02 CALU6_cells, 293T-cells, Moderately similar to !!!! PRSC_log ALU SUB

111285 N71704 Hs.4310 eukaryotic2.02 293TCells, PC3_cells, translation initiation factor EB_cells 119106 842362 Hs.91785 ESTs 2.02 CALU6_celis, MB-MDA-453, PC3_cells 111370 N92915 Hs.94631 brefeldin2.02 EB-cells, OVCAt~cells, A-inhibited guan!ne nucleotide LNCaP_celis 125013 T67261 Hs.154431 ESTs; 2.02 Lu-SC_H345, Lu_SC_H69, Weakly similar to neuronal PRSC_con thread 129762 AA460273 Hs.12372 KIAA05172.02 EB cells, MB-MDA-435s, protein OVCAR_cells 120704 AA291970 Hs.107054 KIAA08212.01 Lu_SC_H69, EB-cells, protein MB-MDA-453 105355 AA235985 Hs.26938 Human DNA seq from clone 126A5 on chromo genes (one with DnaJ domains);
the gene family member HKR3. Conta!ns 2.01 Lu~D_H23, Lu LC H460, ESTs; STSs; Lu_S(~H520 125952 AA017723 small !nducible2.01 LNCaP_cells, DU145_cells, cytokine A5 (RANTES) MB231 cells 103478 Y07755 Hs.38991 S100 2.01 HMEC (total RNA), HMEC, calcium-b!nding protein A2 RPWE 2 133544 T33873 Hs.74624 protein 2.01 Lu_SC_H345, BT474_cells, tyrosine phosphatase; receptor HT29_cells t 112746 893237 yq11e10.s1 Soaresfetal liver spleen 1NF

IMAGE:196650 3', mRNA seq. 2.01 PC3_cells, LNCaP_cells, OVCAR-cells 118513 N67504 Hs.40061 ESTs 2.01 Lu SC_H345, Lu-SC_H69, PRSC_con 123423 AA598484 Hs.238476 EST 2.01 EB_cells, Lu-AD 1123, Lu-SC_H345 127854 AA769520 ESTs; Weakly 2.01 HS578T_cells, CALU6_cells, similar to REGULATOR OF MIT

Lu_S(~H520 111843 836969 Hs.18888 ESTs 2.01 Lu-AD Ii23, Lu-AD_358, Lu_S(ZH520 100221 D28383 Human mRNA forATP2.01 EB_cells, Lu-AD H23, synthase B chain, 5'U LNCaP_cells 129966 AA452237 Hs.194443 ESTs;2.01 Lu_SC Fi345, Lu_SC_H69, Weakly similar to BC37295 2 DU145 cells [H.sap 106798 AA478968 Hs.20558 ESTs 2.01 EB cells, Lu~4D_H23, Lu_LC_H460 114636 AA085374 zn13d5.s1 Stratagene hNT neuron (#937233 gb:L8441 CYTOCHROME C OXIDASE 2.01 EB_cells, CALU6 POLYPEPTI cells, OVCAR_cells 125348 H21585 Hs.191277 ESTs; 2.01 EB cells, HS578T_cells, Moderately similar to ATP b!nding PC3_cells 130620 AA233245 Hs.16773 ESTs 2.01 EB_celis, DU145_cells, 293T_cells 106471 AA450118 Hs.25722 ESTs; OVCAR_cells, LNCaP_cells, Weakly similarto ZINC FINGER EB-cells PROT 2.01 134175 T33128 Hs.7966 ESTs 2 Lu SC H345, Fibroblasts 2, Lu-AD_H23 117291 N22289 yw36g08.s1 Morton2 MB-MDA-453, OVCAR cells, Fetal Cochlea H sapien CALU6_cells 134199 U47635 Hs.79877 myotubularin2 EB-cells, PC3 cells, related protein 6 LNCaP_cells 128758 AA129545 Hs.181165 eukaryotic2 Lu_SC H69, EB cells, Uanslation elongation factor Lu_SC_H345 112005 842569 Hs.22444 ESTs 2 Lu_AD-H23, PRSC-log, Lu~ID_358 122521 AA449433 Hs.149227 ESTs; HT29_cells, RPWE_2, Weakly similar to PROLINE-RICH MB231 cells 130356 X84373 Hs.155017 nuclear2 DU145 cells, PC3_cells, receptor interacting prote!n MCF7 114067 138153 Hs.26921 ESTs 2 293T_cells, MB-MDA~t35s, HT29_cells 107136 AA620795 Hs.8207 ESTs 2 LNCaP_cells, PC3_cells, EB_cells Table 3 Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex UG-ID Complete-Title Ratio Top 3 expressing Accn BSIMet cell lines 302347 Hs.194659 chloride channel;19.71 EB, NCI-H520, NCI-H23 AF039400 calcium activated;
fam 316304 Hs.221599 ESTs 14.49 PRSC_con, RPWE-2, 339196 CH22_FF113D11.GENSCAN.3-110.37 NCI-H69, PRSC_con, 336171 CH22-FGENES.708 3 9.45 NCI-H69, NCI-H460, 338895 CH22_DJ32110.GENSCAN.9-29.31 PC3, BT474, OVCA-R

333625 CH22_FGENES.223 2 8.96 NCI-H69, PRSC_con, 333730 CH22_FGENES.258 1 8.82 NCI-H69, BT474, MB-MDA-231 320244 Hs.129778 gastrointestinal8.22 BT474, CALU6, DU145 AA296922 peptide 333643 CH22_FGENES.232 2 7.66 MCF7, NCI-H69, LnCap 333423 CH22_FGENES.147 3 7.57 HT29, MB-MDA-231, EB

302332 Hs.184507 H sap!ens 7.55 MB-MDA-231, AI833168 Chromosome 16 BAC clone HT29, MB-MDA-453 333588 CH22_FGENES.206 2 7.46 HT29, OVCA-R, BT474 322033 EST cluster (not in 7.35 PRSC con, PRSC_log, AL137507 UniGene) NCI-H345 308601 EST singleton (not in 6.83 PC3, DU145, DU145 AI719930 Un!Gene) with exon 339044 CH22_DA59H18.GENSCAN.2756.46 NCI-H69, NCI-H345, PRSC_log 314516 Hs.231748 ESTs 6.41 EB, OVCA-R, Caco2 327805 CH.05 hs gi~5867968 6.28 NCI-H69, NCI-H345, PRSC con 334239 CH22_FGENES.364_2 6.09 NCI-H520, MB-MDA-435s, 332958 CH22_FGENES.48-15 6.04 NCI-H69, PRSC con, PRSC_log 313386 Hs.173924 ESTs 5.88 MB-MDA-231, OVCA-R, 314350 Hs.190675 ESTs; Moderately5.84 OVCA-R, CALU6, EB
AL037927 similar to !!!! ALU
SUB

337170 CH22_FGENES.564-1 5.67 LnCap, CALU6, NCI-H69 337503 CH22 FGENES.803-1 5.66 NCI-H345, PRSC_con, 337562 CH22_C65E1.GENSCAN.1-2 5.53 HT29, MB-MDA~153, 337219 CH22_FGENES.614-3 5.45 NCI-H69, NCI-H345, PRSC-log 311331 Hs.32225 !mmunoglobulin5.43 NCI-H69, NCI-H23, AI679622 alpha 1 NCI-H345 314251 EST cluster (not in 5.41 PC3, EB, LnCap AA713589 UniGene) 336246 CH22_FGENES.746_5 5.34 NCI-H69, NCI-H345, PRSC_log 335009 CH22_FGENES.472_13 5.31 EB, EB, NCI-H69 339365 CH22 BA354112.GENSCAN.34-15.25 PRSC_con, NCI-H69, PRSC_log 336088 CH22 FGENES.688 17 5.21 PRSC_con, Caco2, PRSC-log 334966 CH22_,FGENES.465_36 5.16 DU145, BT474, MB-MDA-231 334666 CH22_FGENES.418_18 5.15 NCI-H69, NCI-H345, PRSC_log 316830 Hs.127821 ESTs 5.12 NCI-H345, PRSC_con, AW182106 PRSC_log 339413 CH22_DJ579N16.GENSCAN.S-85.06 NCI-H69, NCI-H345, PRSC_log 337951 CH22_EM:AC005500.GENSCAN.94-15.01 NCI-H345, NCI-H69, PRSC con 330153 CH.21_p2 gi~4325335 5 PRSC_con, PRSC_log, 333987 CH22_FGENES.310 11 4.96 MB-MDA-231, MB-MDA-453, 334304 CH22_FGENES.373 7 4.96 OVCA-R, CALU6, NCI-H23 338990 CH22_DA59H18.GENSCAN.6-64.95 PRSC_log, PRSC_can, 333152 CH22_FGENES.89_1 4.89 MB-MDA-435s, OVCA-R, 327049 CH.21_hs gi~6531965 4.87 PRSC_con, NCI-H345, PRSC_log 337225 CH22_FGENES.626-3 4.83 DU145, CALU6, EB

333496 CH22_FGENES.168_6 4.81 NCI-H69, NCI-H345, PRSC con 334451 CH22_FGENES.387 11 4.79 RPWE-2, PRSC_con, 333594 CH22_FGENES.210_3 4.78 OVCA-R, PC3, HT29 333635 CH22 FGENES.228 2 4.78 NCI-H69, PRSC_log, PRSC_con 336796 CH22_FGENES.176-6 4.73 NCI-H69, NCI-H345, PRSC_log 333313 CH22 FGENES.138 5 4.72 NCI-H69, NCI-H345, PRSC_log 336833 CH22_FGENES.242-2 4.7 NCI-H345, NCI-H69, PRSC con 336090 CH22_,FGENES.689_2 4.7 NCI-H69, PRSC_con, PRSC_log 336645 CH22_FGENES.26-1 4.63 HT29, OVCA-R, DU145 334565 CH22_FGENES.405_5 4.62 NCI-H345, PRSC_log, 333242 CH22_FGENES.111 6 4.56 NCI-H345, PRSC_log, PRSC_can 326304 CH.17_hs gi~5867277 4.48 OVCA-R, EB, DU145 337445 CH22_.FGENES.769-4 4.47 RPWE-2, NCI-H69, PRSC_log 327413 CN.O~hs gi~5867750 4.46 NCI-H69, PRSC log, NC!-H345 327990 CH.06_hs gi~5868218 4.44 PRSC_con, PRSC_log, 325038 Hs.21782 ESTs 4.43 PRSC_con, MB-MDA-231, 314923 Hs.136370 ESTs 4.4 HT29, MB-MDA-231, 328859 CH.07_hs gi~6381928 4.4 OVCA-R, BT474, A549 334476 CH22_FGENES.394 7 4.38 OVCA-R, PC3, EB

336092 CH22_FGENES.689_6 4.35 PRSC_con, Caco2, PRSC_log 333965 CH22_FGENES.305_3 4.35 NCI-H69, NCI-H345, PRSC_log 336402 CH22 FGENES.823_17 4.34 RPWE-2, HT29, OVCA-R

337947 CH22_EM:AC005500.GENSCAN.9054.33 OVCA-R, DU145, PC3 337504 CH22 FGENES.803-2 4.33 NCI-H345, PRSC_con, PRSC_log 336813 CH22_FGENES.213-6 4.33 DU145, HT29, OVCA-R

338069 CH22_EM:AC005500.GENSCAN.166-144.33 NCI-H69, PRSC_con, 318538 Hs.74034 caveolin 1; 4.31 PC3, A549, BT474 N28625 caveolae protein; 22kD

333631 CH22_FGENES.227_2 4.3 OVCA-R, PRSC_con, LnCap 302646 EST 4.27 PRSC_con, PRSC_log, 336049 CH22_FGENES.681 2 4.26 HT29, DU145, DU145 335667 CH22_FGENES.590_18 4.25 NCI-H520, Caco2, 320352 Hs.145296 disintegrin 4.25 MB-MDA-231, DU145, Y13323 protease BT474 304480 EST singleton (not in 4.22 NCI-358, NCI-H460, AA430373 UniGene) with exon NCI-H23 327273 CH.01 hs gi~5867466 4.22 NCI-H69, NCI-H345, PRSC con 334540 CH22_FGENES.403_5 4.17 NCI-H69, NCI-H345, PRSC_log 334719 CH22_FGENES.421 30 4.17 NCI-H69, NCI-H345, 327827 CH.05_hs gi~5867968 4.17 OVCA-R, NCI-H69, 333599 CH22_FGENES.212_2 4.17 PRSC_Iog, NCI-H69, PRSC_con 329638 CH.12~2 gi~3779004 4.16 DU145, MB-MDA-231, 307556 EST singleton (not in 4.16 BT474, HT29, CALU6 AI281651 UniGene) with exon 336836 CH22_FGENES.247-11 4.15 PRSC_con, NCI-H345, 323187 Hs.240038 ESTs 4.14 NCI-H345, MB-MDA-435s, 336397 CH22_FGENES.823_12 4.13 NCI-H345, PRSC_con, 325007 EST cluster (not in 4.13 NCI-H69, PRSC_con, AA736429 UniGene) NCI-H345 300199 Hs.150836 ESTs 4.11 NCI-H345, PRSC_con, AI304386 PRSC_log 335832 CH22_FGENES,620_6 4.08 NCI-H69, NCI-H345, PRSC log 312778 Hs.197919 ESTs 4.07 NCI-358, NCI-H23, AI631655 PRSC_con 323164 Hs.151858 ESTs 4.06 NCI-H23, A549, HT29 315871 Hs.117237 ESTs 4.05 MB-MDA-231, EB, 337452 CH22 FGENES.775-1 4.02 PRSC_con, PRSC_log, 335265 CH22_FGENES.521 1 4.01 NCI-H69, MCF7, RPWE-2 335200 CH22_FGENES.508_9 4.01 NCI-H69, PRSC_log, PRSC_con 336917 CH22 FGENES.346-4 3.99 PRSC_con, NCI-H345, PRSC_log 336584 CH22_FGENES,847_1 3.98 PRSC_Iog, PRSC_con, 333382 CH22_FGENES.143 21 3.97 EB, A549, HT29 329436 CH.Y_hs gi~5868883 3.97 BT474, PC3, HT29 336929 CH22_FGENES.349-3 3.94 NCI-H69, NCI-H345, PRSC_log 337238 CH22_FGENES.641-3 3.92 NCI-H69, NCI-H345, PRSC_log 333875 CH22 FGENES.291 11 3.92 PRSC_con, RPWE-2, PRSC_log 337069 CH22 FGENES.448-2 3.9 NCI-H69, LnCap, 332491 Hs.1435 guanosine monophosphate3.86 OVCA-R, MB-MDA-435s, M24470 reductase CALU6 304623 EST singleton (not in 3.86 OVCA-R, DU145, PC3 AA521331 UniGene) with exon 335348 CH22_FGENES.537 4 3.85 HT29, MB-MDA-231, 334568 CH22_FGENES.405_9 3.85 NCI-H69, NCI-H345, PRSC log 336924 CH22_FGENES.347-9 3.84 NCI-H345, PRSC_log, 301654 EST 3.84 NCI-H520, LnCap, 334677 CH22_FGENES.418 30 3.83 PRSC_con, NCI-H345, 326688 CH.20_hs gi~5867562 3.83 NCI-H345, PRSC_con, PRSC log 327790 CH.05_hs gi~5867977 3.8 PRSC_con, PRSC_log, 334591 CH22_FGENES.408 1 3.8 NCI-H69, PRSC_log, 337974 CH22_EM:AC005500.GENSCAN.106-33.78 PRSC_log, PRSC_con, 311274 Hs.197101 ESTs 3.78 NCI-H345, PRSC_con, 326668 CH.20 hs gi~6552455 3.78 NCI-H345, NCI-H69, PRSC_log 304195 EST singleton (not in 3.77 NCI-H69, RPWE-2, N35382 UniGene) with exon PRSC_con 336294 CH22_FGENES.786 4 3.77 PRSC_con, PRSC_Iog, 311613 Hs.252443 ESTs; Weakly 3.76 HT29, BT474, MB-MDA-231 AL046311 similar to Illl ALU
SUBFAMI

338123 CH22_EM:AC005500.GENSCAN.19553.75 MB-MDA-231, HT29, 318230 EST cluster (not in 3.74 RPWE-2, PRSC_con, AA558125 UniGene) NCI-H345 303985 Hs.156110 Immunoglobulin3.73 MB-MDA-231, BT474, AW514501 kappa variable 1D-8 PRSC_con 336502 CH22_FGENES.833_8 3.72 NCI-H345, RPWE-2, PRSC_con 334063 CH22_FGENES.327 17 3.71 NCI-H69, NCI-H345, PRSC_con 333600 CH22_FGENES,213 2 3.7 NCI-H69, OVCA-R, 339424 CH22_DJ579N16.GENSCAN.1433.69 NCI-H69, NCI-H345, PRSC_con 336862 CH22_FGENES.297-2 3.67 NCI-H345, PRSC_con, PRSC_log 334823 CH22_FGENES:437 5 3.67 RPWE-2, PRSC_log, PRSC_con 329940 CH.16_p2 gi~6165199 3.66 CALU6, EB, MCF7 300275 Hs.231521 ESTs 3.66 PRSC_con, NCI-H69, 328820 CH.07 hs gi~5868330 3.66 NCI-H69, NCI-H345 PRSC_con 332398 Hs.104788 H sapiens 3.66 PRSC con, PRSC_log, AA446446 clone 24554 unknown NCI-H345 mRNA

325791 CH.14_hs gi~6682476 3.65 NCI-H345, BT474, LnCap 300672 Hs.256573 ESTs ~ 3.65 MCF7, MB-MDA-053, 814469 MB-MDA-435s 338344 CH22_EM:AC005500.GENSCAN.312-83.65 NCI-H345, PRSC_log, PRSC-con 333257 CH22_FGENES.118_5 3.65 DU145, EB, OVCA-R

332140 Hs.112890 ESTs 3.65 MB-MDA-453, DU145, 337489 CH22_FGENES.799-2 3.63 NCI-H345, NCI-H69, PRSC log 305167 EST singleton (not in 3.63 OVCA-R, MB-MDA-231, AA663080 UniGene) with exon MB-MDA-435s 336200 CH22_FGENES.719 4 3.61 NCI-H69, PRSC_log, 339208 CH22_FF113D11.GENSCAN.6-33.59 PRSC_con, NCI-H69, PRSC_log 320090 Hs.113275 purinergic 3.58 OVCA-R, LnCap, AB002058receptor P2X-like 1; NCI-H69 orphan r 335999 CH22_,FGENES.657_1 3.57 NCI-H345, NCI-H69, PRSC_con 332909 CH22 FGENES.36_13 3.57 NCI-H345, PRSC
con, PRSC_log 306531 EST singleton (not in 3.56 BT474, MB-MDA-053, AA991423UniGene) with exon MB-MDA-435s 333261 CH22_FGENES.119_1 3.55 HT29, CALU6, MB-MDA-231 303883 Hs.169624 ESTs 3.54 NCI-H69, NCI-H345, 335831 CH22_FGENES.620 5 3.53 MCF7, BT474, OVCA-R

333983 CH22_FGENES.310 7 3.52 NCI-H345, PRSC_con, PRSC_log 333623 CH22_FGENES.222 2 3.51 NCI-H69, PRSC_con, PRSC_log 333997 CH22_FGENES.310_22 3.5 NCI-H345, PRSC_con, PRSC_log 325623 CH.14_hs gi~5867000 3.5 CALU6, HT29, BT474 309151 Hs.140 immunoglobulin 3..49 EB, MCF7, MB-MDA-053 AI935829gamma 3 (Gm marker) 305080 EST singleton (not in 3.49 NCI-H23, NCI-H460, AA641485UniGene) with exon NCI-358 339268 CH22_BA354112.GENSCAN.10-63.47 NCI-H69, NCI-H345, PRSC con 310048 Hs.105077 ESTs 3.47 Caco2, PRSC_con, 314758 Hs.192738 ESTs 3.46 NCI-H23, NCI-H23, 334664 CH22_FGENES.418_15 3.45 NCI-H69, PRSC_log, PRSC_con 334661 CH22 FGENES.418_9 3.45 NCI-H69, PRSC-con, PRSC_log 330984 Hs.32766 H sapiens clone3.44 OVCA-R, MCF7, PC3 H38678 24803 mRNA seq 333464 CH22_FGENES.160_1 3.44 NCI-H69, MB-MDA-231, 333580 CH22_FGENES.199_2 3.42 PRSC_con, NCI-H69, PRSC_log 313356 Hs.132929 ESTs 3.42 RPWE-2, PRSC_con, 334518 CH22_FGENES.400_1 3.41 PRSC_log, PRSC-con, 333627 CH22_FGENES.225_2 3.4 HT29, BT474, BT474 309641 Hs.253100 EST 3.4 HT29, MB-MDA-453, 338221 CH22_EM:AC005500.GENSCAN.246-103.4 NCI-H69, PRSC_log, 312993 Hs.125230 ESTs 3.4 PRSC_log, NCI-H345, 318336 Hs.164158 ESTs 3.38 OVCA-R, EB, CALU6 326218 CH.17_hs gi~5867226 3.38 NCI-H460, NCI-H69, 336231 CH22 FGENES.736_3 3.38 NCI-H69, NCI-H345, PRSC log 307912 EST singleton (not in 3.37 NCI-H345, PRSC-con, AI382224UniGene) with exon RPWE-2 336161 CH22_FGENES.707 6 3.37 NCl-H69, NCI-H345, 300875 Hs.192477 ESTs 3.37 RPWE-2, PRSC_log, AW134756 PRSC-con 336593 CH22_FGENES.135_1 3.37 PRSC_con, NCI-H69, 310696 Hs.160875 ESTs 3.36 HT29, OVCA-R, BT474 304745 EST singleton (not in 3.36 NCI-H345, RPWE-2, AA577771UniGene) with exon PRSC_con 308911 Hs.156110 Immunoglobulin3.36 EB, DU145, CALU6 AI860287kappa variable 1D-8 336347 CH22 FGENES.815 3 3.36 NCI-H69, PRSC log, PRSC_con 334906 CH22_FGENES.452_21 3.33 Caco2, CALU6, MB-MDA-453 334548 CH22_FGENES.403 13 3.33 NCI-H345, PRSC_con, 336695 CH22_FGENES.48-4 3.32 NCI-H69, PRSC-log, PRSC-con 316684 Hs.220783 ESTs; Weakly 3.31 DU145, EB, AA807187similar to WNT-1 PROTO-ONCO MB-MDA-231 315901 Hs.179718 v-myb avian 3.3 Caco2, LnCap, NCI-H69 AI521558myeloblastosis viral oncogen 320115 EST cluster (not in 3.3 DU145, HT29, CALU6 T93574 UniGene) 307847 Hs.157273 EST 3.3 NCI-H345, PRSC
AI363993 con, PRSC_log 327899 CH.06_hs gi~5868156 3.28 BT474, MB-MDA-231, 304612 EST singleton (not in 3.28 DU145, CALU6, LnCap AA514207UniGene) with exon 330021 CH.16_p2 gi~6671889 3.27 A549, HT29, EB

338132 CH22_EM:AC005500.GENSCAN.200-23.27 MB-MDA-231, CALU6, EB

323690 Hs.188897 ESTs 3.27 RPWE-2, NCI-H345, 327362 CH.01 hs gi~6552412 3.26 NCI-H69, RPWE-2, PRSC_log 333488 CH22_FGENES.167-3 3.26 NCI-H69, NCI-H345, PRSC_log 334106 CH22_FGENES.330_5 3.26 NCI-H69, PRSC_con, PRSC_log 306990 Hs.146491 EST; Weakly NCI-H345, PRSC_log, AI129298similar to FERRITIN PRSC_con HEAVY CH 3.26 328420 CH.07_hs gi~5868411 3.26 NCI-H69, NCI-H345, PRSC_log 336214 CH22 FGENES.722 8 3.26 MCF7, EB, OVCA-R

330565 Hs.1545 caudal type 3.25 EB, DU145, HT29 051095 homeo box transcription fact 333879 CH22_FGENES.291 15 3.25 PRSC_con, PRSC_log, 300145 Hs.232016 ESTs 3.25 NCI-H345, PRSC
AI240850 con, PRSC_log 327581 CH.03_hs gi~5867825 3.25 EB, DU145, MB-MDA-453 308153 Hs.1103 transforming 3.24 MCFl, EB, EB
AI500429growth factor, beta 308337 EST singleton (not in 3.24 PRSC_log, PRSC_con, AI608947UniGene) with exon NCI-H345 329406 CH.X_hs gi~6682547 3.23 DU145, HT29, MB-MDA-231 325482 CH.12_hs gi~5866957 3.23 NCI-H69, NCI-H345, PRSC_con 337544 CH22_FGENES.833-7 3.22 NCI-H69, NCI-H345, PRSC_con 337204 CH22_FGENES.595-1 3.22 NCI-H69, PRSC_con, PRSC_log 309451 Hs.246687 EST 3.22 PRSC_con, RPWE-2, 337259 CH22_FGENES.649-3 3.2 PRSC_con, NCl-H345, 336489 CH22_FGENES.831 10 3.2 CALU6, MB-MDA~l35s, Caco2 334804 CH22_FGENES.435 4 3.18 PRSC_log, PRSC_con, 335739 CH22_FGENES.601 10 3.18 NCI-H69, RPWE-2, PRSC_con 306264 Hs.179779 ribosomal 3.17 LnCap, NCI-H69, AA935305protein L37 EB

329386 CH.X_hs g1~6004484 3.17 RPWE-2, NCI-H345 PRSC log 323479 EST cluster (not in 3.16 PRSC_con, NCI-H345, AA278246UniGene) RPWE-2 304731 EST singleton (not in 3.18 NCI-H69, LnCap, AA576085UniGene) with exon DU145 339419 CH22_DJ579N16.GENSCAN.11-113.15 NCI-H69, PRSC log, 301202 Hs.173155 ESTs 3.15 LnCap, NCI-H69, AI536797 Caco2 333608 CH22_FGENES.216 3 3.15 NCI-H345, PRSC_con, PRSC_log 339193 CH22_FF113D11.GENSCAN.1-53.14 NCI-H69, NCI-H345, PRSC_con 310527 Hs.211986 ESTs 3.14 PRSC_log, PRSC_con, 321146 Hs.183983 ESTs 3.14 PRSC_con, NCI-H69, AA707443 PRSC log 333271 CH22 FGENES.121 2 3.13 NCI-H345, NCI-H69, 330280 CH.05_p2 gi~6671910 3.13 NCI-H69, NCI-H345, PRSC_log 309977 EST singleton (not in 3.13 PRSC_con, PRSC_log, AW451663UniGene) with exon RPWE-2 307588 EST singleton (not in 3.13 MB-MDA-231, BT474, AI285535UniGene) with exon BT474 330551 Hs.105440 hepatocyte 3.13 MB-MDA-453, LnCap, U39840 nuclear factor 3; alpha Caco2 314404 Hs.157505 ESTs 3.13 DU145, EB, OVCA-R

334030 CH22_FGENES.320 2 3.13 NCI-H69, NCI-H345, PRSC_con 309106 EST singleton (not in 3.13 BT474, MCF7, EB
AI925949UniGene) with exon 317516 Hs.192262 ESTs 3.12 OVCA-R, EB, MB-MDA-453 304161 EST singleton (not in 3.12 PRSC_con, NCI-H69, H71886 UniGene) with exon RPWE-2 334590 CH22_,FGENES,407_13 3.12 NCI-H69, NCI-H345, PRSC_con 333408 CH22_FGENES.145_6 3.11 PRSC_log, RPWE-2, PRSC_con 330387 Hs.31386 ESTs; Highly 3.11 DU145, OVCA-R, PC3 H14624 similar to secreted apoptos 332567 Hs.25647 v-fos FBJ murine3.11 EB, MB-MDA-453, N23730 osteosarcoma viral onto MCF7 333682 CH22_FGENES.247 10 3.1 PRSC_con, PRSC_log, 323152 Hs.246192 ESTs; Weakly 3.1 PC3, MB-MDA-453, AI680562similar to REGULATOR DU145 OF MIT

311142 Hs.195649 ESTs 3.1 PRSC_con, RPWE-2, A1638441 PRSC log 333441 CH22_FGENES.151 5 3.1 RPWE-2, NCI-H345, PRSC_log 326459 CH.19_hs gi~5867400 _ EB, CALU6, PC3 3.09 313493 Hs.126868 ESTs 3.09 NCI-H345, PRSC_con, 339356 CH22_BA354112.GENSCAN.31-13.08 NCI-H69, NCI-H345, PRSC_log 333629 CH22_FGENES.226_5 3.08 NCI-H69, NCI-H345, PRSC_log 304127 EST singleton (not in 3.07 LnCap, PRSC_con, H42981 UniGene) with exon DU145 325691 CH.14_hs gi[5867021 3.07 NCI-H345, PRSC_con, 333014 CH22_FGENES.61 6 3.07 PRSC_con, PRSC_log, 327379 CH.02_hs gi[5867795 3.07 PRSC_con, PRSC_log, 337816 CH22_EM:AC005500.GENSCAN.13-13.06 NCI-H69, PRSC-con, PRSC_log 337954 CH22_EM:AC005500.GENSCAN.96-33.06 PRSC_log, NCI-H69, 328109 CH.O6_hs gi[5868020 3.05 HT29, BT474, MB-MDA-231 338527 CH22_EM:AC005500.GENSCAN.396-153.05 NCI-H69, NCI-H345, PRSC_con 320083 EST cluster (not in UniGene)3.05 BT474, MB-MDA-435s, 333466 CH22_FGENES.161 2 3.05 NCI-H345, RPWE-2, PRSC_lag 334788 CH22_FGENES.432_13 3.04 EB, A549, CALU6 302681 EST 3.04 OVCA-R, EB, MB-MDA-453 336238 CH22_FGENES.743_3 3.03 NCI-H69, PRSC-log, PRSC_con 337606 CH22_C20H12.GENSCAN.17-23.02 HT29, BT474, MB-MDA-231 333545 CH22_FGENES.180_1 3.02 NCI-H69, NCI-H345, 309782 Hs.156110 Immunoglobulin3.02 PRSC_log, PRSC_con, AW275156kappa variable 1 D-8 RPWE-2 324277 Hs.207285 ESTs 3.02 BT474, MB-MDA-231, 321074 Hs.32756 ESTs 3.02 PC3, BT474, MB-MDA-231 337094 CH22 FGENES.465-19 3.01 PRSC_con, PRSC log, 313913 EST cluster (not in UniGene)3 NCI-H345, RPWE-2, AW391342 PRSC_log 329140 CH.X_hs gi~6017060 3 EB, DU145, PC3 335331 CH22_FGENES.535 4 3 MB-MDA~35s, HT29, 334827 CH22_FGENES.437 9 2.99 CALU6,.EB, DU145 326029 CH.17_hs gi~5867176 ' 2.99 NCI-H345, RPWE-2, PRSC_con 303100 EST 2.99 MB-MDA-453, NCI-H345, 328768 CH.07_hs gi[6017031 2.99 NCI-H345, PRSC_con, 329392 CH.X-hs gi[6478815 2.98 NCI-H69, NCI-H345, PRSC_con 305168 EST singleton (not in 2.98 LnCap, NCI-H345, AA663105UniGene) with exon MCF7 300992 Hs.191798 ESTs 2.98 Caco2, HT29, NCI-358 334474 CH22_FGENES.394_5 2.98 NCI-H69, PRSC-con, 322647 Hs.125062 ESTs 2.98 HT29, OVCA-R, A549 310620 Hs.178953 ESTs 2.97 PRSC_con, RPWE-2, AI341328 PRSC log 328276 CH.07_hs gi~6004471 2.97 NCI-H345, NCI-H69, 331018 Hs.24048 ESTs; Weakly 2.96 Caco2, NCI-H460, N26904 similar to FK506Irapamycin- A549 321523 Hs.191325 ESTs; Weakly 2.96 PRSC_con, PRSC log, H78472 similar to cDNA EST NCI-H345 yk414c9 339280 CH22 BA354112.GENSCAN.14-122.96 NCI-H69, PRSC log, 305967 EST singleton (not in 2.96 NCI-H520, NCI-358, AA886428UniGene) with exon MB-MDA-453 335755 CH22-FGENES.604 4 2.95 EB, A549, MB-MDA-453 323907 Hs.165387 ESTs 2.95 PRSC_con, NCI-H345, AL043098 PRSC_log 330370 CH.X_p2 gi~6580495 2.95 EB, DU145, MB-MDA~35s 334529 CH22_FGENES.402_9 2.94 EB, MCF7, DU145 339256 CH22_BA354112.GENSCAN.7-112.94 NCI-H69, NCI-H345, PRSC_con 334783 CH22_FGENES.432_8 2.94 A549, Caco2, PC3 335266 CH22_FGENES.521 2 2.94 NCI-H69, PRSC_con, PRSC_con 323707 Hs.128385 ESTs 2.94 NCI-H345, PRSC_con, AA845957 PRSC_log 336199 CH22_FGENES.719_3 2.93 NCI-H69, NCI-H345, PRSC_log 338326 CH22_EM:AC005500.GENSCAN.308-22.93 NCI-H69, NCI-H345, 333652 CH2~FGENES.239_1 2.93 PC3, OVCA-R, BT474 336479 CH22_,FGENES.829 2.92 NCI-H69, PRSC-con, 39 PRSC log 336086 CH22 FGENES.688 2.92 PRSC_con, Caco2, CALU6 338516 CH22_EM:AC005500.GENSCAN.392-6 2.92 NCI-H69, NCI-H345, PRSC_con 320121 EST cluster 2.92 EB, BT474, HT29 T93657 (not in UniGene) 305782 EST singleton 2.92 MB-MDA-453, MCF7, DU145 AA844730(not in UniGene) with exon 339304 CH22_BA354112.GENSCAN.20-16 2.91 PRSC_con, PRSC_log, 327472 CH.02_hs 2.91 PRSC_log, PRSC_con, giJ5867775 RPWE-2 311458 Hs,244718 2.91 PRSC_con, PRSC_log, AW139426ESTs RPWE-2 338431 CH22_EM:AC005500.GENSCAN.351-4 2.9 BT474, MCF7, MB-MDA-339230 CH22_BA354112.GENSCAN.1-6 2.89 NCI-H69, NCI-H345, PRSC_log 320586 EST cluster 2.89 OVCA-R, HT29, MB-MDA-231 NM-00365(not in UniGene) 304777 Hs,2186 2.89 OVCA-R, EB, MCF7 AA581692eukaryo6c translation elongation factor 337768 CH22_EM:AC000097.GENSCAN.119-6 2.88 NCI-H69, LnCap, DU145 319465 Hs.191558 2.88 NCI-H460, NCI-H520, AA319115ESTs NCI-358 319068 Hs.110155 2.87 BT474, MB-MDA-453, W93011 ESTs MB-MDA-435s 330958 Hs.159824 2.87 OVCA-R, PC3, A549 334215 CH22_FGENES.357 2.87 NCI-H69, PRSC_con, 7 PRSC_log 333568 CH22_FGENES.185_1 2.87 PRSC_con, PRSC_log, 333142 CH22_FGENES.85 2.87 NCI-H69, HT29, HT29 330239 CH.05_p2 6671857 2.87 MB-MDA-453, MB-MDA-453, giJ EB

302120 Hs.31075 y similar 2.87 CALU6, MB-MDA-435s, 855140 ESTs; Weaklto Weak similarity BT474 338679 CH22_EM:AC005500.GENSCAN.47Q-1 2.86 NCI-H345, PRSC_log, PRSC_con 329041 CH.X_hs 2.86 LnCap, PRSC_con, RPWE-2 giJ5868564 333541 CH22_FGENES.178 2.86 NCI-H69, NCI-H345, 3 ~ PRSC_con 337011 CH22_FGENES.427-6 2.86 NCI-H69, PRSC_log, PRSC_con 324031 EST cluster 2.86 NCI-H345, PRSC_log, AA375646(not in LnCap UniGene) 331842 Hs.98232 2.86 DU145, OVCA-R, HT29 AA416586ESTs 336599 CH22_FGENES.350 2.85 LnCap, NCI-H69, NCI-H345 337586 CH22_C20H12.GENSCAN.S-4 2.85 NCI-H345, NCI-H69, PRSC_con 336177 CH22_FGENES.712 2.85 NCI-H69, PRSC_log, 337522 CH22_FGENES.819-1 2,85 CALU6, OVCA-R, HT29 338596 CH22_EM:AC005500.GENSCAN.437-2 2.85 NCl-H69, PRSC_con, 309522 Hs.252259 2.85 MB-MDA-453, MB-MDA-435s, AW150044ribosomal MB-MDA-435s protein 336981 CH22_FGENES.397-7 2.85 NCI-H69, PRSC_con, PRSC_log 330286 CH.05_p2 2.84 NCI-H345, PRSC_log, giJ6671913 NCI-H69 333713 CH22_FGENES.251 2.84 RPWE-2, PRSC-can, NCI-H69 335068 CH22,FGENES.483 2.83 M8-MDA-231, NCI-H345, 305075 Hs.181165 2.83 EB, LnCap, DU145 AA641288eukaryotic translation elongation factor 326380 CH.19_hs 2.82 NCI-H69, PRSC_con, giJ5867327 PRSC_log 334970 CH22_FGENES.466 2.82 PRSC_con, NCI-H69, 337097 CH22_FGENES.471-1 2.82 NCI-H345, NCI-H69, PRSC_log 323676 EST cluster 2.82 LnCap, A549, CALU6 AI702835(not in UniGene) 333785 CH22_FGENES.274 2.82 OVCA-R, Caco2, MB-MDA-453 334175 CH22_FGENES.349 2.81 RPWE-2, BT474, MCF7 337865 CH22_EM:AC005500.GENSCAN.46-5 2.81 Caco2, NCI-H23, BT474 302585 Hs.249220 2.81 EB, DU145, MB-MDA-453 AA083564H sapiens mRNA for hTbr2;
complete cds 336623 CH22_FGENES.4-5 2.81 NCI-H345, PRSC-con, 332854 CH22_FGENES.22 2.8 RPWE-2, PRSC_log, PRSC
1 con 336978 CH22_FGENES.384-10 2.8 PRSC_con, NCI-H345, 326874 CH.20_hs 2.8 RPWE-2, NCI-H345, PRSC
giJ6682507 log 315121 Hs.105902 2.8 NCI-H345, PRSC_log, AA565011ESTs RPWE-2 311185 Hs.224665 2.8 NCI-H69, NCI-H345, AI638294ESTs PRSC-fag 334682 CH22_FGENES.419 2.8 NCI-H69, PRSC_log, 316845 Hs.250388 2.79 RPWE-2, NCI-H345, PRSC_log AW418715ESTs 331599 Hs.50535 2.79 A549, MB-MDA-453, MB-MDA-035s N74626 ESTs 315681 Hs.136591 2.78 NCI-H460, MB-MDA-453, AW022054ESTs MCF7 313012 Hs.143929 2.78 DU145, MB-MDA-453, AI207390ESTs MCF7 313476 EST cluster 2.78 NCI-H520, NCI-H460, AA010267(not in HT29 UniGene) 327277 CH.01_hs 2.78 DU145, CALU6, EB
giJ5867473 310981 Hs.171380 2.78 LnCap, RPWE-2, NCI-H460 AI494514ESTs 335090 CH22_FGENES.490_1 2.77 NCI-H69, PRSC_log, PRSC_con 328581 CH.07_hs 2.77 HT29, MB-MDA-453, MCF7 giJ6006033 333219 CH22_FGENES.104_11 2.77 NCI-H69, PRSC_log, 308311 EST singleton 2.77 MB-MDA-231, HT29, CALU6 AI581855(not in UniGene) with exon 329760 CH.14_p2 2.77 CALU6, DU145, EB
giJ6048280 303925 Hs.258523 2.77 NCI-H69, LnCap, MB-MDA-231 AW469999ESTs 337628 CH22_C20H12.GENSCAN.28-31 2.77 NCI-H69, LnCap, MB-MDA-453 333520 CH22_FGENES.174 2.77 NCI-H69, NCI-H345, 3 PRSC_con 303168 Hs.197770 2.76 DU145, OVCA-R, MB-MDA-453 AA872479ESTs; Weakly similar to estrogen-respons 313451 Hs.122672 2.76 OVCA-R, EB, DU145 AW138189ESTs 328474 CH.07_hs 2.76 NCI-H69, NCI-H345, giJ5868446 RPWE-2 331988 Hs.9242 2.76 MB-MDA-435s, A549, AA477414pudne-rich OVCA-R
element binding protein B

306180 EST singleton 2.76 NCI-H69, DU145, LnCap AA922503(not in UniGene) with exon 321071 Hs.241502 2.76 PRSC_log, PRSC_con, AA013011Cdc42 effector NCI-H345 protein 302972 EST 2.76 NCI-H345, RPWE-2, NCI-H69 305185 Hs.248038 2.75 DU145, A549, BT474 AA663985major histocompatibility complex;
class 335998 CH22 FGENES.656_16 2.75 NCI-H69, PRSC_con, 319138 Hs.73818 ubiquinol-cytochrome2.75 NCI-H345, NCI-H69, 811699 c reductase hinge p PRSC_con 336387 CH22 FGENES.822_7 2.75 PRSC_con, RPWE-2, PRSC_log 338054 CH22 EM:AC005500.GENSCAN.158-22.75 OVCA-R, EB, DU145 316041 EST cluster (not in 2.74 DU145, MCF7, MB-MDA-453 AA719183 UniGene) 336863 CH22_FGENES.297-4 2.74 MB-MDA-453, MCF7, OVCA-R

335975 CH22_FGENES.652 9 2.74 CALU6, EB, A549 302952 EST 2.74 CALU6, MB-MDA-435s, 326122 CH.17_hs gi~5867194 2.74 HT29, Caco2, PC3 337427 CH22_,FGENES.761-4 2.74 RPWE-2, NCI-H69, PRSC_log 308063 Hs.119252 tumor protein;2.74 NCI-358, NCI-H23, Caco2 AI469244 translationally-controlle 325433 CH.12_hs gi~5866936 2.74 NCI-H345, PRSC con, 316252 Hs.190406 ESTs 2.74 OVCA-R, MCF7, A549 310837 Hs.170301 ESTs 2.74 NCI-H345, PRSC con, 313562 Hs.257676 ESTs 2.74 HT29, MCF7, MB-MDA-231 335455 CH22_FGENES.562_15 2.74 NCI-H69, LnCap, PRSC_con 304792 Hs.29797 ribosomal protein2.73 EB, OVCA-R, MB-MDA-053 331979 Hs.105322 EST 2.73 MCF7, BT474, NCI-H460 336198 CH22-FGENES.719 2 2.73 NCI-H69, PRSC con, PRSC_log 314698 Hs.187127 ESTs 2.73 MB-MDA-231, LnCap, 307954 EST singleton (not in 2.73 HT29, HT29, EB
AI419692 UniGene) with exon 318288 Hs.134702 ESTs 2.73 PRSC_log, NCI-H345, A1088590 PRSC_con 327833 CH.05_hs gi~5867968 2.73 BT474, PC3, MB-MDA-231 300221 Hs.217953 ESTs; Highly 2.73 NCI-H520, NCI-358, AW449602 similarto NK-TUMOR MB-MDA-453 RECOGNI

326039 CH.17_hs gi~5867179 2.73 MB-MDA~153, EB, EB

318457 Hs.143952 ESTs 2.72 PRSC con, PRSC_log, 336753 CH22_FGENES.128-9 2.72 MB-MDA-435s, NCI-H520, 330086 CH.19_p2 gi~6015293 2.72 HT29, MB-MDA-453, MCF7 333566 CH22_FGENES.183 2 2.72 IiT29, BT474, OVCA-R

339384 CH22 BA232E17.GENSCAN.3-222.71 NCI-H69, NCI-H345, PRSC_log 338668 CH22_EM:AC005500,GENSCAN.465-12.71 NCI-H69, RPWE-2, PRSC_con 300798 Hs.194613 ESTs 2.71 PRSC_con, NCI-H345, AI382618 PRSC_log 303745 EST 2.71 PRSC_log, PRSC_con, 305197 EST singleton (not in 2.71 EB, NCI-H520, OVCA-R
AA666301 UniGene) with exon 338725 CH22_EM:AC005500.GENSCAN.499-12.7 CALU6, MB-MDA-053, 307799 EST singleton (not in 2.7 HT29, BT474, MCF7 AI351112 UniGene) with exon 309598 Hs.250106 EST 2.69 NCI-358, NCI-H69, NCI-H23 302727 EST 2.69 OVCA-R, BT474, PC3 308544 EST singleton (not in 2.69 HT29, CALU6, MB-MDA-435s AI695133 UniGene) with exon 322877 EST cluster (not in 2.69 NCI-H345, NCI-H69, AA079727 UniGene) PRSC_con 325695 CH.14_hs gi~6552446 2.69 NCI-H69, NCI-H460;

307728 EST singleton (not in 2.68 NCI-H69, PRSC_log, AI335557 UniGene) with exon NCI-358 302399 EST 2.68 NCI-H69, PRSC_con, 309343 EST singleton (not in 2.68 HT29, MB-MDA-231, MB-MDA-231 AW028652 UniGene) with exon 339360 CH22_BA354112.GENSCAN.32-22.68 NCI-H69, PRSC_log, PRSC_con 337821 CH22_EM:AC005500.GENSCAN.13-112.68 PRSC con, PRSC_log, PRSC_log 337338 CH22_FGENES.717-7 2.68 NCI-H69, PRSC_con, PRSC_log 334510 CH22_FGENES.398 8 2.68 NCI-H460, NCI-H23, 300918 Hs.128792 ESTs 2.68 MB-MDA-435s, CALU6, 335536 CH22_FGENES.574-2 2.67 NCI-H69, NCI-H345, PRSC_log 335311 CH22_FGENES.532 4 2.67 MB-MDA-035s, Caco2, 338959 CH22 DJ32110.GENSCAN.23-312.67 NCI-H345, PRSC_con, 339081 CH22_DA59H18.GENSCAN.37-102.67 NCI-H345, RPWE-2, NCI-H69 334068 CH22 FGENES.327 23 2.67 PRSC_con, RPWE-2, PRSC_log 338976 CH22 DA59H18.GENSCAN.1-32.66 PRSC_con, PRSC_log, 325524 CH.12_hs gi~5866981 2.66 NCI-H345, RPWE-2, PRSC_con 333069 CH22_FGENES.76 5 2.66 NCI-H69, NCI-H345, PRSC_con 336203 CH22_FGENES.719 7 2.66 OVCA-R, PC3, A549 333133 CH22_FGENES.83_9 2.66 HT29, OVCA-R, A549 304074 Hs.142528 ESTs 2.65 DU145, CALU6, EB

330919 Hs.86941 ESTs 2.65 PRSC_con, RPWE-2, LnCap 333248. CH22_FGENES.115_5 2.65 NCI-H345, PRSC_con, 336665 CH22_FGENES.42-2 2.65 NCI-H69, PRSC_log, PRSC_con 315322 EST cluster (not in 2.65 A549, MB-MDA-053, MB-MDA-435s AA770599 UniGene) 307474 EST singleton (not in 2.65 NCI-H69, NCI-H345, A1264023 UniGene) with exon RPWE-2 320221 Hs.127384 DKFZP564C196 2.65 MB-MDA-453, MCF7, HT29 AL050020 protein 301767 EST 2.65 NCI-H345, PRSC_con, AW361892 PRSC_log 327246 CH.01 hs gi~5867547 2.65 EB OVCA-R DU145 337403 CH22_FGENES.752-2 2.65 PRSC con, PRSC_log, 328221 CH.06_hs gi~5868099 2.64 MCF7, MB-MDA-231, BT474 336759 CH22_FGENES.133-2 2.64 NCI-H69, PRSC_log, PRSC_con 327532 CH.02_hs gi~6469818 2.64 PC3, CALU6, A549 305621 EST singleton (not in 2.64 HT29, MB-MDA-231, MB-MDA-453 AA789095 UniGene) with exon 322931 Hs.151764 ESTs 2.64 PRSC_con, RPWE-2, NCI-H345 327278 CH.01 hs gi~5867473 2.64 EB, NCI-H460, NCI-H69 332235 Hs.109284 ESTs 2.64 DU145, EB, OVCA-R

332792 CH22_FGENES.3_2 2.63 HT29, Caco2, A549 312340 Hs.176333 2.63 NCI-358, NCI-358, HT29 AI862668ESTs 337484 CH22_FGENES.795-8 2.63 NCI-H69, NCI-H345, PRSC_con 325783 CH.14_hs 2.63 EB, OVCA-R, PC3 gi~6456780 303672 Hs.210527 2.63 PRSC_log, NCI-H345, AW502380ESTs NCI-H69 306009 EST singleton 2.63 HT29, MB-MDA-231, CALU6 AA894560(not in UniGene) with exon 308548 EST singleton 2.63 PC3, A549, NCI-358 AI695484(not in UniGene) with exon 337930 CH22_EM:AC005500.GENSCAN.81-3 2.62 PC3, OVCA-R, MCF7 327791 CH.05_hs 2.62 PRSC_log, PRSC_con, gi~5867977 NCI-H345 330925 Hs.87073 2.62 OVCA-R, MCF7, LnCap AA232678ESTs 327259 CH.01 hs 2.62 NCI-H345, PRSC_con, gi~5867454 RPWE-2 302150 Hs.152531 2.61 OVCA-R, PC3, A549 AF061756heart and neural crest derivatives expre 304881 Hs.195188 MB-MDA-435s, NCI-H23, AA598501glyceraldehyde-3-phosphate MCF7 dehydrogenase 2.61 335956 CH22_FGENES.647 2.61 DU145, PRSC_con, PC3 326506 CH.19_hs 2.61 RPWE-2, NCI-H460, NCI-358 gi~5867435 335863 CH22_FGENES.629_8 2.61 PC3, HT29, NCI-358 334752 CH22_FGENES.428 2.61 PRSC_con, NCI-H69, 1 PRSC_log 333288 CH22_FGENES.128_19 2.61 HT29, NCI-358, Caco2 306709 Hs.131477 2.61 MB-MDA-435s, MCF7, 305816 EST singleton 2.6 MB-MDA-453, MCF7, MB-MDA-435s AA854776(not in UniGene) with exon 327264 CH.01 hs 2.6 MB-MDA~35s, MB-MDA-435s, gi~5867461 MB-MDA-453 310905 Hs.252259 2.6 OVCA-R, EB, DU145 AW075527ribosomal protein 324492 Hs.135179 2.6 DU145, EB, OVCA-R
AA479507ESTs 322649 EST cluster 2.6 PRSC_con, RPWE-2, PRSC-log AA526549(not in UniGene) 329384 CH.X_hs 2.6 NCI-H69, NCI-H345, gi~5868869 PRSC_con 321240 EST cluster 2.6 BT474, CALU6, MB-MDA-231 M62378 (not in UniGene) 302751 Hs.156110 ble 2:59 MCF7, MB-MDA-453, OVCA-R
AA299576Immunoglobulin 1D-8 kappa varia 305841 EST singleton 2.59 NCI-H345, PRSC_log, AA860348(not in PRSC_con UniGene) with exon 324180 Hs.122799 2.58 EB, PC3, HT29 AA402242ESTs 334196 CH22_FGENES.353 2.58 NCI-H345, NCI-H69, 4 PRSC_con 338451 CH22_EM:AC005500.GENSCAN.359-39 2.58 MB-MDA~t35s, NCI-H23, 300333 Hs.227052 2.58 PRSC_con, PRSC_log, AW297396ESTs NCI-H69 305046 EST singleton 2.58 NCI-H460, MB-MDA-453, AA632201(not in MB-MDA-035s UniGene) with exon 305648 Hs.156110 2.57 PRSC-con, RPWE-2, NCI-H345 AA807652Immunoglobulin kappa variable 301744 EST 2.57 PRSC_con, PRSC_log, 329182 CH.X_hs 2.57 PRSC-con, RPWE-2, NCI-H345 gi~6056331 318178 Hs.158401 2.57 MB-MDA-231, PRSC-con, AW137425ESTs BT474 330057 CH.17_p2 2.57 NCI-H345, RPWE-2, PRSC_con gi~6478962 326552 CH.19_hs 2.57 NCI-H345, PRSC_con, gi~5867308 RPWE-2 311956 Hs.188464 2.57 HT29, MB-MDA-053, NCI-H460 T67085 ESTs 327185 CH.01 hs 2.57 CALU6, HT29, EB
gi~6117805 302183 EST 2.57 MCF7, PC3, OVCA-R
NM_00224 327263 CH.01_hs 2.56 PRSC_con, NCI-H69, gi~6525274 PRSC_log 339164 CH22_DA59H18.GENSCAN.69-4 2.56 NCI-H69, PRSC_con, 332763 Hs.90959 2.56 RPWE-2, NCI-H345, PRSC_con AA063554ESTs 330579 Hs.154437 2.55 HT29, CALU6, PC3 U67733 phosphodiesterase 2A; cGMP-stimulated 329948 CH.16_p2 2.55 NCI-H460, MCF7, MB-MDA-453 gi~5540101 300282 Hs.236131 2.55 NCI-H460, NCI-H23, AW044305ESTs; Highly NCI-H23 similar to homeodomain-inte 335448 CH22_FGENES.562_5 2.55 MB-MDA~453, BT474, 330959 Hs.26484 2.55 MB-MDA~t53, HT29, MCF7 H09174 HIRA-interacting protein 307262 EST singleton 2.55 MCF7, DU145, MB-MDA-435s AI202100(not in UniGene) with exon 335806 CH22_FGENES.616 2.55 NCI-H345, NCI-H69, 8 PRSC-con 335782 CH22_FGENES.609 2.55 Caco2, MB-MDA-453, 4 MB-MDA~t35s 301703 EST 2.55 PC3, MCF7, MB-MDA-453 329018 CH.Y~hs 2.54 NCI-H69, PRSC log, gi~6249620 PRSC_con 329870 CH.14_p2 2.54 NCI-H23, NCI-H460, gi~6706435 NCI-358 334504 CH22_FGENES.398_2 2.54 HT29, BT474, MB-MDA-231 304707 EST singleton 2.53 NCI-H520, EB, NCI-H460 AA564846(not in UniGene) with exon 329326 CH.)~hs 2.53 MB-MDA-231, NCI-H345, gi~5868806 NCI-H69 334418 CH22_FGENES.384 2.53 NCI-H23, NCI-358, NCI-H460 338124 CH22_EM:AC005500.GENSCAN.196-2 2.53 NCI-H69, PRSC_con, PRSC_log 318423 Hs.214491 2.53 OVCA-R, EB, DU145 AI362671ESTs 333006 CH22_FGENES.60_3 2.53 NCI-H69, PRSC_con, PRSC_log 333668 CH22_FGENES.245_2 2.53 NCI-H69, PRSC_log, PRSC con 333567 CH22_FGENES.184 2.53 NCI-H69, NCI-H345, 2 PRSC_con 309592 EST singleton 2.52 LnCap, NCI-H69, DU145 AW172384(not in UniGene) with exon 328989 CH.09_hs 2.52 MB-MDA-435s, OVCA-R, gi~5868535 EB

326725 CH.20_hs 2.52 PRSC_con, NCI-H345, gi~6552456 NCI-H69 302996 EST 2.52 HT29, BT474, CALU6 335733 CH22_FGENES.601 2.52 NCI-H69, PRSC_log, 336000 CH22_FGENES.658_1 2.52 LnCap, OVCA-R, DU145 327774 CH.05_hs 5867964 2.52 DU145, CALU6, HT29 gi~

328557 CH.07_hs 5868489 2.52 MB-MDA-453, MB-MDA-435s, gi~ MCF7 328228 CH.06_hs 5868105 2.52 NCI-H69, NCI-H345, gi~ PRSC_con 328305 CH.07_hs 6004478 2.52 NCI-H69, NCI-H460, gi~ PRSC_log 334010 CH22_FGENES.313_1 2.51 NCI-H69, PRSC_log, PRSC_con 339033 CH22_DA59H18.GENSCAN,26-12.51 NCI-H69, NCI-H345, PRSC_can 335340 CH22_FGENES,535 17 2,51 NCI-H69, PRSC_con, PRSC_log 300156 Hs,233395 ESTs 2.51 PRSC_con, PRSC_log, 305880 Hs.156110 Immunoglobulin2.5 EB, OVCA-R, DU145 AA866065kappa variable 1D-8 310841 Hs.232024 ESTs 2.5 LnCap, NCI-358, CALU6 336908 CH22_FGENES.343-2 2.5 NCI-H345, RPWE-2, PRSC_log 304674 EST singleton (not in 2.5 RPWE-2, NCI-H69, MCF7 AA541735UniGene) with exon 314521 Hs,107149 ESTs; Weakly S2.5 NCI-H460, EB, Caco2 AW503939similar to PTB-ASSOCIATED

307592 EST singleton (not in 2.5 PRSC_con, NCI-H345, AI285739UniGene) with exon PRSC_log 331476 Hs.43768 ESTs 2.5 NCI-H345, NCI-H69, N26190 PRSC_con 325803 CH.14_hs gi~6552451 2.5 NCI-H345, RPWE-2, PRSC_con 306549 EST singleton (not in 2.49 A549, OVCA-R, CALU6 AA993796UniGene) with exon 304833 EST singleton (not in 2.49 MCF7, DU145, LnCap AA586504UniGene) with exon 336333 CH22_FGENES.813_1 2.49 NCI-H345, PRSC_con, PRSC_log 332320 Hs.100551 EST 2.49 NCI-H345, LnCap, RPWE-2 328236 CH.06_hs gi~5868117 2.49 PRSC_con, NCI-H345, PRSC log 317335 Hs.130210 ESTs 2.49 MCF7, MB-MDA-453, PC3 339188 CH22 DA59H18.GENSCAN.72-162.48 NCI-H69, PRSC_con, PRSC_log 334235 CH22_FGENES.361 19 2.48 NCI-H520, MB-MDA-453, 301214 Hs.157034 ESTs; Weakly 2.48 HT29, A549, A549 AW450950similar to Unknown [H.sapie 332843 CH22_FGENES.19 1 2.48 DU145, CALU6, EB

337431 CH22_FGENES.763-7 2.48 PRSC_con, RPWE-2, NCI-H69 336757 CH22 FGENES.131-1 2.48 NCI-H69, PRSC_log, PRSC_con 305403 EST singleton (not in 2.48 NCI-H23, DU145, OVCA-R
AA723748UniGene) with exon 330065 CH.19_p2 gi~6165044 2.48 PRSC_con, PRSC_log, 309245 EST singleton (not in 2.48 MB-MDA-231, NCI-H69, AI972447UniGene) with exon HT29 328876 CH.07_hs gi~6525286 2.47 MB-MDA-231, CALU6, 333944 CH22_FGENES.302_2 2.47 NCI-H69, RPWE-2, PRSC_log 328504 CH.07_hs gi~5868471 2.47 LnCap, MB-MDA-453, MB-MDA-435s 338120 CH22_EM:AC005500.GENSCAN.195-12.47 MB-MDA-231, NCI-H69, PRSC_con 306710 EST singleton (not in 2.47 OVCA-R, EB, LnCap A1024221UniGene) with exon 305064 EST singleton (not in 2.47 NCI-H69, RPWE-2, PRSC_con AA636012UniGene) with exon 329995 CH.16_p2 gi~4567166 2.47 OVCA-R, DU145, MB-MDA-053 315694 Hs.168418 ESTs; Moderately2.46 EB, A549, LnCap AI821743similar to !!!! ALU
SUB

331004 Hs.32748 ESTs 2.46 EB, MCF7, MB-MDA-035s 305259 EST singleton (not in 2.46 PRSC con, NCI-H345, AA679225UniGene) with exon RPWE-2 304576 EST singleton (not in 2.46 PRSC_con, RPWE-2, PRSC_log AA496563UniGene) with exon 318887 Hs.21065 ESTs 2.46 NCI-H345, Caco2, Caco2 308954 EST singleton (not in 2.46 PRSC-con, PRSC-log, AI868958UniGene) with exon RPWE-2 301140 Hs.207128 ESTs 2.46 OVCA-R, MB-MDA-231, 322085 Hs.170298 ESTs 2.46 PRSC_log, PRSC-con, 339130 CH22 DA59H18.GENSCAN.56-32.46 NCI-H345, PRSC_con, 337612 CH22 C20H12.GENSCAN,22-52.46 EB, A549, Caco2 313765 Hs.185981 ESTs; Weakly 2.45 RPWE-2, PRSC_log, PRSC
AW206181similar to gag [H.sapiens] con 311665 Hs.223742 ESTs 2.45 PRSC_log, RPWE-2, PRSC_con 328620 CH.07_hs gi~5868241 2.45 MB-MDA-453, MCF7, MB-MDA-435s 305361 EST singleton (not in 2.45 HT29, MB-MDA-435s, AA708902UniGene) with exon A549 336243 CH22_.FGENES.746_1 2.44 OVCA-R, MB-MDA~53, MB-MDA-435s 320299 Hs.177181 ESTs 2.44 PRSC_con, RPWE-2, NCI-H345 302535 EST 2.44 MB-MDA-453, EB, DU145 333465 ' CH22 FGENES.160 2 2.44 NCI-H69, PRSC_con, PRSC_log 334109 CH22_FGENES.330 8 2.44 NCI-H69, NCI-H345, PRSC_log 301749 Hs.90790 ' ESTs 2.44 NCI-H345, RPWE-2, PRSC_log 324575 EST cluster (not in 2.44 NCI-H345, PRSC_con, AW502257UniGene) RPWE-2 337114 CH22 FGENES.494-17 2.44 NCI-H69, PRSC_log, PRSC_con 336087 CH22_FGENES.688_16 2.44 PRSC_con, Caco2, PRSC_log 315678 Hs.120036 ESTs 2.44 NCI-358, PC3, NCI-H23 333258 CH22_FGENES.118 6 2.44 MB-MDA-231, HT29, CALU6 303798 Hs.36977 hemoglobin; 2.44 MB-MDA~t35s, MCF7, V00505 delta MB-MDA~t53 309759 EST singleton (not in 2.44 MB-MDA~453, EB, MCF7 AW268822UniGene) with exon 318946 EST cluster (not in 2.44 PC3, OVCA-R, DU145 A1122843UniGene) 321986 EST cluster (not in 2.44 DU145, CALU6, CALU6 AL133656UniGene) 338151 CH22_EM:AC005500.GENSCAN.207-52.44 PRSC_con, PRSC_log, 327056 CH.21 hs gi~6531965 2.44 PRSC-con, NCI-H345, 309605 EST singleton (not in 2.43 NCI-358, NCI-H23, NCI-H520 AW182800UniGene) with exon 335783 CH22_FGENES.610 3 2.43 PRSC_con, PRSC_log, 325790 CH.14_hs gi~6381957 2.43 MB-MDA-435s, MB-MDA-453, 339342 CH22_BA354112.GENSCAN.27-102.43 BT474, MB-MDA-231, 335777 CH22_FGENES.607_13 2.43 DU145, EB, BT474 309972 Hs.257283 ESTs 2.43 MCF7, MB-MDA-453, OVCA-R

308718 EST singleton (not in 2.43 NCI-H345, PRSC_con, AI798009UniGene) with exon PRSC_log 338087 CH22_EM:AC005500.GENSCAN.174-162.43 DU145, PC3, CALU6 306930 EST singleton (not in 2.43 NCI-H69, MCF7, BT474 AI124518UniGene) with exon 319032 Hs.80449 ESTs; Weakly 2.43 RPWE-2, A549, NCI-H69 AW409728similar to cytoplasmic dyne 304330 EST singleton (not in 2.43 MB-MDA-453, PC3, OVCA-R
AA157834UniGene) with exon 320638 Hs.101120 ESTs 2.43 MCF7, MB-MDA-435s, 335281 CH22_FGENES.524 2.43 PC3, LnCap, A549 317431 Hs.132453 2.43 NCI-H345, RPWE-2, AI675790 ESTs PRSC_log 306511 EST singleton 2.43 OVCA-R, EB, DU145 AA988891 (not in UniGene) with exon 333298 CH22_FGENES.133 2.43 EB, DU145, PC3 328436 CH.07 hs 2.43 EB, LnCap, A549 gi~5868417 333420 ' CH22_FGENES.146_11 2.43 NCI-H345, NCI-H69, PRSC_log 338113 CH22_EM:AC005500.GENSCAN.188-13 2.42 DU145, EB, CALU6 335188 CH22_,FGENES.507 2.42 EB, A549, BT474 329164 CH.X."hs 2.42 RPWE-2, PRSC_con, gi~5868691 PRSC_log 336316 CH22_FGENES.799_11 2.42 MB-MDA-435s, MCF7, 310831 Hs.161142 2.42 NCI-H345, PRSC_con, AI927594 ESTs PRSC_log 327334 . CH.01 2.42 MB-MDA-053, MB-MDA-435s, hs gi~5902477 MCF7 334017 CH22_,FGENES.315 2.42 PRSC_con, PRSC_log, 308138 EST singleton 2.42 DU145, LnCap, EB
AI494446 (not in UniGene) with exon 333074 CH22-FGENES.76_10 2.42 NCI-H69, RPWE-2, PRSC_log 306546 EST singleton 2.42 HT29, CALU6, LnCap AA993109 (not in UniGene) with exon 336516 CH22_FGENES.836_1 2.42 NCI-H69, PRSC-con, PRSC-log 306791 EST singleton 2.42 CALU6, DU145, EB
A1042387 (not in UniGene) with exon 329411 CH.X-hs 2.42 OVCA-R, EB, LnCap gi~6682549 308659 EST singleton 2.41 EB, DU145, CALU6 AI750091 (not in UniGene) with exon 313504 Hs.143127 2.41 DU145, EB, CALU6 AI190405 ESTs 326073 CH.17_hs 2.41 DU145, A549, MB-MDA-435s gi~6682495 334047 CH22_FGENES.326_5 2.41 PRSC con, PRSC_log, 325464 CH.12 hs 2.41 NCI-358, NCI-H23, gi~5866947 NCI-H460 334764 CH22 FGENES.428_13 2.41 NCI-H69, NCI-H345, 312737 Hs.132895 2.41 OVCA-R, DU145, A1033500 ESTs CALU6 306591 EST singleton 2.41 MB-MDA-231, MCF7, A1000248 (not in DU145 UniGene) with exon 333582 CH22 FGENES.201 2.41 NCI-H69, PRSC con, 2 PRSC_log 337843 CH22-EM:AC005500.GENSCAN.30-8 2.4 EB, LnCap, A549 335284 CH22_FGENES.526_6 2.4 NCI-H69, NCI-H345, PRSC_log 305134 EST singleton 2.4 DU145, HT29, MB-MDA-453 AA653159 (not in UniGene) with exon 335527 CH22_FGENES.572_7 2.4 DU145, OVCA-R, EB

336795 CH22_FGENES.176-5 2.4 NCI-H69, NCI-H345, PRSC-log 303144 EST 2.4 PRSC_con, PRSC_log, 334948 CH22 FGENES.465_15 2.4 PRSC con, PRSC_log, ~ RPWE-2 328860 CH.07_hs 2.4 PRSC con, PRSC_log, gi~6381928 NCI-H345 322929 Hs.146246 2.4 NCI-H460, A549, AI365585 ESTs HT29 333561 CH22 FGENES.180_18 2.4 OVCA-R, EB, DU145 338239 CH22_EM:AC005500.GENSCAN.2645 2.4 NCI-H69, NCI-H345, PRSC_con 323670 Hs.161763 2.4 DU145, MB-MDA-453, AL040411 ESTs; EB
Weakly similar to KIAA0738 protein 305903 EST singleton 2.4 MCF7, A549, NCI-H520 AA873085 (not in UniGene) with exon 312573 Hs.190526 2.4 LnCap, NCI-H460, AW297673 ESTs NCI-H23 334470 CH22_FGENES.394_1 2.4 NCI-H520, HT29, 333272 CH22_FGENES.122-1 2.39 NCI-H345, PRSC
con, RPWE-2 304010 Hs.177592 2.39 DU145, CALU6, EB
AW518383 ribosomal protein;
large;

337316 CH22_FGENES.692-1 2.39 MCF7, BT474, OVCA-R

316769 Hs.212184 2.39 PRSC_con, NCI-H345, AI914939 ESTs RPWE-2 336280 CH22-FGENES.763 2.39 NCI-H345, PRSC-log, 4 PRSC-con 331223 Hs.194181 2.39 DU145, HT29, PC3 T98872 ESTs 337172 CH22 FGENES.565-2 2.39 EB, OVCA-R, DU145 300625 Hs.143631 2.39 EB, NCI-H520, LnCap AI671992 ESTs;
Weakly similarto WASP-family prot 337092 CH22_FGENES.465-12 2.39 PRSC con, PRSC_log, 334528 CH22_FGENES.402 2.39 NCI-H345, PRSC_con, 338411 CH22_EM:AC005500.GENSCAN.341-7 2.39 NCI-H345, NCI-H69, PRSC_con 331344 Hs.70208 2.39 PC3, EB, A549 AA357927 ESTs 334044 CH22_FGENES.323_2 2.38 MB-MDA-231, MCF7, LnCap 333918 CH22_FGENES.296 2.38 RPWE-2, NCI-H345, 317168 Hs.125910 2.38 NCI-H345, PRSC_con, AI042614 ESTs RPWE-2 333424 CH22-FGENES.147 2.38 DU145, MCF7, OVCA-R

317779 Hs.128381 2.38 EB, DU145, OVCA-R
AW450515 ESTs 315142 Hs.190219 2.38 OVCA-R, EB, CALU6 AI380577 ESTs 310471 Hs.149596 2.38 NCI-H460, NCI-H23, AW270515 ESTs NCI-H23 325049 Hs.256310 2.38 PRSC_con, RPWE-2, AW410339 ESTs; NCI-H345 Weakly similar to centaurin beta2 305234 EST singleton 2.38 MB-MDA-453, MB-MDA-231, AA670431 (not in A549 UniGene) with exon 337760 CH22_EM:AC000097.GENSCAN.116-8 2.38 PRSC_con, PRSC_log, 311502 Hs.208662 2.38 NCI-H345, NCI-H69, AW204380 ESTs LnCap 337548 - CH22_FGENES.844-5 2.38 MB-MDA-453, MCF7, 326981 CH.21 hs 2.38 NCI-H345, NCI-H69, gi~6588016 PRSC_con 309600 EST singleton 2.37 RPWE-2, NCI-358, AW182066 (not in NCI-H69 UniGene) with exon 328936 CH.08_hs 5868500 2.37 OVCA-R, MB-MDA-453, gi~ CALU6 327937 CH.06_hs 5868192 2.37 BT474, EB, OVCA-R
gi~

328282 CH.07_hs 5868353 2.37 DU145, CALU6, CALU6 gi~ .

303607 Hs.208206 y similar 2.37 LnCap, PRSC_log, AL046388 ESTs; to Naf1 alpha NCI-H345 Weakl prate 304227 Hs.75344 2.37 EB, PC3, OVCA-R
N94974 ribosomal protein S4; X-linked 314101 Hs.257542 2.37 OVCA-R, CALU6, AW452279 ESTs CALU6 325026 Hs.12285 2.37 NCI-H345, PRSC_con, AI671168 ESTs PRSC_log 315015 Hs.132625 ESTs 2.37 MB-MDA-453, MB-MDA-231, AI659989 LnCap 328662 CH.07_hs gij6004473 2.37 NCI-H345, RPWE-2, PRSC con 305867 EST singleton (not in 2.37 MCF7, MB-MDA-453, AA864572UniGene) with exon MB-MDA-231 333296 CH22_FGENES.132_3 2.37 EB, PC3, CALU6 331070 Hs.182059 ESTs 2.36 OVCA-R, MB-MDA~t53, 333698 CH22_FGENES.250_12 2.36 HT29, OVCA-R, Caco2 316423 Hs.121380 ESTs 2.36 HT29, MCF7, MB-MDA-435s 323189 Hs.120589 ESTs 2.36 PC3, NCI-H460, DU145 318889 Hs.18720 programmed cell2.36 OVCA-R, A549, MB-MDA-453 243296 death 8 (apoptosis-induc 334237 CH22_FGENES.362-1 2.36 NCI-H345, NCI-H69, LnCap 315931 Hs.117328 ESTs 2.36 MCF7, NCI-H345, DU145 326884 CH.20 hs gij6682511 2.36 A549, EB, PC3 333132 CH22_FGENES.83 8 2.36 NCI-H69, HT29, EB

306574 Hs.76067 heat shock 27kD2.36 RPWE-2, PRSC_log, AA995719protein 1 PRSC con 324416 Hs.194115 ESTs 2.36 NCI-H345, RPWE-2, AI669524 PRSC_con 329496 CH.10_p2 gij3983518 2.35 HT29, MCF7, MB-MDA-231 320994 EST cluster (not in UniGene)2.35 NCI-H23, A549, CALU6 320481 Hs.24372 ESTs; Weakly 2.35 PRSC-con, RPWE-2, AA461139similar to dJ207H1.1 PRSC_log [H.sap 309958 EST singleton (not in 2.35 NCI-H345, PRSC_con, AW444488UniGene) with exon PRSC_log 327009 CH.21_hs gij5867664 2.35 HT29, BT474, MCF7 309594 Hs.181165 eukaryotic 2.35 HT29, DU145, EB
AW172821translation elongation factor 335468 CH22_FGENES.567 4 2.35 NCI-H69, PRSC_con, 304269 EST singleton (not in 2.35 PRSC_con, PRSC_log, AA069029UniGene) with exon RPWE-2 305877 EST singleton (not in 2.35 A549, MCF7, OVCA-R
AA865649UniGene) with exon 305700 EST singleton (not in 2.35 PRSC_con, NCI-H345, AA815428UniGene) with exon PRSC_log 326423 CH.19_hs gij5867369 2.34 PC3, MCF7, LnCap 334560 CH22_FGENES.404_3 2.34 HT29, NCI-H460, MB-MDA-035s 337100 CH22_FGENES.472-3 2.34 PRSC-log, PRSC-con, 301505 Hs.144849 ESTs 2.34 CALU6, MB-MDA-231, 312142 Hs.221069 ESTs 2.34 PRSC_con, RPWE-2, AW298359 PRSC log 305787 EST singleton (not in 2.34 NCI-H23, NCI-H520, AA845035UniGene) with exon NCI-H460 338686 CH22_EM:AC005500.GENSCAN.472-52.33 BT474, MB-MDA-231, 331977 Hs.125887 ESTs 2.33 OVCA-R, A549, MB-MDA-435s 314687 Hs.135177 ESTs 2.33 NCI-H69, PRSC_con, 336089 CH22,FGENES.688_18 2.33 PRSC_con, Caco2, PRSC_log 338952 CH2~..DJ32110.GENSCAN.23-222.33 PC3, OVCA-R, HT29 334612 CH22 FGENES.411 11 2.33 OVCA-R, MB-MDA-453, EB

338223 CH22_EM:AC005500.GENSCAN.250-102.33 DU145, MB-MDA-453, 327845 CH.05_hs gij6531962 2.32 OVCA-R, MB-MDA~53, 308187 Hs.156110 Immunoglobulin2.32 NCI-H69, NCI-358, AI538108kappa variable 1D-8 PRSC_con 317767 Hs.128340 ESTs; Weakly 2.32 BT474, CALU6, MB-MDA-231 AW294164similar to Cdc42 GTPase-act 330468 Hs.112341 protease inhibitor2.32 PC3, Caco2, HT29 L10343 3; skin-derived (SKAL

319003 EST cluster (not in UniGene)2.32 MCF7, PC3, MB-MDA-453 323022 Hs.133865 ESTs 2.32 CALU6, MB-MDA-231, 303148 Hs.127317 ESTs; Weakly 2.32 NCI-H345, PRSC_con, 873167 similar to CYTOCHROME RPWE-2 303215 EST 2.32 NCI-H345, PRSC_con, AW250314 PRSC_log 318891 Hs.196208 ESTs; Weakly 2.32 NCI-H69, LnCap, NCI-H345 H10477 similarto 1111 ALU SUBFAMI

336653 CH22_FGENES.33-4 2.32 DU145, EB, LnCap 333329 CH22_FGENES.138 22 2.32 DU145, BT474, MB-MDA-231 301980 Hs.121498 potassium voltage~ated2.31 NCI-H345, MB-MDA-231, U69962 channel; Shab-re LnCap 336968 CH22_FGENES.375-28 2.31 HT29, BT474, EB

308539 EST singleton (not in 2.31 NCI-H345, NCI-H69, AI694191UniGene) with exon PRSC_log 326417 CH.19_hs gij5867362 2.31 HT29, MCF7, BT474 328851 CH.07_hs gij6381923 2.31 NCI-H520, NCI-H460, 329254 CH.X_hs gij5868733 2.31 RPWE-2, NCI-H345, PRSC_con 303075 Hs.59125 ESTs 2.3 DU145, OVCA-R, EB

335131 CH22_FGENES.497_15 2.3 NCI-H69, NCI-H345, PRSC_log 303129 Hs.172210 MUF1 protein 2.3 LnCap, DU145, HT29 327067 CH.21 hs gij6531965 2.3 NCI-H345, NCI-H69, MB-MDA-435s 324064 EST cluster (not in UniGene)2.3 DU145, HT29, EB

325965 CH.16_hs gij5867147 2.3 NCI-H69, NCI-H345, 334525 CH22_FGENES.402 4 2.3 NCI-H345, PRSC_con, 336654 CH22_FGENES.34-2 2.3 BT474, PC3, MB-MDA-453 302348 Hs.194680 WNT1 inducible2.3 LnCap, CALU6, DU145 AF100779signaling pathway protein 309275 EST singleton (not in 2.3 NCI-H460, NCI-H23, AI989570UniGene) with exon NCI-H520 329246 CH.X_hs gij5868732 2.3 NCI-H69, NCI-H345, PRSC_log 305557 EST singleton (not in 2.3 CALU6, CALU6, MCF7 AA774834UniGene) with exon 322907 EST cluster (not in UniGene)2.3 MB-MDA-231, CALU6, 318683 Hs.202653 ESTs; Weakly 2.29 NCI-H345, PRSC_con, AI703241similar to Xin [M.musculus] RPWE-2 309233 EST singleton (not in 2.29 CALU6, OVCA-R, EB
AI971416UniGene) with exon 308913 Hs.119122 ribosomal protein2.29 MB-MDA-435s, MCF7, AI860692L13a HT29 335827 CH22_FGENES.620_1 2.29 PRSC_con, PRSC-log, 334066 CH22_FGENES.327_21 2.29 PRSC_con, PRSC_log, 302656 Hs.220905 ESTs 2.29 NCI-H23, Caco2, CALU6 308974 Hs.140 immunoglobulin 2.29 CALU6, A549, NCI-H69 AI872290gamma 3 (Gm marker) 333607 CH22_FGENES.216 2 2.29 OVCA-R, MCF7, A549 335174 CH22_FGENES.504 4 2.29 HT29, A549, MB-MDA-453 332028 Hs.134406 ESTs; Weakly 2.29 EB, A549, DU145 AA489680similar to Dim1p homolog [H

336417 CH22_FGENES.823 39 2.29 NCI-H69, NCI-H345, PRSC_log 323426 EST cluster (not in UniGene)2.29 HT29, MB-MDA-231, 336618 CH22_FGENES.2-1 2.29 NCI-358, NCI-H460, 310017 Hs.148488 ESTs 2.29 NCI-H345, PRSC_log, AI188739 PRSC_con 334055 CH22_FGENES.327_6 2.28 DU145, OVCA-R, 337168 CH22_FGENES.562-28 2.28 NCI-H69, PRSC_log, 329824 CH.14_p2 gi~6630758 2.28 NCI-H23, CALU6, 333891 CH22_FGENES.292_13 2.28 NCI-H69, MB-MDA-231, 339127 CH22_DA59H18.GENSCAN.55-12.28 PRSC_con, NCI-H345, 305686 EST singleton (not in 2.28 NCI-H520, NCI-H23, AA812726UniGene) with exon NCI-H460 329782 CH.14~2 gi~5912597 2.28 NCI-H69, NCI-H345, PRSC_log 311059 Hs.175346 ESTs 2.28 MCF7, BT474, MB-MDA-035s 336934 CH22_FGENES.351-1 2.28 BT474, HT29, MB-MDA-435s 314893 EST cluster (not in UniGene)2.28 OVCA-R, HT29, DU145 331596 Hs.50220 ESTs 2.28 A549, MCF7, NCI-358 330729 Hs.3736 ESTs; Weakly E MB-MDA-231, CALU6, AA258559similar to DELTA-LIKE 2.28 MCF7 PROT

338285 CH22_.EM:AC005500.GENSCAN.29332.27 NCI-H69, PRSC_log, PRSC_con 300154 Hs.179331 ESTs 2.27 NCI-H23, NCI-H520, 306383 Hs.183698 ribosomal protein2,27 RPWE-2, NCI-H345, AA969078L29 PRSC_log 309005 EST singleton (not in 2.27 A549, MCF7, BT474 AI884454UniGene) with exon 332995 CH2~FGENES.58_2 2.27 RPWE-2, NCI-H345, PRSC log 337426 CH22_FGENES.761-3 2.27 DU145, EB, CALU6 337778 CH22_EM:AC000097.GENSCAN.119-202.27 NCI-H69, PRSC_con, PRSC_log 329705 CH.14_p2 gi~6065790 2.27 PRSC_con, PRSC_log, 335971 CH22_,FGENES.652 4 2.27 PRSC_log, MB-MDA-231, 315862 Hs.133996 ESTs 2.27 HT29, MB-MDA~t35s, 316466 Hs.126365 ESTs 2.27 NCI-H460, NCI-358, 334430 CH22_FGENES.385 3 2.27 NCI-H345, NCI-H69, PRSC_con 331941 Hs.99272 ESTs 2.26 PRSC_con, LnCap, AA452257 PRSC_log 301230 Hs.153019 ESTs 2.26 NCI-H345, PRSC_log, 317394 Hs.190518 ESTs 2.26 NCI-H345, PRSC_con, AI935024 PRSC_log 306220 EST singleton (not in 2.26 NCI-H345, PRSC_con, AA928363UniGene) with exon PRSC_log 304134 EST singleton (not in 2.26 DU145, CALU6, PC3 H54627 UniGene) with exon 335421 CH22_FGENES.551 1 2.26 NCI-H69, PRSC_con, PRSC_log 305260 Hs.156110 Immunoglobulin2.26 NCI-H345, NCI-H69, AA679280kappa variable 1 D-8 PRSC con 303592 EST 2.26 CALU6, OVCA-R, 317982 Hs.130607 ESTs 2.26 PC3, MB-MDA-435s, 325304 CH.11_hs gi~5866910 2.26 MCF7, CALU6, A549 334118 CH22_FGENES.330_19 2.26 PRSC_con, NCI-H69, PRSC_log 335687 CH2~FGENES.596 2 2.26 A549, CALU6, LnCap 334035 CH22 FGENES.322 3 2.26 NCI-H345, PRSC_con, 305454 EST singleton (not in 2.25 EB, HT29, CALU6 AA738413UniGene) with exon 335902 CH22_FGENES.635_10 2.25 EB, DU145, HT29 339215 CH22_FF113D11.GENSCAN.6-102.25 PRSC_con, PRSC_log, 328810 CH.07_hs gi~5868327 2.25 PC3, OVCA-R, MB-MDA-453 337396 CH22_FGENES.749-1 2.25 EB, A549, DU145 336808 CH22_FGENES.205-3 2.25 NCI-H345, NCI-H69, PRSC_con 305808 EST s!ngleton (not in 2.24 MB-MDA-453, DU145, AA853958UniGene) with exon EB

333571 CH22_FGENES.188 2 2.24 MCF7, MB-MDA-453, 323023 Hs.258539 ESTs 2.24 EB, DU145, CALU6 334626 CH22_FGENES.416_2 2.24 NCI-H69, NCI-H345, PRSC_log 333593 CH22_FGENES.210 2 2.24 NCI-H69, NCI-H345, PRSC_con 326708 CH.20_hs gi~5867593 2.24 NCI-H460, NCI-H23, 314502 Hs.132141 ESTs 2.23 NCI-H345, RPWE-2, A1041717 PRSC_con 309181 EST singleton (not in 2.23 PRSC_con, PC3, Ai951727UniGene) with exon MB-MDA-231 324926 Hs.117798 ESTs 2.23 EB, EB, DU145 333632 CH22 FGENES.227 3 2.23 CALU6, CALU6, MB-MDA-453 328243 CH.06_hs gi~6056292 2.23 PC3, LnCap, LnCap 327037 CH.21_hs gi~6531965 2.23 LnCap, DU145, EB

307380 EST singleton (not in 2.23 NCI-H345, PRSC_con, AI222985UniGene) with exon PRSC_log 334766 CH22 FGENES.428_15 2.23 PRSC_log, NCI-H345, 335236 CH22-FGENES.515 8 2.23 OVCA-R, MCF7, BT474 336615 CH22_FGENES.613_5 2.23 NCI-H69, PRSC_log, PRSC_con 307558 EST singleton (not in 2.23 DU145, OVCA-R, AI281998UniGene) with exon CALU6 308029 Hs.62954 femtin; heavy 2.23 EB, OVCA-R, MB-MDA-453 AI457115polypep6de 1 331508 Hs.46732 EST 2.23 MB-MDA-453, MCF7, 320980 Hs.214142 5;10-methylenetetrahydrofolate2.23 OVCA-R, EB, EB
AJ237672reductase 304241 EST singleton (not in 2.23 BT474, MB-MDA-435s, AA010976UniGene) with exon MB-MDA-231 314682 Hs.178226 ESTs; Weakly 2.23 MB-MDA-231, MCF7, AI190864similar to !!1! ALU OVCA-R
SUBFAMI

308382 EST singleton (not in 2.22 OVCA-R, BT474, AI624301UniGene) with exon CALU6 314476 Hs.169604 ESTs 2.22 DU145, EB, A549 327864 CH.06 hs gi~5868130 2.22 NCI-H69, PRSC_log, PRSC_con 337279 CH22_FGENES.665-2 2.22 NCI-H345, NCI-H69, PRSC_con 302263 EST 2.22 BT474, NCI-H520, 322840 EST cluster (not in 2.22 HT29, MB-MDA-453, AA083710UniGene) CALU6 307574 EST singleton (not in 2.22 OVCA-R, CALU6, BT474 AI283549UniGene) with exon 319027 EST cluster (not in 2.22 LnCap, NCI-H69, NCI-H69 AA716612UniGene) 305925 EST singleton (not in 2.22 NCI-H345, NCI-H69, AA877883UniGene) with exon NCI-H69 329725 CH.14_p2 gi~6065785 2.22 NCI-H69, PRSC_con, 316194 Hs.255774 ESTs 2.22 CALU6, EB, NCI-H520 301119 EST 2.22 A549, OVCA-R, EB

333815 CH22_FGENES.282 4 2.22 MB-MDA~t35s, EB, 334358 CH22_FGENES.378 1 2.22 NCI-H345, RPWE-2, PRSC_con 303763 Hs.30928 DNA segment 112.21Caco2, NCI-H23, NCI-H520 AF043250on chromosome 19 (unique) 335593 CH22_FGENES.581 32 2.21 NCI-H345, PRSC_log, 334026 CH22_FGENES.318_3 2.21 NCI-H69, PRSC con, 322224 EST cluster (not in 2.21 PRSC_con, PRSC log, AF086064UniGene) RPWE-2 309836 Hs.157397 ESTs 2.21 NCI-H345, PRSC_con, 332669 Hs.661 NADH dehydrogenase NCI-H520, CALU6, M33374 (ubiquinone) 1 beta OVCA-R
s 2.21 307629 EST singleton (not in 2.21 MB-MDA-231, MB-MDA-453, AI300246UniGene) with exon HT29 300470 EST 2.21 PC3, EB, CALU6 330064 CH.19_p2 gi~6165044 2.21 NCI-H69, PRSC_con, 338819 CH22_DJ246D7.GENSCAN.1-242.21 NCI-H69, RPWE-2, PRSC_log 337797 CH22_EM:AC005500.GENSCAN.3~t2.21 LnCap, NCI-H69, NCI-H520 328025 CH.06 hs gi~5902482 2.2 RPWE-2, PRSC con, PRSC_log 326240 CH.17_hs gi~5867260 2.2 EB, LnCap, MB-MDA-453 312865 Hs.173280 ESTs 2.2 DU145, DU145, OVCA-R

338450 CH22_EM:AC005500.GENSCAN.359-362.2 MCF7, MB-MDA-453, MB-MDA-435s 302532 Hs.248115 growth hormone2.2 PRSC_con, PRSC_log, U60181 secretagogue receptor PRSC log 321132 EST cluster (not in 2.2 NCI-H23, NCI-H520, AA081495UniGene) NCI-358 337787 CH22_EM:AC000097.GENSCAN.123-32.2 EB, PC3, LnCap 337032 CH22_FGENES.438-3 2.2 NCI-H69, NCI-H345, 300026 AFFX control: transfemn2.2 HT29, EB, MB-MDA-231 M11507 receptor 333139 CH22_FGENES.83 16 2.2 HT29, MB-MDA~53, Caco2 334298 CH22_,FGENES.372 4 2.2 PRSC_con, PRSC_log, 335002 CH22_FGENES.470 7 2.2 PRSC_con, NCI-H345, 335000 CH22_FGENES.470 5 2.2 EB, PC3, A549 337298 CH22 FGENES.678-3 2.2 NCI-H69, A549, HT29 302461 Hs.241381 cofactor required2.2 EB, CALU6, LnCap AF104253for Sp1 transcriptiona 334819 CH22_FGENES.436_15 2.19 CALU6, BT474, Caco2 300426 Hs.253296 ESTs 2.19 DU145, CALU6, HT29 302569 multiple UniGene matches2.19 RPWE-2, PRSC_log, AC004472 PRSC_con 339401 CH22_BA232E17.GENSCAN.7-72.19 NCI-H345, NCI-H69, PRSC_log 328791 CH.07 hs gi~5868309 2.19 DU145, PC3, HT29 337333 CH22_FGENES.711-3 2.19 NCI-H69, NCI-H345, PRSC_log 339363 CH22_BA354112.GENSCAN.33-62.19 NCI-H69, PRSC_log, PRSC_con 329429 CH.Y_hs gi~5868882 2.19 CALU6, HT29, OVCA-R

336927 CH22_FGENES.348-3 2.19 NCI-H69, PRSC_log, 336351 CH22_FGENES.816_3 2.19 DU145, EB, MB-MDA-231 313466 Hs.148876 ESTs 2.19 CALU6, DU145, OVCA-R

307433 EST singleton (not in 2.19 NCI-H23, NCI-H23, AI244895UniGene) with exon NCI-358 336590 CH22_FGENES.51 2 2.19 PRSC_con, NCI-H69, PRSC_log 310758 Hs.209445 ESTs 2.18 EB, MB-MDA-231, BT474 327823 CH.05 hs gi~5867968 2,18 PRSC_con, NCI-H69, 313257 EST cluster (not in 2.18 PRSC_log, RPWE-2, N92638 UniGene) PRSC_con 335377 CH22_FGENES.543_17 2.18 PC3, MB-MDA-435s, 303958 EST singleton (not in 2.18 NCI-H345, RPWE-2, AL042931UniGene) with exon PRSC_con 320153 Hs.120360 phospholipase2.18 LnCap, PC3, MB-MDA~35s AF064594A2; group VI

335201 CH22_FGENES.508 10 2.18 OVCA-R, DU145, HT29 338591 CH22_EM:AC005500.GENSCAN.434-02.18 NCI-H69, NCI-H345, 331958 Hs.99405 ESTs 2.18 MCF7, NCI-H23, NCI-H460 337218 CH22_FGENES.614-2 2.18 CALU6, A549, MCF7 309470 EST singleton (not in 2.18 PC3, EB, MB-MDA-435s AW118833UniGene) with exon 331896 Hs.97174 H sapiens mRNA; 2.18 RPWE-2, NCI-H69, AA435495cDNA DKFZp566E164 (from PRSC_log 330275 CH.05_p2 gi~6671904 2.18 NCI-H345, PRSC_log, PRSC_con 335817 CH22_FGENES.618 5 2.18 A549, Caco2, PC3 332896 CH22_FGENES.35_10 2.18 NCI-H345, RPWE-2, PRSC_log 303294 EST 2.17 MB-MDA-435s, A549, 338703 CH22_EM:AC005500.GENSCAN.480-22.17 HT29, BT474, NCI-H69 300115 Hs.208130 ESTs 2.17 PC3, OVCA-R, HT29 330979 Ns.31795 ESTs 2.17 MCF7, EB, MB-MDA-435s 317246 Hs.155690 ESTs 2.17 MB-MDA-453, DU145, 329078 CH.X_hsgi~5868597 2.17 MB-MDA~t53 MB-MDA-231,BT474 312554 Hs.109390 ESTs 2.17 NCI-H520, OVCA-R, 323207 Hs.192201 ESTs 2.17 NCI-H69, NCI-H345, A1052795 PRSC_log 301894 Hs.41997 alpha-1-B glycoprotein2.17 PRSC_con, LnCap, AA484435 PRSC log 329097 CH.X_hs gi~5868624 2.16 MB-MDA-231 MCF7, 328328 CH.07_hs gi~5868375 2.16 NCI-H345 PRSC con, 302671 Hs.135917 ESTs 2.16 BT474, DU145, A549 329201 CH.X_hs g1~5868718 2.16 OVCA-R, PC3, MB-MDA-435s 329902 CH.15~2 2.16 PRSC-con, NCl-H69, gi~6634760 NCI-H345 334435 CH22_FGENES.385 2.16 PRSC_can, NCI-H345, 330742 Hs.25691 2.16 MCF7, MB-MDA-453, AA400979calcitonin PC3 receptor-like receptor activi 328484 CH.07_hs 2.16 NCI-H69, PRSC_log, gi~5868454 NCI-H345 334784 CH22 FGENES.432 2.16 PRSC_log, RPWE-2, 9 PRSC_con 337771 CH22_EM:AC000097.GENSCAN.119-10 2.16 NCI-H69, PRSC-con, 300181 Hs.157568 2.16 DU145, EB, CALU6 AI284955ESTs; Weakly similar to ataxin-2 [M.musc 300268 Hs.245450 2.16 PRSC_con, RPWE-2, AI539446ESTs PRSC_log 309575 Hs.195188 A549, NCI-H23, MB-MDA-453 AW168096glyceraldehyde-3-phosphate dehydrogenase 2.16 336548 CH22_FGENES.841 2.16 NCI-H345, NCI-H69, 328506 CH.07 hs 2.16 EB, A549, CALU6 gi~5868471 330189 CH.05_p2 2.16 NCI-H460, MCF7, MB-MDA-453 gi~6165182 305480 Hs.25911 2.16 EB, DU145, NCI-358 AA746500HLA-B associated transcript-2 302270 EST 2.16 OVCA-R, MB-MDA~135s, 856151 PRSC con 306669 EST singleton 2.16 PRSC_log, PRSC_con, A1004899(not in NCI-H345 UniGene) with exon 325887 CH.16 hs 5867087 2.16 EB, CALU6, NCI-358 gi~

327015 CH.21_hs 5867664 2.15 EB, PC3, HT29 gi~

338576 CH22-EM:AC005500.GENSCAN.429-1 2.15 NCI-H69, NCI-H345, PRSC_con 333592 CH22_FGENES.209_2 2.15 NCI-H69, OVCA-R, PRSC_con 317253 Hs.199685 2.15 MB-MDA-435s, NCI-H23, AW071241ESTs MB-MDA-453 302301 Hs.127150 PC3, MCF7, MB-MDA~35s 867493 ESTs; Weakly similar to ZINC
FINGER
PROT 2.15 336858 CH22 FGENES.293-8 2.15 RPWE-2, PRSC-con, 308417 Hs.2186 2.15 EB, OVCA-R, CALU6 AI640693eukaryotic translation elongation factor 338177 CH22_EM:AC005500.GENSCAN.219-5 2.15 NCI-H345, NCI-H23, 337592 CH22-C20H12.GENSCAN.6-7 2.15 PC3, A549, HT29 325945 CH.16_hs 2.15 MB-MDA-453, MB-MDA-435s, gi~5867138 DU145 335262 CH22_FGENES.520_3 2.15 EB, PC3, A549 333665 CH22_FGENES.244 2.15 PRSC-con, RPWE-2, 1 PRSC-log 333710 CH22 FGENES.250 2.14 PRSC_log, NCI-H69, 25 PRSC_con 304927 Hs.195188 LnCap, PC3, MCF7 AA604728glyceraldehyde-3-phosphate dehydrogenase 2.14 336999 CH22_FGENES.417-20 2.14 NCI-H69, NCI-H345, PRSC_con 313283 Hs.157099 2.14 EB, MB-MDA-231, A549 W32480 ESTs 306221 EST singleton 2.14 NCI-H460, PRSC_con, AA928686(not in NCI-H23 UniGene) with exon 333205 CH22-FGENES.102_5 2.14 NCI-H69, PRSC_con, PRSC_log 312932 Hs.209614 2.14 PRSC_con, NCI-H345, AI804218ESTs RPWE-2 328938 CH.O8 hs ~5868500 2.14 HT29, PC3, MB-MDA-453 gi 326746 CH.20 hs ~5867611 2.14 NCI-H345, NCI-H69, gi PRSC_con 337964 CH22_EM:AC005500.GENSCAN.100-9 2.14 RPWE-2, PRSC_con, PRSC_log 337984 CH22_EM:AC005500.GENSCAN.110-2 2.14 EB, DU145, NCI-H345 337704 CH22_EM:AC000097.GENSCAN.87-6 2.14 NCI-H69, NCI-H460, 302162 EST 2.14 MB-MDA-035s, PC3, 303192 Hs.8059 V 2.14MB-MDA-435s, MB-MDA-435s, AA081755ESTs; Highly MB-MDA-453 similar to SYNAPTOTAGMIN
I

306200 EST singleton 2.14 MB-MDA-453, CALU6, AA926816(not in DU145 UniGene) with exon 303996 Hs.84298 2.14 LnCap, MB-MDA-231, AW515979CD74 antigen BT474 (invariant polypptd of majo 325409 CH.12-hs 2.14 PRSC_log, PRSC-con, gi~5866921 RPWE-2 308558 Hs.172182 2.14 MCF7, EB, MB-MDA-435s AI700145poly(A)-binding protein;
cyioplasmic 302185 Hs.156915 2.14 MB-MDA-053, MCF7, AA243837ESTs EB

303021 EST 2.14 PRSC_con, NCI-H69, 301005 Hs.210848 2.14 DU145, EB, HT29 AW451916ESTs 336029 CH22_FGENES.672 2.14 NCI-H69, PRSC_con, 305443 EST singleton 2.14 NCI-358, NCI-H520, AA736653(not in NCI-H23 UniGene) with exon 335485 CH22_FGENES.570 2.13 NCI-H460, MB-MDA-435s, 304817 EST singleton 2.13 MCF7, MCF7, NCI-H520 AA584712(not in UniGene) with exon 309859 EST singleton 2.13 NCI-H69, PRSC_con, AW298760(not in LnCap UniGene) with exon 326206 CH.17_hs 2.13 EB, MB-MDA-231, LnCap gi~5867219 303656 Hs.122574 2.13 LnCap, MB-MDA-435s, AA437189ESTs EB

334745 CH22_FGENES.426_3 2.13 OVCA-R, DU145, MB-MDA-453 318504 EST cluster 2.13 RPWE-2, LnCap, CALU6 T26453 (not in UniGene) 306839 EST singleton 2.13 MCFl, MB-MDA~t53, A1077385(not in MB-MDA-435s UniGene) with exon 303843 Hs.58094 2.13 MB-MDA~t35s, NCI-H345, W94322 melanoma RPWE-2 inhibitory activity 308444 Hs.197097 2.13 MB-MDA-453, MCF7, 301322 Hs.256305 2.13 NCI-H345, LnCap, PC3 AW448965ESTs 326997 CH.21 hs 2.13 HT29, A549, CALU6 gi~5867660 326793 CH.20_hs 2.13 PRSC_log, PRSC con, gi~5867631 MB-MDA-453 320360 EST cluster 2.12 MB-MDA-231, BT474, H12405 (not in HT29 UniGene) 316301 Hs.192009 2.12 DU145, DU145, EB
AW206279ESTs 335371 CH22_FGENES.543 2.12 PC3, MB-MDA-435s, 301178 EST 2.12 EB, OVCA-R, LnCap 326136 CH.17_hs 2.12 RPWE-2, PRSC_log, gi~5867202 PRSC can w 339213 CH22_FF113D11.GENSCAN.6-8 2.12 OVCA-R, PC3, MB-MDA-231 335980 CH22_FGENES.653_2 2.12 BT474, BT474, OVCA-R

314380 Hs.192807 2.11 PRSC con, PRSC_log, AA758797ESTs RPWE-2 306779 EST singleton 2.11 NCI-H345, PRSC_con, A1041302(not in PRSC_log .
UniGene) with exon 335774 CH22_FGENES.607 2.11 PC3 A549, MB-MDA-453 334914 CH22_FGENES.457 2.11 PRSC_con, NCI-H345, 3 . NCI-H69 304619 Hs.119598 2.11 EB, MB-MDA-453, MB-MDA-435s AA515554ribosomal protein 303358 Hs.158149 ESTs 2.11 CALU6, OVCA-R, 306558 EST singleton (not in 2.11 HT29, MB-MDA-453, AA994743UniGene) with exon CALU6 337781 CH22_EM:AC000097.GENSCAN.121-32.11 PRSC_log, PRSC_con, 333140 CH22_FGENES.84_1 2.11 HT29, NCI-H69, OVCA-R

315081 Hs.155281 ESTs 2.11 MB-MDA-453, MCF7, 302965 Hs.138842 ESTs 2.11 NCI-358, NCI-H23, 302138 EST 2.11 PRSC-log, PRSC_con, 320802 Hs.185055 BENE protein 2.11 A549, PC3, HT29 322152 EST cluster (not in UniGene)2.11 A549, CALU6, EB

326418 CH.19_hs gi~5867365 2.1 EB, OVCA-R, DU145 308709 Hs.181165 eukaryoticUanslation2.1 MB-MDA-435s, MB-MDA-453, AI783498elongation factor DU145 332737 Hs.84359 hypothetical 2.1 NCI-H23, A549, C01852 protein DU145 333283 CH22_FGENES.128_13 2.1 NCI-H345, RPWE-2, PRSC_con 328636 CH.07_hs gi~6004473 2.1 DU145, EB, MB-MDA-453 329187 CH.~hs gi~5868713 2.1 NCI-358, NCI-H23, 305999 EST singleton (not in 2.1 HT29, OVCA-R, PC3 AA889603UniGene) with exon 333220 CH22_FGENES.104_12 2.1 PRSC_con, PRSC_log, 335092 CH22_FGENES.492_2 2.1 NCI-H69, PRSC_con, 304887 EST singleton (not in 2.1 DU145, EB, MCF7 AA599355UniGene) with exon 325359 CH.12_hs gi~5866920 2.1 MB-MDA-453, EB, MB-MDA-435s 330956 Hs.6933 ESTs 2.1 NCI-H520, PRSC-con, 323786 Hs.165795 ESTs 2.1 OVCA-R, A549, LnCap 333619 CH22_FGENES.219 3 2.1 8T474, OVCA-R, 324538 EST cluster (not in UniGene)2.09 CALU6, A549, DU145 303405 EST 2.09 DU145, CALU6, NCI-H69 328570 CH.07_hs gi~5868231 2.09 LnCap, MB-MDA-231, 308971 Hs.224731 EST 2.09 NCI-H23, NCI-H460, 330467 Hs.22584 prodynorphin 2.09 PC3, BT474, MB-MDA~53 334793 CH22 FGENES.433 5 2.09 EB, DU145, LnCap 300908 Hs.146137 ESTs; Weakly 2.09 NCI-H345, PRSC-log, AA618335similarto putative [C.eleg PRSC_con 309656 Hs.195188 glyceraldehyde3-phosphate2.09 A549, NCI-H23, AW197060dehydrogenase NCI-H460 320963 Hs.209646 KIAA1118 protein2.09 PRSC con, PRSC_log, 310833 Hs.169136 ESTs 2.09 PC3, LnCap, MB-MDA-453 335693 CH22-FGENES.596_8 2.09 NCI-H69, LnCap, PRSC-log 325966 CH.16_hs gi~5867147 2.09 MCF7, CALU6, MB-MDA-453 329319 CH.~hs gi~6381976 2.09 NCI-H460, EB, DU145 338526 CH22_EM:AC005500.GENSCAN.396-142.09 NCI-H69, NCI-H345, PRSC_log 336751 CH22-FGENES.128-5 2.09 NCI-H69, NCI-H345, PRSC-log 325510 CH.12_,hs gi~5866974 2.09 HT29, OVCA-R, CALU6 323553 Hs.122854 ESTs 2.08 NCI-H345, RPWE-2, 326343 CH.17_hs gi~6525295 2.08 EB, LnCap, DU145 335470 CH22_FGENES.568 3 2.08 NCI-H69, PRSC_con, PRSC log 320122 Hs.187515 ESTs 2.08 MCF7, MB-MDA~53, 335320 CH22_FGENES.534 7 2.08 BT474, MB-MDA-231, 307120 EST singleton (not in 2.08 HT29, MCF7, PC3 A1184343UniGene) with exon 338080 CH22_EM:AC005500.GENSCAN.172-112.08 LnCap, PC3, HT29 313113 Hs.122523 ESTs 2.08 MCF7, DU145, MB-MDA-453 337685 CH22_EM:AC000097.GENSCAN.77-12.08 NCI-H69, NCI-H345, PRSC-log 327461 CH.02_hs gi~6004455 2.08 NCI-H23, BT474, 335895 CH22_FGENES.635-3 2.08 HT29, MB-MDA-231, 303933 EST singleton (not in 2.08 MB-MDA-231, BT474, AW471472UniGene) with exon NCI-H345 314803 Hs.166841 ESTs; Weakly AI935159similar to MYOSIN LIGHT
CHA

NON-MUSCLE ISOZYMES [H.sapiens]2.08 PC3, A549, BT474 302722 EST 2.08 DU145, MB-MDA-435s, 307703 EST singleton (not in 2.08 HT29, MB-MDA-435s, AI318588UniGene) with exon CALU6 310558 Hs.176976 ESTs 2.08 A549, LnCap, PC3 315276 EST cluster (not in UniGene)2.08 PC3, MCF7, OVCA-R

306443 EST singleton (not in 2.07 OVCA-R, PC3, EB
AA976950UniGene) with exon 307961 EST singleton (not in 2.07 HT29, OVCA-R, CALU6 AI421059UniGene) with exon 329735 CH.14~2 gi~6065780 2.07 EB, HT29, OVCA-R

335193 CH22_FGENES.507_8 2.07 EB, A549, A549 320347 Hs.221535 ESTs 2.07 CALU6, A549, EB

316153 Hs.147208 ESTs 2.07 MB-MDA-453, PC3, 300921 Hs.232165 ESTs 2.07 HT29, CALU6, CALU6 319264 EST cluster (not in UniGene)2.07 MB-MDA-053, MCF7, 330204 CH.05~2 gi~6013606 2.07 OVCA-R, DU145, EB

317070 Hs.125379 ESTs 2.07 PRSC_con, NCI-H345, 337645 CH22_EM:AC000097.GENSCAN.10-82.07 NCI-H345, PRSC_log, NCi-H69 312501 Hs.132886 ESTs 2.07 NCI-H520, CALU6, 335587 CH22_FGENES.581 26 2.07 NCI-H69, NCI-H345, PRSC_log 311482 Hs.129997 ESTs 2.07 NCI-H520, MCF7, AI917706 MB-MDA~35s 302488 EST 2.07 EB, DU145, CALU6 304692 Hs.76067 heat shock 27kD2.07 MCF7, MB-MDA-453, AA554202protein 1 PC3 325369 CH.12_hs gi~5866920 2.07 DU145, DU145, MB-MDA1153 306284 EST singleton (not in 2.07 BT474, MB-MDA-231, AA936835UniGene) with exon HT29 337402 CH22_FGENES.752-1 2.07 A549, BT474, DU145 327418 CH.02_hs gi~5867750 2.07 MCF7, MB-MDA-453, MB-MDA-435s 317977 Hs.205091 ESTs; Weakly 2.07 BT474, MB-MDA-453, A1004775similarto WW domain PC3 bindin 331870 Hs.161845 EST 2.07 MB-MDA-231, MB-MDA-035s, 300750 Hs.105464 ESTs 2.07 HT29, BT474, BT474 336657 CH22,FGENES.35-14 2.07 MB-MDA~153, MCF7, 336035 CH22_FGENES.678 6 2.07 NCI-H69, PRSC_con, 325320 CH.11 hs gi~5866870 2.06 NCI-H69, PRSC_log, PRSC_con 306053 EST singleton (not!n 2.06 HT29, OVCA-R, MB-MDA-231 AA905312UniGene) with exon 333175 CH22_FGENES.95_2 2.06 LnCap, HT29, DU145 304491 Hs.115502 EST 2.06 MB-MDA-435s, CALU6, 310632 Hs.176991 ESTs 2.06 NCI-H69, PRSC_log, 338521 CH22,EM:AC005500.GENSCAN.395-352.06 NCI-H345, PRSC_log, PRSC_log 334900 CH22_FGENES.452_14 2.06 A549, CALU6, NCI-H69 337451 CH22_FGENES.774-2 2.06 PRSC_con, PRSC_log, 308792 Hs.195188 glyceraldehyde-3-phosphate2.06 DU145, BT474, MB-MDA-453 AI815153dehydrogenase 336854 CH22_FGENES.280-1 2.06 LnCap, EB, MB-MDA-435s 304485 EST singleton (not in 2.06 MB-MDA-231, BT474, AA434076UniGene) with exon CALU6 326458 CH.19_hs gi~5867400 2.06 EB, DU145, LnCap 303506 Hs.105887 ESTs 2.06 LnCap, MCF7, CALU6 333628 CH22_FGENES.226 2 2.06 NCl-H520, NCI-358, 300763 EST 2.06 NCI-H69, NCI-H345, AA190753 PRSC_con 334836 CH22_FGENES.439 6 2.06 NCI-H345, PRSC_con, 335217 CH22_FGENES.512 3 2.06 PRSC_log, PRSC_con, 338970 CH22_DJ32110.GENSCAN.26-32.06 A549, MB-MDA-453, LnCap 334842 CH22_FGENES.439_21 2.06 DU145, HT29, CALU6 309309 Hs.232857 EST 2.06 EB, DU145, OVCA-R

332949 CH22_FGENES.47_12 2.06 EB, DU145, OVCA-R

310530 Hs.150150 ESTs 2.06 PRSC-con, PRSC_log, 329401 CH.X_hs gi~6682544 2.06 NCl-H69, PRSC_c0n, 316893 EST cluster (not in Un!Gene)2.06 OVCA-R, MCF7, MB-MDA~53 325022 Hs.59745 NADH dehydrogenase2.06 Caco2, NCI-358, W95840 (ubiqu!none) flavopro OVCA-R

329839 CH.14_p2 gi~6672062 2.05 MB-MDA-231, RPWE-2, 306668 EST singleton (not in 2.05 DU145, MB-MDA-453, A1004890UniGene) with exon MCF7 315604 Hs.136965 ESTs 2.05 LnCap, EB, PC3 318551 Hs.239307 tyrosyl-tRNA 2.05 NCI-H345, PRSC_con, AI909951synthetase RPWE-2 339344 CH22_BA354112.GENSCAN.28-12.05 BT474, MB-MDA-231, 310621 Hs.198099 ESTs 2.05 NCI-H69, RPWE-2, 327051 CH.21 hs gi~6531965 2.05 PRSC_con, NCI-N345, PRSC_log 336827 CH22_FGENES.236-2 2.05 NCI-H345, A549, 311846 Hs.177170 ESTs; Moderately2.05 OVCA-R, DU145, A1078033similar to !1!! ALU CALU6 SUB

335036 CH22_,FGENES.475_14 2.05 NCI-H69, PRSC_con, 313100 Hs.122817 ESTs 2.05 RPWE-2, NCI-H345, N52880 PRSC_log 301927 Hs.113250 reflnoschisis 2.05 MB-MDA-231, NCI-H345, AF014459(X-linked; juvenile) PRSC con 326070 CH.17_hs gi~5867175 2.05 MB-MDA-435s, MB-MDA-231, 336514 CH22_EM:AC005500.GENSCAN.392-42.05 PRSC_con, PRSC
log, RPWE-2 328098 CH.06_hs gi~5868020 2.05 DU145, CALU6, EB

301102 Hs.249487 ESTs 2.05 NCI-H460, PRSC_con, 306193 EST singleton (not in 2,05 NCI-H345, PRSC-con, AA923457UniGene) with exon RPWE-2 317027 Hs.174148 ESTs 2.05 EB, DU145, CALU6 336102 CH22_FGENES.693-2 2.04 LnCap, NCI-H69, PRSC_log 301372 Hs.130555 ESTs 2.04 PRSC_con, RPWE-2, AI239895 PRSC_log 333252 CH22_FGENES.116 4 2.04 NCI-358, A549, 322516 Hs.159717 ESTs 2.04 HT29, MB-MDA-231, 324148 EST cluster (not in UniGene)2.04 RPWE-2, PRSC-con, 338770 CH22_EM:AC005500.GENSCAN.520-12.04 PRSC_con, NCI-H69, 314795 Hs.157277 ESTs 2.04 EB, PC3, LnCap 333004 CH22_FGENES.60_1 2.04 A549, NCI-358, 302405 Hs.211914 NADH dehydrogenase NCI-H520, CALU6, AW245825(ubiquinone) Fe-S pro Caco2 2.04 323587 Hs.141901 ESTs; Moderately2.04 EB, A549, HT29 AI905527similar to !!!! ALU
SUB

300898 Hs.157176 ESTs 2.04 PC3, MB-MDA-453, 3(f1506 Hs.143519 ESTs; Weakly 2.04 NCI-H69, RPWE-2, AI149878similar to testicular NCI-H345 tekti 325851 CH.16_hs gi~5867067 2.04 MB-MDA-231, HT29, EB

323945 Hs.155117 ESTs 2.04 MCF7, DU145, DU145 303265 EST 2.04 LnCap, OVCA-R, 334135 CH22_FGENES.336_2 2.04 PC3, A549, MB-MDA-035s 329793 CH.14_p2 gi~6522661 2.04 DU145, CALU6, HT29 332595 Hs.3244 G protein pathway2.04 A549, CALU6, NCI-H23 AA256431suppressor 2 316059 Hs.250181 ESTs 2.04 MCF7, HT29, A549 AW166388 .

324104 Hs.133122 ESTs 2.04 Caco2, A549, MCF7 306801 EST singleton (not in 2.03 EB, LnCap, PC3 A1052653UniGene) with exon 338096 CH22_EM:AC005500.GENSCAN.181-142.03 DU145, HT29, CALU6 327544 CH.03_hs gi~5867797 2.03 PRSC-con, NCI-H69, 318813 EST cluster (not in UniGene)2.03 PRSC_con, RPWE-2, F13195 PRSC_log 325289 CH.11 hs gi~5866903 2.03 EB, OVCA-R, A549 311099 Hs.182167 hemoglobin; 2.03 HT29, BT474, EB
T56361 gamma A

316079 Hs.121735 ESTs 2.03 LnCap, OVCA-R, 309533 EST singleton (not in 2.03 MB-MDA-231, 8T474, AW151131 UniGene) with exon LnCap 338579 CH22_EM:AC005500.GENSCAN.431-32.03 NCI-H69, NCI-H345, 326549 CH.19_hs gi~5867307 2.03 NCI-H69, Caco2, 320012 Hs.193745 ESTs 2.03 BT474, MB-MDA-453, 334111 CH22_FGENES.330_10 2.03 NCI-H69, MB-MDA-231, 327123 CH.21 hs gi~6531971 2.03 NCI-H345, NCI-H69, 324568 EST cluster (not in 2.03 NCI-H345, NCI-H520, AW502311 UniGene) NCI-H460 306012 EST singleton (not in 2.03 NCI-H69, PRSC_log, AA896989 UniGene) with exon PRSC_con 303106 EST 2.03 RPWE-2, OVCA-R, 302194 Hs.158329 G protein-coupled2.03 NCI-H520, NCI-H23, U52219 receptor 50 PC3 326646 CH.20_hs gi~5867562 2.03 NCI-H460, OVCA-R, 304060 EST singleton (not in 2.03 NCI-H345, PRSC_con, T61464 UniGene) with exon PRSC_log 304667 EST singleton (not in 2.03 A549, DU145, EB
AA535602 UniGene) with exon 330514 Hs.53155 properdin P 2.02 NCI-H23, NCI-H460, M83652 factor, complement NCI-358 310324 Hs.159674 ESTs; Weakly NCI-H345, MB-MDA-231, AI473273 similarto GLUTAMATE BT474 [H.sap 2.02 330327 CH.08~2 gi~5919194 2.02 NCI-H345, NCI-H69, PRSC_log 308447 EST singleton (not in 2.02 NCI-H345, RPWE-2, AI659985 UniGene) with exon PRSC_log 307778 Hs.231496 EST 2.02 NCI-H69, CALU6, 319459 Hs.194121 ESTs 2.02 NCI-H460, NCI-358, 300935 Hs.222815 ESTs; Weakly 2.02 DU145, EB, OVCA-R
AA513644 similar to Wiskott-Aldrich 314318 Hs.176141 ESTs 2.02 PRSC_con, LnCap, AL037405 PRSC_log 334779 CH22 FGENES.432 1 2.02 EB, HT29, DU145 336994 CH22 FGENES.410-2 2.02 NCI-H345, PRSC_con, 334076 CH22_FGENES.327 31 2.02 OVCA-R, CALU6, EB

318116 Hs.132339 ESTs 2.02 MB-MDA-231, NCI-H69, 326783 CH.20_hs gi~6525298 2.02 NCI-H69, PRSC_con, 336142 CH22_FGENES.705 4 2.02 NCI-H69, PRSC_log, PRSC-con 320913 EST cluster (not in 2.02 DU145, EB, CALU6 AA663733 UniGene) 301644 EST 2.02 PRSC_con, RPWE-2, AW239364 PRSC_log 300944 Hs.164624 ESTs; Weakly 2.01 RPWE-2, NCI-H69, AW081072 similarto Slit-3 protein NCI-H23 [

310080 Hs.144857 ESTs 2.01 PRSC_con, NCI-H345, AW137088 PRSC-log 311248 Hs.195078 ESTs 2.01 NCI-H345, NCI-H69, 319207 EST cluster (not in 2.01 HT29, A549, NCI-H460 887679 UniGene) 334760 CH22_FGENES.428 9 2.01 NCI-358, NCI-H69, PRSC_log 338368 CH22_EM:AC005500.GENSCAN.325-22.01 NCI-H23, NCI-H520, 317300 Hs.166338 ESTs 2.01 NCI-H460, DU145, 323699 EST cluster (not in 2.01 MCF7, MB-MDA~t53, AW178750 UniGene) OVCA-R

301366 Hs.221667 ESTs 2.01 PRSC_con, NCI-H345, 333306 CH22_FGENES.137_3 2.01 NCI-H69, NCI-H345, PRSC_con 328031 CH.06 hs gi~5902482 2.01 MB-MDA-231, NCI-H345, PRSC-con 301806 Hs.12056 asialoglycoprotein2.01 MB-MDA-453, DU145, AA326007 receptor 1 EB

300993 Hs.191777 ESTs; Weakly 2.01 HT29, NCI-H23, AA584930 similarto RAPS-like NCI-358 prote o 320042 EST cluster (not in 2.01 PRSC_con, NCI-H345, T84520 UniGene) NCI-H69 331082 Hs.22100 ESTs 2.01 EB, DU145, MB-MDA~35s 308851 EST singleton (not in 2.01 DU145, EB, PC3 AI829820 UniGene) with exon 301163 EST 2.01 OVCA-R, PC3, MB-MDA-435s 304734 EST singleton (not in 2.01 LnCap, MB-MDA-453, AA576428 UniGene) with exon DU145 334855 CH22_FGENES.442 6 2.01 NCI-H345, RPWE-2, PRSC_log 337121 CH22_FGENES.519-1 2.01 NCI-H69, NCI-H345, PRSC_con 331838 Hs.104778 ESTs 2.01 BT474, BT474, MCF7 339181 CH22_DA59H18.GENSCAN.72-62.01 NCI-H345, PRSC_con, 327564 CH.03_hs gi~5867811 2.01 BT474, HT29, DU145 304108 Hs.28467 . EST 2 BT474, OVCA-R, 315036 Hs.163297 ESTs 2 MB-MDA-435s, MB-MDA-453, AA534953 LnCap 312777 Hs.138557 ESTs 2 PRSC_con, NCI-H345, 305888 Hs.126145 EST 2 HT29, HT29, BT474 AA868536 ' 323185 EST cluster (not in 2 EB, A549, BT474 852177 UniGene) 308681 EST singleton (not in 2 RPWE-2, PRSC con, AI761307 UniGene) with exon NCI-H345 325755 CH.14_hs gi~6682474 2 NCI-H345, PRSC
con, PRSC_log 324376 EST cluster (not in 2 DU145, BT474, PC3 AW499705 UniGene) 331890 Hs.3577 succinate dehydrogenase2 CALU6, MB-MDA-453, AA432166 complex; subunit A549 Table 4 Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex~ Accn UniG_ID Complete-Title Ratio MetIBS Top 3 expressing cell lines 313166 AI801098 Hs.151500 ESTs 12.23Caco2, E8, OVCA-R

334593 CH22_FGENES.408_3 8.06 NCI-H69, OVCA-R, OVCA-R

331084 820655 Hs.81281 Human 7.89 LnCap, OVCA-R, EB
clone 23732 mRNA; partial cds 324598 AA502659 Hs.163986 ESTs 7.77 OVCA-R, EB, CALU6 314071 AA192455 Hs.188690 ESTs 7.76 CALU6, EB, DU145 315178 AW362945 Hs.162459 ESTs 6.81 OVCA-R, EB, CALU6 325519 CH.12_hs gi~6017036 6.34 NCI-H69, NCI-H345, PRSC_con 331433 H68097 Hs.161023 EST 6.16 OVCA-R, A549, EB

315021 AA533447 EST cluster (not6.15 PC3, EB, CALU6 in UniGene) 337695 CH22_EM:AC000097.GENSCAN.84-15.84 NCI-H69, NCI-H345, 324048 AA378739 EST cluster (not5.77 OVCA-R, DU145, EB
!n Un!Gene) 300781 AA731209 EST cluster (not5.72 MB-MDA-453, MCF7, in UniGene) with exon h MB-MDA-435s 320701 A1093177 Hs.134923 ESTs 5.68 A549, NCI-H345, NCI-H69 332471 AA416967 Hs.120980 nuclear5.68 LnCap, A549, OVCA-R
receptor co-repressor 2 331858 AA421163 Hs.163848 ESTs 5.66 OVCA-R, DU145, Caco2 330987 H40988 Hs.131965 ESTs5.35NCI-H345, OVCA-R, LnCap 322309 AF086372 EST cluster (not5.31 OVCA-R, DU145, PC3 in Un!Gene) 324733 AA582082 Hs.199410 ESTs 5.17 PRSC-con, PRSC_log, 313577 AA565051 Hs.155029 ESTs 5.16 OVCA-R, PC3, EB

310966 AW271974 Hs.210295 ESTs 5.15 NCI-H69, PRSC_log, PRSC_con 311332 AW292247 Hs.255052 ESTs 5.05 Caco2, OVCA-R, EB

314522 AI732331 Hs.187750 ESTs; 5,04 EB, DU145, HT29 Moderately similar to !!!! ALU
CLA

330886 AA135606 Hs.189384 ESTs; 4.93 OVCA-R, DU145, Caco2 Weakly similar to !!!! ALU SUBFAMI

313597 AW162263 Hs.249990 ESTs 4.84 NCI-H460, NCI-H345, 314439 A1539443 Hs.137447 ESTs 4.84 DU145, Caco2, MB-MDA-231 320807 AA086110 Hs.188536 H sapiens4.83 PC3, OVCA-R, DU145 clone 24838 mRNA seq 311804 AA135159 Hs.203349 ESTs 4,82 OVCA-R, PC3, Caco2 321354 AA078493 EST cluster (not4.81 DU145, EB, OVCA-R
in UniGene) 325169 H01560 Hs.163818 ESTs; 4.8 NCI-H345, DU145, LnCap Weakly similarto !!!! ALU SUBFAMI

312828 AI865455 Hs.211818 ESTs; 4.78 DU145, DU145, DU145 Moderately similar to !!!! ALU
SUB

321226 AA311443 Hs,251416 H sap!ens 4.75 DU145, OVCA-R, mRNA; cDNA DKFZp586E2317 (from MB-MDA-453 327772 CH.05_hs gi~5867964 4.74 HT29, MB-MDA-231, 315642 AA742222 Hs.120634 ESTs 4.7 DU145, EB, MB-MDA~453 311905 AA555215 Hs.151913 ESTs 4.7 DU145, Caco2, PRSC-con 312754 899834 Hs.250383 ESTs 4.59 OVCA-R, PC3, EB

336637 CH22_FGENES.13-7 4.58 NCI-H69, PRSC_log, 331644 T99544 Hs.173734 ESTs; 4.55 OVCA-R, NCI-H345, Weakly similar to !!!! ALU CLASS Caco2 B

336984 CH22 FGENES.401-2 4.55 Caco2, Caco2, EB

316261 AW134485 Hs.144967 ESTs 4.53 NCI-H460, NCI-H345, Caco2 300417 AW139492 Hs.245887 ESTs 4.52 DU145, CALU6, EB

300610 N72596 Hs.99120 DEADIH 4.52 OVCA-R, PC3, EB
(Asp-G!u-Ala-AspIH!s) box polypep 324718 AI557019 Hs.116467 ESTs 4.5 LnCap, PC3, PRSC_con 332170 F04112 Hs.177178 ESTs 4.47 Caco2, DU145, DU145 324042 AA377589 EST cluster (not4.45 NCI-H345, PRSC_con, in UniGene) PRSC_log 331148 873816 Hs.17385 ESTs 4.44 CALU6, OVCA-R, EB

328981 CH.09_hs gi~5868527 4.43 HT29, BT474, NCI-H69 321920 N63915 EST cluster (not 4.34 Caco2, A549, A549 in UniGene) 320832 AA214584 EST cluster (not4.34 NCI-H23, CALU6, OVGA-R
in UniGene) .

321971 AI680459 Hs.201441 ESTs 4.33 DU145, HT29, CALU6 308572 AI7W882 EST singleton 4.33 MCF7, NCI-H345, OVCA-R
(not in UniGene) with exon 302459 AF169255 EST cluster (not4.28 MB-MDA-231, OVCA-R, in UniGene) with exon h LnCap 321847 T08401 EST cluster (not 4.25 MB-MDA-453, MB-MDA-435s, in UniGene) MB-MDA-231 337884 CH22_EM:AC005500.GENSCAN.54-24.23 HT29, NCI-H23, MB-MDA-435s 307494 AI269188 Hs.175656 EST 4.23 NCI-H23, NCI-H520, 314915 AA573072 Hs.187748 ESTs; 4.21 PC3, OVCA-R, Caco2 Weakly similar to !!!! ALU SUBFAMI

336638 CH22_FGENES.14-2 4.21 NCI-H69, NCI-H345, PRSC_log 319379 T91443 Hs.193963 ESTs 4.2 PC3, OVCA-R, LnCap 312332 833041 Hs.106200 ESTs 4.19 NCI-H69, OVCA-R, NCI-H460 331445 H89093 Hs.41215 ESTs 4.19 EB, HT29, DU145 315841 AW136397 Hs.247572 ESTs 4.19 Caco2, MB-MDA-453, LnCap 315712 AI950133 Hs.120882 ESTs; 4.18 LnCap, NCI-H345, OVCA-R
Moderately s!milar to !!!! ALU
SUB

319559 AA773876 Hs.251597 ESTs 4.15 NCI-H345, Caco2, DU145 300791 AL138455 Hs,256135 ESTs; 4.13 NCI-358, RPWE-2, NCI-H460 Moderately similar to lll! ALU
SUB

312129 EST cluster 4.12 OVCA-R, MCF7, A549 AW300867(not in UniGene) 321166 Hs.128783 4.11 OVCA-R, Caco2, AA411263ESTs PRSC con 313220 Hs.118241 4.1 OVCA-R, DU145, AI971981ESTs Caco2 314022 Hs.248678 4.1 OVCA-R, EB, PC3 AW452420ESTs 321359 EST cluster 4.1 DU145, OVCA-R, AW474412(not in PC3 UniGene) 328841 CH.07_hs 4.09 NCI-H69, PRSC log, g!~6381920 NC!-H345 337898 CH22_EM:AC005500.GENSCAN.56-5 4.09 NCI-H345, NCI-H69, OVCA-R

333245 CH22_FGENES.115_2 4.09 PRSC_log, PRSC_con, 311958 Hs.132965 4.06 EB, DU145, CALU6 AI247472ESTs 314775 Hs.188809 4.06 OVCA-R, PC3, EB
AI149880ESTs 317901 Hs.250541 4.06 BT474, MB-MDA-453, AW150944ESTs MB-MDA~435s 309985 EST singleton 4.05 MB-MDA~153, NCI-H23, AW452919(not in NCI-H520 UniGene) with exon 311004 EST cluster 4.05 MB-MDA-453, OVCA-R, AA632846(not in EB
UniGene) 323497 Hs,221544 4.04 LnCap, OVCA-R, AI523613ESTs EB

332347 Hs.221716 4.04 EB, CALU6, PC3 W60326 ESTs 331388 Hs.43543 4.01 A549, EB, Caco2 AA456852suppressor of white apricot homolog 313197 Hs.222487 3,96 OVCA-R, EB, PC3 AI738851ESTs 315710 Hs.192785 3.95 EB, MB-MDA-231, AA931550ESTs OVCA-R

316897 EST cluster 3.94 OVCA-R, A549, MB-MDA-453 AA838114(not in Un!Gene) 322564 Hs.118344 3.94 NCI-H460, Caco2, W86440 ESTs EB

304605 EST singleton 3.9 NCI-H345, RPWE-2, AA513225(not in BT474 UniGene) with exon 325726 CH.14_hs 6552447 3.9 OVCA-R, LnCap, gi~ LnCap 320190 Hs.141012 y s!milarto 3.89 DU145, NCI-H23, 832047 ESTs; Weakl!!!! ALU PRSC_log SUBFAMI

331566 Hs.48703 3.87 NCI-H23, NCI-H460, 319403 EST cluster 3.86 NCI-H345, PRSC
T98413 (not in log, LnCap Un!Gene) 324643 Hs.130729 3.84 OVCA-R, DU145, AI436356ESTs NCI-H345 315298 Hs.211377 3.82 NCI-H345, PRSC_con, AI969314ESTs PRSC_log 321632 EST cluster 3.81 EB, OVCA-R, A549 AA419617(not in UniGene) 313219 Hs.182099 3.8 EB, Caco2, OVCA-R
N74924 ESTs 330833 ESTs; Weakly 3.8 LnCap, DU145, PC3 AA046804similar to !!!!
ALU SUBFAMI

327289 CH.01 hs 3.79 EB, HT29, DU145 gi~5867481 314429 EST cluster 3.79 OVCA-R, PC3, PRSC_con AW300749(not in Un!Gene) 314475 Hs.127505 3.79 DU145, CALU6, NCI-H69 AI911160ESTs 317130 Hs.192277 3.78 EB, PC3, Caco2 AW293995ESTs 336635 CH22_FGENES.13-5 3.77 NCI-H69, NCI-H345, PRSC_log 333323 CH22_FGENES.138_16 3.76 NCI-H460, NCI-H23, PRSC_con 332135 Hs.245351 3.75 NCI-H345, A549, AA620331EST Caco2 316979 EST cluster 3.75 NCI-H345, NCI-H69, AA861087(not in RPWE-2 UniGene) 316435 Hs.192618 3.74 MB-MDA-435s, MCF7, AI671871ESTs; Weakly MB-MDA-453 similar to Ill!
ALU CLASS
C

315422 Hs.192374 3.73 OVCA-R, A549, EB
AW135357ESTs 336616 CH22_FGENES.613_5 3.72 NCI-H69, NCI-H345, 320258 EST cluster 3.71 MB-MDA-231, NCI-H69, W93241 (not in EB
Un!Gene) 300463 Hs.186470 3.69 OVCA-R,A549, DU145 N52510 ESTs 306881 EST singleton 3.68 CALU6, HT29, EB
A1088695(not in UniGene) with exon 337304 CH22_FGENES.681-6 3.67 MCF7, MB-MDA-453, LnCap 323693 Hs.249721 3.67 OVCA-R, MB-MDA-453, AW297758ESTs DU145 331073 Hs.18628 3.67 RPWE-2, NCI-H345, 807998 ESTs; Weakly OVCA-R
similarto !1!! ALU
SUBFAMI

318162 Hs.132171 3.67 MB-MDA-231, DU145, AW296277ESTs CALU6 318042 Hs.149991 3.66 EB, HT29, CALU6 AW294522ESTs 308069 EST singleton 3.64 Caco2, Caco2, NCI-H23 AI470895(not in UniGene) with exon 327614 CH.04_hs 3.62 NCI-H460, NCI-H345, gi~6525283 NCI-H69 337514 CH22rFGENES.809-7 3.62 NCI-358, NCI-H23, 332093 Hs.112592 3.6 EB, OVCA-R, DU145 AA608794ESTs 327793 CH.05_hs 3.59 LnCap, OVCA-R, gi~5867979 EB

331053 Hs.183146 3.59 OVCA-R, EB, Caco2 N70242 ESTs 303769 Hs.173415 3.58 HT29, CALU6, CALU6 AA134888ESTs 319872 Hs.189699 3.58 PRSC_con, LnCap, 897130 ESTs RPWE-2 317902 Hs,211265 3.57 CALU6, NCI-H345, AI828602ESTs OVCA-R

324090 Hs.116070 3.57 PRSC-con, NCI-H345, AI656531ESTs PRSC log 300120 Hs.170784 3.57 NCI-H69, NCI-H345, AW204314ESTs PRSC_con 307752 EST singleton 3.56 NCI-358, HT29, AI339447(not in MB-MDA-231 UniGene) with exon 322438 Hs.167851 3.55 NCI-H345, NCI-H69, W44531 ESTs Caco2 311275 Hs,207144 3.55 MB-MDA-231, PRSC_con, AI659166ESTs LnCap 338830 CH22_DJ246D7.GENSCAN.6-7 3.54 LnCap, PC3, OVCA-R

315647 Hs.212911 3.53 OVCA-R, MB-MDA~53, AA648983ESTs CALU6 331469 Hs.39140 3.52 EB, A549, CALU6 N22273 ESTs 313445 Hs.127264 3.51 EB, OVCA-R, A549 AI123657ESTs 330139 CH.21_p2 3.5 EB, CALU6, DU145 gi~4210430 304450 Hs.10326 3.49 NCI-H345, NCI-H69, AA404521coatomer NCI-H460 protein complex;
subunit epsilo 325763 CH.14_hs 3.49 PC3, BT474, OVCA-R
gi~6682475 312803 Hs.117864 3.47 OVCA-R, Caco2, AA677934ESTs MB-MDA-453 303654 Hs.168308 3.46 DU145, NCI-H460, AA436942ESTs NCI-H69 317924 Hs.166306 3.46 PRSC_con, PRSC_log, AI222324ESTs; Weakly NCI-H69 similar to zinc finger prot 312354 Hs.167040 3.44 Caco2, MB-MDA-435s, AA036955ESTs NCI-H460 337517 CH22_FGENES.814-6 3.43 NCI-H69, HT29, 324865 Hs.114103 3.42 NCI-H23, NCI-H460, AA702138ESTs ' NCI-H520 323755 EST cluster (not in UniGene)3.42 PRSC_con, RPWE-2, 314452 Hs.209222 ESTs 3.42 NCI-H345, PRSC_con, AL042699 PRSC_log 337911 CH22_EM:AC005500.GENSCAN.59-63.42 OVCA-R, PC3, HT29 318086 Hs.132238 ESTs 3.41 CALU6, LnCap, OVCA-R

311859 Hs.181044 ESTs; Weakly AA704705similar to Chain A;
Human 0 Complexed With L-Canaline3.41 LnCap, MB-MDA-435s, [H,sapiens] A549 314409 Hs.131833 ESTs 3.41 NCI-H69, LnCap, H15560 LnCap 323333 EST cluster (not in UniGene)3.41 Caco2, OVCA-R, NCI-H69 325690 CH.14_hs gi~5867021 3.4 HT29, CALU6, DU145 314539 Hs.190092 ESTs 3.4 MB-MDA-231, BT474, 310567 Hs.155780 ESTs 3.4 PRSC_con, NCI-H345, 330527 transcript ch21=oligomycin S77356 sensitivity c 8 stomach cancer cell 3.39 NCI-H23, Caco2, lines, mRNA, 262 n A549 314660 Hs.188780 ESTs 3.39 OVCA-R, BT474, Caco2 321321 EST cluster (not in UniGene)3.39 NCI-358, EB, Caco2 323356 Hs.188715 ESTs 3.38 DU145, CALU6, CALU6 328592 CH.O7 hs gi~5868227 3.38 MCF7, NCI-358, MB-MDA-231 311116 Hs.232193 ESTs 3.36 NCI-H520, NCI-H23, AI631195 PRSClog 323853 EST cluster (not in UniGene)3.36 DU145, EB, Caco2 327740 CH.05_hs gi~5867943 3.35 EB, LnCap, OVCA-R

326857 CH.20_hs gi~6552460 3.33 NCI-H69, MCF7, NCI-H345 317787 Hs.249364 ESTs 3.31 NCI-H345, PRSC_con, AW339612 PRSC_log 325760 CH.14 hs gi~6552449 3.3 EB, CALU6, HT29 337513 CH22 FGENES.809-4 3.29 LnCap, NCI-H23, 336606 CH22_FGENES.429 3 3.29 NCI-H69, A549, NCI-H23 322895 Hs.192152 ESTs 3.29 DU145, Caco2, EB

314312 Hs.257634 ESTs 3.29 RPWE-2, NCI-H69, 328224 CH.O6_hs gi~5868101 3.28 DU145, NCI-H345, LnCap 336128 CH22_FGENES.701 16 3.27 BT474, NCI-H520, 332442 Hs.4947 ESTs 3.27 Caco2, PC3, NCI-H345 302514 EST cluster (not in UniGene)3.27 DU145, CALU6, NCI-H520 M14269 with exon h 313749 Hs.130803 ESTs 3.26 OVCA-R, NCI-H69, 302891 Hs.114164 ESTs 3.26 LnCap, NCI-H345, AI681578 PRSC-log 334690 CH22_FGENES.420_3 3.25 NCI-H69, RPWE-2, PRSC_con 308676 EST singleton (not in 3.25 DU145, MB-MDA-231, AI761036UniGene) with exon HT29 304254 Hs.111334 femtin; light 3.24 OVCA-R, DU145, A549 AA046273polypeptide 311994 Hs.13849 ESTs 3.24 NCI-H460, NCI-H23, 321020 Hs.227850 KIAA0953 protein3.24 EB, MCF7, MB-MDA-435s 316724 Hs.123337 ESTs 3.23 DU145, OVCA-R, BT474 326942 CH.21 hs gi~6004446 3.22 HT29, BT474, NCI-H23 324824 Hs.224624 ESTs 3.21 OVCA-R, MB-MDA~453, 320789 EST cluster (not in UniGene)3.21 DU145, LnCap, EB

315070 Hs.186736 ESTs 3.21 Caco2, NCI-358, 303794 Hs.197025 ESTs 3.19 OVCA-R, PC3, LnCap 310237 Hs.158906 ESTs 3.19 NCI-358, NCI-H345, 313960 EST cluster (not in UniGene)3.18 MB-MDA-231, HT29, 336634 CH22_FGENES.13-4 3.18 NCI-H69, NCI-H345, 301085 Hs.190428 ESTs; Weakly 3.17 NCI-H345, NCI-H345, AA779058similar to NG26 [H.sapiens] NCI-358 313774 Hs.144583 ESTs 3.17 Caco2, EB, OVCA-R

307177 EST singleton (not in 3.17 EB, CALU6, CALU6 AI188864UniGene) with exon 324025 Hs.190623 ESTs 3.17 OVCA-R, DU145, PC3 313099 Hs.128064 ESTs 3.17 MB-MDA-231, BT474, 305536 EST singleton (not in 3.17 NCI-358, Caco2, AA770682UniGene) with exon HT29 331916 Hs.124918 ESTs 3.17 EB, OVCA-R, Caco2 314912 Hs.161784 ESTs 3.17 EB, BT474, MCF7 303388 EST cluster (not in UniGene)3.17 HT29, NCI-358, Caco2 AL039604with exon h 332273 Hs.173830 ESTs 3.16 MCF7, DU145, EB

314697 Hs.243770 ESTs 3.16 MB-MDA-453, DU145, 335344 CH22_FGENES.536-3 3.15 PRSC_log, NCI-H345, PRSC_con 326162 CH.17_hs gi~5867168 3.15 BT474, HT29, HT29 304467 EST singleton (not in 3.15 NCI-H23, RPWE-2, AA424703UniGene) with exon NCI-H460 339340 CH22_BA354112,GENSCAN.27-83.15 LnCap, OVCA-R, MB-MDA-453 325393 CH.12_hs gi~5866921 3.13 Caco2, NCI-H23, 315367 Hs.169399 ESTs 3.13 OVCA-R, EB, MB-MDA-453 307085 EST singleton (not in 3.12 RPWE-2, PRSC con, AI160868UniGene) with exon PRSC_log 313001 Hs.249591 ESTs; Moderately3.12 NCI-H345, OVCA-R, N29264 similar to !!!I ALU Caco2 SUB

307606 EST singleton (not in 3.12 MB-MDA-231, HT29, AI290006UniGene) with exon NCI-H23 325710 CH.14_hs gi~6682473 3.09 NCI-H69, MB-MDA~53, 313810 Hs.257854 ESTs 3.09 EB, DU145, CALU6 335482 CH22_FGENES.570 11 3.09 NCI-H460, NCI-358, 326310 CH.17 hs gi~5867277 3.08 MCF7, MB-MDA-453, 325742 CH.14_hs gi~6552448 3.08 NCI-H23, NCI-H460, 312467 Hs.75458 ribosomal protein3.08 NCI-358, NCI-H23, 327309 CH.01 hs gi~6456757 3.07 NCI-H69, MB-MDA-435s, MB-MDA-435s 310583 Hs.211198 ESTs 3.07 OVCA-R, A549, Caco2 322373 Hs.130829 ESTs 3.07 NCI-H69, PRSC_con, 324497 3.06 NCI-H345, RPWE-2, AW152624 PRSC_con Hs.136340 ESTs 315095 Hs.243788 ESTs 3.06 Caco2, DU145, 302445 EST cluster (not in UniGene)3.05 OVCA-R, A549, N79647 with exon h NCI-H460 302842 Hs.163834 ESTs; Highly 3.05 A549, DU145, NCI-H23 AW383226similarto Chp [R.norvegicu 317346 Hs.221274 ESTs 3.04 BT474, HT29, HT29 334650 CH22_FGENES.417_17 3.04 MCF7, BT474, OVCA-R

306644 EST singleton (not in 3.04 CALU6, MCF7, BT474 A1002913UniGene) with exan 322682 EST cluster (not in UniGene)3.03 NCI-H345, RPWE-2, 311065 Hs.224906 ESTs 3.03 PRSC_log, PRSC_con, 318623 Hs.151547 ESTs 3.03 DU145, MB-MDA-435s, 304978 EST singleton (not in 3.03 CALU6, BT474, AA617735UniGene) with exon MB-MDA-435s 305554 Hs.121774 EST 3.03 EB, NCI-H460, AA774567 Caco2 302574 Hs.249165 fibroblast 3.03 HT29, DU145, PC3 U66199 growth factor 11 336202 CH22 FGENES.719_6 3,02 NCI-H69, NCI-H23, 302893 Hs.173515 H Sapiens mRNA; 3.02 EB, DU145, AL117539cDNA DKFZp586H021 (from CALU6 315166 Hs.158528 ESTs 3.01 Caco2, EB, NCI-H69 335606 CH22 FGENES.582_3 3.01 NCI-H23, NCI-H520, 330058 CH.17_p2 gi~6634847 3.01 OVCA-R, HT29, LnCap 303179 EST cluster (not in UniGene)3,01 MCF7, RPWE-2, AA071215with exon h MB-MDA~153 307625 EST singleton (not in 3 MB-MDA-231, LnCap, AI299617UniGene) with exon BT474 323074 Hs.203213 ESTs 3 NCI-H23, NCI-H520, 336232 CH22_FGENES.736 7 3 HT29, BT474, MB-MDA-231 334915 CH22_FGENES.457 4 3 NCI-H345, PRSC_con, 329116 CH.X_hs gi~5868650 3 NCI-H69, PRSC_con, 333495 CH22_FGENES.168_5 3 OVCA-R, NCI-H69, 303756 Hs.115838 ESTs 2.99 HT29, PRSC_con, 332134 Hs.139240 DKFZP564F1422 2.99 EB, A549, MCF7 AA610123protein 322916 Hs.154091 ESTs 2.99 DU145, DU145, 318050 Hs.133132 ESTs 2.99 NCI-H345, DU145, 301019 Hs.98722 ESTs 2.99 NCI-358, NCI-H69, AI147356 MB-MDA-435s 315213 Hs.136494 ESTs 2.98 MB-MDA-231, BT474, AA587773 LnCap 339251 CH22 BA354112.GENSCAN.7-52.98 NCI-H69, PRSC_log, 303835 EST cluster (not in UniGene)2.97 BT474, NCI-H345, T05645 with exon h LnCap 300070 Hs.256832 ESTs 2.97 DU145, A549, ~VCA-R

320954 Hs.204121 KIAA1030 protein2.97 LnCap, DU145, 327624 CH.04_hs gi~5867871 2.97 EB, DU145, LnCap 329029 CH.X_hs gi~6525302 2.96 NCI-H69, PRSC_log, LnCap 317040 Hs.126154 ESTs 2.96 DU145, EB, LnCap 328016 CH.06 hs gi~5902482 2.96 NCI-H345, PRSC_con, 312674 Hs.151327 ESTs; Moderately2,96 OVCA-R, NCI-H69, AI762475similar to !1!! ALU NCI-H69 SUB

332301 Hs.127826 ESTs 2.96 OVCA-R, DU145, 300951 Hs.105834 ESTs; Weakly 2.95 NCI-358, NCI-H460, AI732374similar to 25 kDa trypsin Caco2 i 318226 Hs.134125 ESTs 2.95 NCI-H460, NCI-H23, 311349 Hs.254110 ESTs 2.94 EB, DU145, OVCA-R

312757 Hs.183817 ESTs 2.94 DU145, LnCap, AI285970 LnCap 316507 Hs.158381 ESTs 2.94 PRSC_con, PRSC_log, 302278 Hs.173730 Mediterranean 2.93 EB, NCI-H69, DU145 AF018080fever 311016 Hs.243468 ESTs 2.93 NCI-H345, LnCap, AW173166 LnCap 323864 Hs.214028 ESTs 2.92 EB, Caco2, HT29 336632 CH22_FGENES.13-2 2,92 NCI-H69, NCI-H345, 328886 CH.07_hs gi~6588003 2.92 HT29, PC3, LnCap 301859 EST cluster (not in UniGene)2.92 LnCap, EB, EB
T61587 with exon h 323775 Hs.143022 ESTs 2.92 PRSC con, PRSC_log, 315426 Hs.128171 ESTs 2.92 CALU6, EB, A549 322264 EST cluster (not in UniGene)2.92 Caco2, OVCA-R, 315135 Hs.192446 ESTs 2.91 EB, HT29, DU145 327982 CH.06_hs gi~5868216 2.91 LnCap, MB-MDA-453, 314530 Hs.131741 ESTs 2.91 NCI-H460, NCI-H520, 315003 Hs.156037 ESTs 2.9 PRSC_con, RPWE-2, 339032 CH22_DA59H18.GENSCAN.25-12.9 NCI-H69, PRSC_con, 308379 Hs.2186 eukaryotic translation2.89 BT474, MB-MDA-231, AI623950elongation factor HT29 312133 Hs.221665 ESTs 2.88 Caco2, MB-MDA-453, 307992 EST singleton (not in 2.88 NCI-H520, MCF7, AI434166UniGene) with exon NCI-H23 308010 Hs.181165 eukaryotic 2.88 Caco2, NCI-H69, AI439190translation elongation NCI-H345 factor 320154 Hs.119559 ESTs 2.88 MB-MDA-053, DU145, 331496 Hs.171984 ESTs 2.86 MB-MDA-453, PC3, 320016 Hs.194574 ESTs 2.86 PRSC_con, RPWE-2, H57622 PRSC_log 317923 Hs.220751 ESTs 2,86 NCI-H345, PRSC
AW450544 con, PRSC_log 301822 Hs.1142 integdn; alpha 2.86 PC3, BT474, CALU6 X17033 2 (CD49B; alpha 2 subuni 311759 Hs.169536 Rhesus blood 2.85 DU145, HT29, MB-MDA-231 AA705075group-associated glycoprote 315083 Hs.210655 ESTs 2.84 PRSC_con, RPWE-2, 317759 Hs.202460 ESTs; Weakly 2.83 HT29, MB-MDA-231, AI908455similar to hypothetical BT474 313980 Hs.159914 ESTs 2.83 Caco2, MB-MDA-053, 310941 Hs.173705 ESTs; Weakly 2.83 NCI-H345, MCF7, AI453402similar to 1l8 ALU CLASS Caco2 C

313593 Hs.213724 ESTs 2.83 LnCap, Caco2, 314973 Hs.254669 EST 2.82 BT474, LnCap, 310950 Hs.170561 2.82 EB, MB-MDA-453, AI582758ESTs LnCap 323626 Hs.207604 2.82 PC3, HT29, CALU6 AL039822ESTs 325410 CH.12_hs 2.81 MB-MDA~t53, PRSC_con, gi~5866921 NCI-358 313911 Hs.116385 2.81 PRSC_con, EB, RPWE-2 AI565458ESTs 334244 CH22_FGENES.365 2.81 OVCA-R, PC3, MB-MDA-453 309333 EST singleton 2.81 NCI-H460, NCI-H23, AW025709(not in NCI-358 UniGene) with exon 328467 CH.07 hs 5868434 2.81 EB, OVCA-R, HT29 g!~

318563 EST clusternot in UniGene)2.81 BT474, NCI-H23, AW250501( MB-MDA-231 326412 CH.19_hs 5867362 2.81 BT474, PRSC_log, gi~ RPWE-2 303407 EST clusternot in UniGene)2.8 CALU6, NCI-H345, AA309616( with exon DU145 h 328462 CH.07_hs 5868433 2.8 BT474, CALU6, MCFl gi~

335157 CH22_FGEN ES.501 7 2.8 NCI-H69, NCI-H345, PRSC_log 313458 Hs.255853 2.79 OVCA-R, DU145, AA007259ESTs LnCap 310416 Hs.202395 2.79 DU145, MB-MDA-435s, AI695047ESTs PC3 317709 Hs.128056 2.79 NCI-H460, NCI-358, AI435973ESTs DU145 321415 Hs.3337 2.79 A549, PC3, OVCA-R
AI377596transmembrane 4 superfami!y member 313693 Hs.170651 2.79 OVCA-R, MCF7, EB
AW469180ESTs 309438 Hs.225787 2.79 PC3, OVCA-R, DU145 AW102802ESTs; Moderately similarto hypothetical 308961 EST singleton 2.78 BT474, MB-MDA-231, AI870248(not in EB
UniGene) with exon 329107 CH.X_hs 2.78 DU145, MCF7, MB-MDA-435s gi~5868626 313975 Hs.65114 2.78 Caco2, EB, DU145 AW025024keratin 330901 Hs.238380 PC3, NCI-H520, AA157818Human endogenous BT474 retrov!ral protease mRN 2.78 311749 Hs.13911 2.78 OVCA-R, MB-MDA-453, 806249 ESTs MCF7 329853 CH.14_p2 2.78 BT474, BT474, HT29 gi~6682295 322340 EST cluster 2.77 NCI-H345, Caco2, AF088076(not in LnCap UniGene) 326806 CH.20_hs 2.77 NCI-H69, NCI-H345, gi~6469835 MB-MDA-231 314661 EST cluster 2.77 NCI-H460, MB-MDA-435s, AA436432(not in CALU6 UniGene) 322135 EST cluster 2.77 NCI-358, NCI-H460, AF075082(not in Caco2 UniGene) 331849 Hs.193767 2.77 DU145, EB, CALU6 AA417078ESTs 301056 Hs.208076 NCI-H69, RPWE-2, AI797955ESTs; Weakly PRSC_con similar to D(4) DOPAMINE
RE 2.76 327739 CH.05 hs 2.76 EB, PC3, LnCap gi~5867942 308016 EST singleton 2.76 LnCap, HT29, MB-MDA-231 AI445116(not in UniGene) with exon 331549 Hs.237507 2.76 MB-MDA-453, MCF7, 331851 Hs.98303 2.75 MB-MDA-231, NCI-H345, AA418599caveolin BT474 315023 Hs.185844 2.75 PRSC_con, OVCA-R, AA533505ESTs EB

335565 CH22_FGENES.579 2.75 OVCA-R, EB, A549 306137 EST singleton 2.74 EB, LnCap, DU145 AA916176(not in UniGene) with exon 332240 yv31d2.s1 N54803 Soares fetal liverspleen 3' similar 2.74 DU145, EB, CALU6 to contains Ll.t3 L1 repetit 313246 Hs.159454 2.74 NCI-H69, NCI-H345, N90762 ESTs PRSC_log 303642 EST cluster 2.74 EB, A549, Caco2 AW299459(not in UniGene) with exon h 325513 CH.12_hs 2.74 MB-MDA-231, NCI-H345, gi~6017035 BT474 337236 CH22_FGENES.639-2 2.74 MCF7, MB-MDA-453, 311555 Hs.244807 2.74 BT474, NCI-H345, AW407892ESTs NCI-H69 339266 CH22_BA354112.GENSCAN.10-4 2.73 CALU6, DU145, OVCA-R

300127 Hs.235224 2.73 NCI-H345, RPWE-2, AW028615ESTs; Weakly PRSC_log similarto [H.sapi 311741 Hs.193642 2.72 LnCap, PC3, OVCA-R
800099 ESTs 310915 Hs,201893 2.72 DU145, EB, MB-MDA-435s AW449673ESTs 324982 Hs.98518 2.71 PRSC_con, PRSC_log, T31689 ESTs RPWE-2 305030 EST singleton 2.71 DU145, DU145, NCI-358 AA629988(not in Un!Gene) with exon 315396 Hs.152686 2.69 OVCA-R, Caco2, AW296107ESTs EB

319098 EST cluster 2.69 RPWE-2, LnCap, AI908374(not in PC3 UniGene) 309119 Hs.228499 2.69 LnCap, NCI-H23, AI927384EST; Moderately NCI-358 similar to PK-120 precur 312095 Hs.233482 2.68 Caco2, OVCA-R, AW444937ESTs HT29 324316 EST cluster 2.68 NCI-H460, Caco2, AI291330(not in PRSC_log UniGene) 331367 Hs.41641 2.68 MB-MDA~135s, NCI-H520, AA425688ESTs; Weakly NCI-H460 similar to CAGH4 [H.sapiens 339116 CH22_DA59H18.GENSCAN.49-4 2.68 DU145, EB, CALU6 324297 Hs.168587 2.68 PRSC_con, OVCA-R, AI565566ESTs PRSC_log 318728 EST cluster 2.68 LnCap, Caco2, PC3 230201 (not in UniGene) 304813 EST singleton 2.68 BT474, OVCA-R, AA584540(not in RPWE-2 UniGene) with exon 312393 Hs.191659 2.68 NCI-H345, PRSC_con, N34376 ESTs; Weakly EB
similar to !1!!
ALU CLASS
E

330671 Hs.92236 2.67 NCI-358, OVCA-R, A8002302KIAA0304 Caco2 gene product 305406 EST singleton 2.66 OVCA-R, EB, MCF7 AA723860(not in UniGene) with exon 330957 Hs.13352.1 2.66 EB, PC3, OVCA-R
H08778 ESTs 300350 Hs.172597 2.66 NCI-H23, NCI-H520, AI871129ESTs; Weakly NCI-H460 similarto zinc finger prot 322302 EST cluster 2.66 DU145, OVCA-R, W76021 (not in PC3 UniGene) 321891 Hs.165954 2.66 EB, OVCA-R, Caco2 AW157424ESTs 300124 Hs.242447 2.65 PRSC_con, A549, AI217394ESTs HT29 302747 EST cluster 2.65 NCI-H23, BT474, AF062275(not in MCF7 UniGene) with exon h 308741 Hs.209002 2.65 PC3, EB, OVCA-R
AI802780ESTs; Weakly similar to !!!!
ALU SUBFAMI

310802 Hs.159732 2.65 PRSC_con, PRSC_log, AI631546ESTs NCI-H69 300694 EST cluster 2.65 BT474, EB, MCF7 AA063406(not in UniGene) with exon h 311395 EST cluster 2.64 EB, OVCA-R, DU145 823313 (not in UniGene) 336538 CH22_FGENES.840 2.64 DU145, NCI-H460, 316473 EST cluster 2.64 LnCap, OVCA-R, AA829961(not in EB
UniGene) 328134 CH.06_hs 2.64 LnCap, EB, CALU6 gi~5868039 329330 CH.~hs 2.64 EB, CALU6, DU145 gi~5868806 316664 EST cluster 2.64 NCI-H345, MB-MDA-231, A1042101(not in PRSC_log Un!Gene) 328015 CH.06_hs 2.63 BT474, HT29, MB-MDA-231 gi~5902482 308991 EST singleton 2.63 BT474, EB, NCI-H23 AI879831(not in UniGene) with exon 323899 EST cluster 2.62 DU145, A549, CALU6 AL042966(not in UniGene) 321708 EST cluster 2.62 EB, A549, CALU6 AA476817(not in UniGene) 301752 EST cluster 2.62 HT29, BT474, NCI-H345 T75247 (not in UniGene) with exon h 309351 EST singleton 2.62 NCI-H23, PRSC_con, AW057547(not !n LnCap UniGene) with exon 314412 Hs.155654 2.62 CALU6, MB-MDA-231, AI864270ESTs BT474 309441 Hs.244230 2.62 BT474, MB-MDA-231, 335993 CH22_FGENES.656 2.61 NCI-H460, NCI-358, 318196 Hs.133397 2.6 EB, CALU6, HT29 A1056776ESTs 322880 Hs.50848 2.6 DU145, A549, PC3 AA310521ESTs;
Weakly similar to KIAA0862 protein 300558 Hs.122638 2.6 OVCA-R, NCI-H69, AI540051ESTs MCF7 318594 Hs.224581 2.6 PC3, MB-MDA-453, AA918320ESTs DU145 308554 Hs.201923 2.6 LnCap, EB, NCI-H345 335108 CH22_FGENES.494_14 2.6 NCI-H69, NCI-H345, 312483 Hs.184636 2.59 PC3, DU145, OVCA-R
AI417526ESTs 311981 Hs.257612 2.59 NCI-H460, MB-MDA-453, 319359 EST cluster 2.59 LnCap, NCI-H460, F13458 (not in MB-MDA-231 UniGene) 300230 Hs.158846 2.59 HT29, NCI-358, NCI-H345 AI377746ESTs 316504 Hs.132458 2.59 DU145, EB, CALU6 AW135854ESTs 322337 EST cluster 2.59 NCI-H69, NCI-H345, AA249804(not in NCI-H345 UniGene) 301775 EST cluster 2.59 NCI-H345, RPWE-2, AW247670(not in PRSC_log UniGene) with exon h 301089 Hs.220727 2.58 PRSC_log, PRSC_con, AA666396ESTs RPWE-2 331213 Hs.163862 2.58 DU145, EB, OVCA-R
T88698 ESTs 321121 EST cluster 2.58 NCI-H69, MB-MDA-435s, W23285 (not !n PC3 UniGene) 316634 Hs.122254 2.58 MCF7, HT29, BT474 AW241910ESTs 322141 EST cluster 2.58 PC3, OVCA-R, HT29 AF075092(not in Un!Gene) 312108 Hs.127453 2.58 A549, CALU6, Caco2 T82331 ESTs 339071 CH22_DA59H18.GENSCAN.34-1 2.58 CALU6, DU145, EB

311666 Hs.223747 2.57 OVCA-R, MB-MDA-231, AW389509ESTs BT474 318662 Hs.115367 2.57 OVCA-R, DU145, EB
AI285898ESTs 317010 EST cluster 2.57 NCI-H520, PRSC-con, AA863395(not !n NCI-358 UniGene) 324710 Hs.120884 2.57 LnCap, DU145, AI742028ESTs; MB-MDA-453 Weakly similar to RAS-RELATED
PROT

327888 CH.O6_hs 2.56 NCI-H345, MB-MDA-435x, gi~5868149 RPWE-2 336149 CH22_FGENES.706 2,56 NCI-H69, PC3, A549 312816 Hs.188620 2,56 EB, Caco2, NCI-H460 H74319 ESTs 327999 CH.06-hs 2.56 NCI-358, NCI-H520, g!~5867994 NCI-H23 316761 Hs.213722 2.55 NCI-H345, NCI-H460, AI911173ESTs MB-MDA-231 336958 CH22_FGENES.367-1 2.55 HT29, CALU6, CALU6 325043 Hs.32944 2.55 NCI-H460, NCI-H23, W27919 inositol HT29 polyphosphate-4-phosphatase;
ty 315417 Hs.186770 2.55 NCI-H345, NCI-H69, AW452360ESTs PRSC_con 331603 Hs.161535 2.55 NCI-H345, PRSC_con, N78656 EST PRSC_log 309403 EST singleton 2,55 BT474, MB-MDA-231, AW082954(not in MCF7 Un!Gene) with exon 337289 CH22_FGENES.672-8 2,54 BT474, HT29, MB-MDA-231 314242 Hs.246280 2.54 Caco2, MB-MDA-435s, AI570943ESTs MB-MDA-453 328053 CH.06_hs 2.54 MB-MDA-231, DU145, gi~5902482 MB-MDA-453 307215 EST singleton 2.53 HT29, CALU6, MB-MDA-231 AI193189(not in UniGene) with exon 327566 CH.03-hs 5867811 2.53 NCI-H69, NCI-H520, gi~ NCI-H345 326338 CH.17_hs 6056311 2.53 PC3, A549, DU145 gi~

318115 Hs.159130 2.53 DU145, EB, PC3 AI384027ESTs;
Moderately similar to !1!!
ALU SUB

307437 EST singleton 2.52 NCI-H23, NCI-H520, AI245683(not in NCI-358 Un!Gene) with exan 322059 Hs.121344 2.52 EB, DU145, OVCA-R
AA412371ESTs 322505 EST cluster 2.52 PRSC_con, RPWE-2, AF147315(not in NCI-H69 UniGene) 314032 Hs.193211 2.52 NCI-H345, LnCap, AW081897ESTs DU145 336125 CH22_FGENES.701 2.51 NCI-H69, LnCap, DU145 312765 Hs.181873 2.51 NCI-H23, NCI-358, AI692908ESTs NCI-H520 335523 CH22_FGENES.572 2.51 HT29, BT474, OVCA-R

327585 CH.03_hs 2.51 HT29, NCI-H460, MB-MDA-453 gi~5867825 323183 EST cluster 2.51 MB-MDA-231, LnCap, AW393850(not in RPWE-2 UniGene) 314418 Hs,232275 2.51 EB, DU145, DU145 AI478722ESTs;
Moderately similarto !!!! ALU
SUB

313361 Hs.137312 2.5 CALU6, HT29, DU145 AI359782ESTs 305632 EST singleton 2,5 MB-MDA-053, NCI-H460, AA805276(not in NCI-H23 UniGene) with exon 331689 Hs.184675 2.5 NCI-H69, EB, A549 W90131 ESTs 323438 Hs.113817 2.5 NCI-H345, PRSC_con, AI540243ESTs MB-MDA-231 315742 Hs.143198 2.5 MCF7, MB-MDA-053, AI821724H sapiens MB-MDA-435s PAC clone from 7q31 305971 EST singleton 2.5 NCI-358, NCI-H23, AA886874(not in NCI-H520 Un!Gene) with exon 336633 CH22_FGENES.13-3 2.5 NCI-H69, NCI-H345, PRSC-log 304746 EST singleton 2.49 NCI-H69, BT474, MB-MDA-231 AA577793(not in UniGene) with exon 327925 CH.06_hs 2.49 NCI-358, NCI-358, gi~5868172 NCI-H460 336055 CH22_FGENES.683 2.49 EB, HT29, MB-MDA-231 328888 CH.07_hs 2.48 MB-MDA-435s, MB-MDA-453, gi~6588003 PRSC log 311244 Hs.197689 2.48 NCI-H345, MCF7, PC3 AW016694ESTs 327155 CH.01 hs 2.48 NCI-H69, MB-MDA-231, gi~5867549 NCI-H345 334907 CH22_FGENES.453_2 2.48 DU145, NCI-H345, 314887 2.48 DU145, A549, A549 Hs.139469 ESTs 339435 CH22_DJ579N16.GENSCAN.18-102.48 NCI-H69, MCF7, 334172 CH22_FGENES.349_5 2.48 NCI-H69, NCI-H345, PRSC_log 320767 EST cluster (not in 2.48 NCI-358, NCI-H23, AA299525UniGene) NCI-H460 336772 CH22_FGENES.156-1 2.47 NCI-358, NCI-358, 326957 CH,21 hs g!~6469836 2.47 BT474, RPWE-2, PRSC_con 308505 Hs.200778 EST; Weakly MCF7, MB-MDA-053, AI686615sim!lar to SALIVARY MB-MDA-435s PROLINE- 2.47 321325 EST cluster (not in 2.47 EB, CALU6, A549 AB033100UniGene) 313149 Hs.201058 ESTs 2.47 NCI-H345, PRSC_con, 338325 CH22_EM:AC005500.GENSCAN.307-72.46 BT474, LnCap, EB

307877 EST singleton (not in 2.46 NCI-H23, PRSC_log, AI368880UniGene) with exon NCI-H520 311525 Hs.247095 ESTs; Moderately2.46 PRSC_con, PRSC_log, AI7994d4s!milar to i!!! ALU NCI-H345 SUB

337023 CH2~FGENES.433-12 2.46 OVCA-R, CALU6, PRSC_con 300916 Hs.164675 ESTs 2.45 LnCap, DU145, CALU6 302919 EST cluster (not in 2.45 LnCap, MB-MDA-231, AL137382UniGene) with exon CALU6 h 320303 Hs.137154 H sapiens 2.45 BT474, MB-MDA-231, AL079289mRNA full length insert MB-MDA-453 cDNA c 318359 Hs.135548 ESTs 2.45 NCI-H460, MB-MDA-453, 314384 Hs.162203 ESTs; Weakly 2.45 OVCA-R, PC3, EB
AA535840similar to alternatively sp 326763 CH,20_hs gi~6598307 2.45 NCI-H69, NCI-H345, 319900 EST cluster (not in 2.45 Caco2, NCI-H460, AW408392UniGene) NCI-H23 314451 Hs.190232 ESTs 2.45 PRSC_con, NCI-H345, 300641 Hs.118346 ESTs 2.44 NCI-H345, PRSC_log, AW237699 PRSC_con 324368 EST cluster (not in 2.44 PC3, DU145, OVCA-R
AW299374UniGene) 336510 CH22_FGENES.834 5 2.44 NCI-H69, RPWE-2, PRSC_con 326876 CH.20_hs gi~6682507 2.44 NCI-H23, NCI-H460, 307753 Hs.182426 ribosomal 2.44 NCI-H23, NCI-H460, AI340509protein S2 Caco2 317071 Hs.132694 ESTs 2.44 NCI-H345, NCI-H69, 313877 Hs.250113 ESTs; Moderately AA767869similar to thyroid horm component TRAP150 [H.sapiens]2.44 DU145, LnCap, CALU6 315974 Hs.191952 ESTs 2.43 EB, DU145, OVCA-R

322970 Hs.142287 ESTs; Weakly 2.43 NCI-H345, RPWE-2, AI885052similar to !!1! ALU EB
CLASS F

317733 Hs.132317 ESTs 2.43 CALU6, RPWE-2, 313599 Hs.136742 ESTs 2.42 NCI-H460, NCI-358, 323014 EST cluster (not in 2.42 PRSC_con, NCI-H460, AA305198Un!Gene) RPWE-2 324980 Hs.254296 ESTs 2.41 MCFl, OVCA-R, PC3 301326 Hs.252924 ESTs 2.41 PRSC_con, PRSC_log, 308695 EST singleton (not in 2.41 RPWE-2, NCI-H69, AI763350Un!Gene) with exon NCI-H345 330166 CH.02~2 gi]6648220 2.41 CALU6, DU145, A549 317552 Hs.127019 ESTs 2.41 NCI-358, NCI-358, 320572 Hs.159590 lymphocyte 2.41 CALU6, HT29, A549 AI929508antigen 6 complex;
locus H

315618 Hs.154029 ESTs; Weakly OVCA-R, Caco2, AI287341similar to TRANSCRIPTION MB-MDA-231 FA2.41 331610 Hs.54681 ESTs 2.41 NCI-H23, NCI-H520, 311731 Hs.246875 ESTs 2.41 NCI-H69, NCI-H345, AW393528 PRSC-con 318571 Hs.8053 ESTs 2.4 NCI-358, NCI-H23, 334958 CH22_FGENES.465_27 2.4 DU145, PRSC con, 323570 Hs.208752 ESTs; Weakly 2.4 OVCA-R, EB, BT474 AL038623similar to !1!! ALU
SUBFAMI

301685 EST cluster (not in 2.4 MB-MDA-231, NCI-H345, W67730 UniGene) with exon EB
h 303849 EST cluster (not in 2.4 RPWE-2, PRSC_lag, AW163324UniGene) with exon NCI-H345 h 325702 CH.14_hs gi~5867028 2.4 NCI-H23, NCI-H460, 313074 Hs.127171 ESTs 2.4 MB-MDA-231, RPWE-2, N48261 PRSC_log 308994 EST singleton (not in 2.4 RPWE-2, EB, PRSC_con AI880051Un!Gene) with exon 330338 CH.08_p2 gi~5457162 2.4 DU145, EB, LnCap 327274 CH.01_hs gi~5867470 2.4 OVCA-R, DU145, 325953 CH.16_hs gi~5867140 2.4 MB-MDA-053, MB-MDA-435s, 333281 CH22_FGENES.128 7 2.4 NCI-H23, HT29, 314778 Hs.152258 ESTs 2.39 EB, CALU6, Caco2 317005 Hs.197773 ESTs 2.38 MB-MDA-231, BT474, 334257 CH22_FGENES.367 5 2.38 HT29, NCI-358, 324783 EST cluster (not in 2.38 EB, OVCA-R, MB-MDA-453 AA640770UniGene) 300949 Hs.162183 ESTs 2.38 NCI-H69, NCI-H345, AA534325 PRSC_log 314957 Hs.208368 ESTs; Moderately2.38 LnCap, DU145, DU145 AW029274similar to i!!! ALU
SUB

324350 Hs.157174 ESTs; Weakly 2.38 HT29, NCI-H23, AW292501similar to similar NCI-H23 to SH3-b 338235 CH22_EM:AC005500.GENSCAN.260-162.38 NCI-H69, NCI-H460, 300937 Hs.255631 ESTs 2.38 PRSC_log, PRSC_con, AW297302 PRSC_con 317439 Hs.170623 ESTs 2.38 A549, DU145, EB

324745 Hs.116506 ESTs; Weakly 2.38 NCI-358, NCI-H460, AI742120sim!lar to !1!! ALU BT474 SUBFAMI

338306 CH22_EM:AC005500.GENSCAN.302-22.38 NCI-H69, PRSC_con, PRSC_log 318765 Hs.23961 ESTs 2.38 LnCap, NCI-H23, 310254 Hs.157491 ESTs 2.37 OVCA-R, DU145, 305116 EST singleton (not in 2.37 CALU6, MB-MDA-435s, AA649244UniGene) with exon MB-MDA-453 324016 Hs.246849 ESTs; Moderately2.37 EB, DU145, OVCA-R
AL045285sim!lar to 1!!1 ALU
SUB

322774 EST cluster (not in 2.37 OVCA-R, EB, A549 AA131111UniGene) 335745 CH22_FGENES.601 16 2.37 PRSC_log, PRSC_con, 300972 Hs.211518 ESTs 2.37 NCI-H69, NCI-H345, AI979100 PRSC_log 338809 CH22_EM:AC005500.GENSCAN.531-102.37 NCI-H23, NCI-H69, 316983 Hs.177131 ESTs 2.37 NCI-H345, PRSC_con, AI480204 PRSC_log 321308 Hs.117029 ESTs 2.37 BT474, NCI-H69, 323578 Hs.168166 ESTs 2.37 LnCap, EB, MB-MDA-453 335747 CH22 FGENES.601 20 2.36 NCI-H69, LnCap, PRSC_con 322362 EST cluster (not in 2.36 DU145, PRSC_con, AF039697 UniGene) NCI-H345 314430 Hs.78110 ESTs; Weakly 2.36 DU145, MB-MDA-453, N76302 similar to F17A9.2 CALU6 [C.elega 304831 EST singleton (not in 2.36 NCI-H23, NCI-H460, AA586422 UniGene) with exon CALU6 337432 CH22_FGENES.765-1 2.36 MB-MDA-231, BT474, 305984 EST singleton (not in 2.36 DU145, HT29, CALU6 AA887654 UniGene) with exon 313486 Hs.247186 ESTs 2.36 DU145, A549, CALU6 309028 Hs.212032 EST 2.36 NCI-358, NCI-H520, 318292 Hs.150603 ESTs 2.35 NCI-H460, Caco2, 334198 CH22_FGENES.354 4 2.35 NCI-H69, PRSC_log, PRSC_con 314458 Hs.143873 ESTs 2.35 Caco2, A549, PC3 333346 CH22_FGENES.139 15 2.35 CALU6, DU145, LnCap 325408 CH.12-hs gi~5866921 2.35 NCI-H460, NCI-H520, 313758 Hs.129770 ESTs 2.35 NCI-H23, MB-MDA-435s, 309825 EST singleton (not in 2.35 NCI-H460, NCI-H23, AW293701 UniGene) with exon NCI-H520 303536 Hs.183941 ESTs; Moderately2.35 DU145, CALU6, NCI-H520 855497 similar to H beta 58 ho 331534 Hs.133756 EST 2.35 NCI-H23, NCI-H520, 325164 Hs.21963 ESTs 2.34 NCI-H345, PRSC_log, 327710 CH.04_hs gi~5867860 2.34 BT474, MB-MDA-231, 306351 EST singleton (not in 2.34 BT474, MB-MDA-231, AA961356 UniGene) with exon MB-MDA-435s 304968 EST singleton (not in 2.34 CALU6, HT29, MB-MDA-453 AA614308 UniGene) with exon 334015 CH22-FGENES.313 7 2.34 HT29, MB-MDA-231, 318315 Hs.134852 ESTs 2.33 CALU6, NCI-H520, 306809 EST singleton (not in 2.33 PC3, DU145, EB
A1057134 UniGene) with exon 337697 CH22 EM:AC000097.GENSCAN.86-12.33 RPWE-2, PRSC_log, 329630 CH.11_p2 gi~6729060 2.33 NCI-H520, NCI-H23, 326577 CH.19 hs gi~5867317 2.33 NCI-H460, NCI-358, 333428 CH22_FGENES.149_1 2.33 NCI-H345, PRSC_con, 301080 Hs.155405 ESTs; Weakly 2.33 OVCA-R, MCF7, MCF7 AI479391 similar to 1111 ALU
SUBFAMI

324829 EST cluster (not in 2.33 NCI-H460, NCI-358, AA714311 UniGene) NCI-H23 302776 EST cluster (not in 2.32 NCI-H23, NCI-H460, AJ133798 UniGene) with exon NCI-H520 h 325801 CH.14_hs gi~6552451 2.32 PRSC_log, MCF7, 332122 Hs.112389 ESTs 2.32 DU145, HT29, PC3 314167 Hs.208983 ESTs 2.32 DU145, MCF7, PC3 324023 Hs.214226 ESTs 2.31 DU145, NCI-H345, 320503 EST cluster (not in 2.31 A549, OVCA-R, PC3 NN~00589 UniGene) 312217 EST cluster (not in 2.31 NCI-H23, Caco2, T98289 UniGene) NCI-H69 321304 EST cluster (not in 2.31 DU145, OVCA-R, EB
AA078293 UniGene) 323517 Hs.154366 ESTs 2.31 NCI-H345, DU145, 336455 CH22_FGENES.829_13 2.31 NCI-H345, PRSC_con, 313352 Hs.144758 ESTs 2.31 MCF7, DU145, OVCA-R

331457 Hs.41840 ESTs 2.31 Caco2, NCI-H460, 333054 CH22_FGENES.73_8 2.31 NCI-H69, NCI-358, 308598 EST singleton (not in 2.31 OVCA-R, CALU6, Caco2 A1719237 UniGene) with exon 327059 CH.21 hs gi~6531965 2.3 NCI-H460, LnCap, LnCap 334120 CH22_FGENES.333_1 2.3 NCI-H69, RPWE-2, MB-MDA-435s 324154 Hs.192817 ESTs 2.3 NCI-H460, MB-MDA-453, 326509 CH.19_hs gi~6682496 2.3 NCI-H345, CALU6, OVCA-R

316855 Hs.254974 ESTs 2.3 NCI-H345, NCI-H460, 337918 CH22_EM:AC005500.GENSCAN.66-42.3 RPWE-2, NCI-H345, PRSC_log 317471 Hs.144084 ESTs 2.29 HT29, OVCA-R, DU145 331023 Hs.5856 ESTs 2.29 OVCA-R, LnCap, A549 332231 Hs.102629 EST 2.29 CALU6, DU145, EB

309912 EST singleton (not in 2.29 MB-MDA-435s, PRSC-con, AW339671 UniGene) with exon NCI-358 316427 Hs.145644 ESTs 2.29 Caco2, HT29, EB

313329 Hs.122658 ESTs 2.29 OVCA-R, DU145, Caco2 335019 CH22_FGENES.474 7 2.29 HT29, CALU6, MB-MDA-231 324394 Hs.152128 ESTs; Moderately2.29 NCI-H345, MB-MDA-231, F20654 similar to !111 ALU RPWE-2 SUB

339357 CH22_BA354112.GENSCAN.31-22.29 NCI-H69, OVCA-R, 322128 EST cluster (not in 2.28 NCI-H23, NCI-H520, AI346033 UniGene) NCI-H460 301310 Hs.130794 ESTs 2.28 OVCA-R, DU145, MB-MDA-231 300623 Hs.118261 ESTs; Moderately2.28 BT474, RPWE-2, PRSC_con AI929130 similar to finger prote 323409 EST cluster (not in 2.27 NCI-H345, NCI-358, AL135534 UniGene) Caco2 308406 EST singleton (not in 2.27 OVCA-R, EB, HT29 AI634885 UniGene) with exon 322518 EST cluster (not in 2.27 DU145, MB-MDA-035s, AI133446 UniGene) OVCA-R

338381 CH22_EM:AC005500.GENSCAN.330-102.27 NCI-H69, PRSC_con, PRSC_log 316003 Hs.119993 ESTs 2.27 NCI-358, NCI-H520, 307090 EST singleton (not in 2.27 ' NCI-H345, DU145, AI161024 UniGene) with exon RPWE-2 300356 Hs.121335 ESTs 2.27 LnCap, NCI-H460, AA758411 Caco2 331887 Hs.98660 ESTs 2.27 NCI-358, NCI-H520, 330951 Hs.191268 H Sapiens 2.27 OVCA-R, BT474, H02566 mRNA; cDNA DKFZp434N174 BT474 (from 305547 EST singleton (not in 2.27 LnCap, DU145, BT474 AA773111 UniGene) with exon 312457 Hs.191589 ESTs 2.26 NCI-H345, RPWE-2, AA776743 PRSC_con 333929 CH22_FGENES.300_2 2.26 HT29, CALU6, EB

319845 Hs.187902 2.26 LnCap, DU145, MCF7 AA649011 ESTs 306739 EST singleton 2.26 MB-MDA-435s, NCI-358, A1028393 (not in CALU6 UniGene) with exon 306919 EST singleton 2.26 HT29, BT474, PC3 A1096832 (not in UniGene) with exon 333312 CH22 FGENES.138 2.26 OVCA-R, DU145, 334955 CH22_FGENES.465-24 2.25 RPWE-2, PRSC_con, 312295 Hs.173863 2.25 OVCA-R, DU145, AA578233 ESTs NCI-H345 307643 EST s!ngleton 2.25 CALU6, CALU6, OVCA-R
AI302124 (not in UniGene) with exon 324252 EST cluster 2.25 OVCA-R, EB, A549 AA421989 (not in Un!Gene) 309767 EST singleton 2.25 DU145, NCI-H460, AW271805 (not in CALU6 UniGene) with exon 311492 Hs.4437 2.25 NCI-H69, NCI-H460, AW410240 ribosomal NCI-H520 protein 312260 Hs.230597 2.25 Caco2, EB, DU145 327125 CH.21_hs 2.25 HT29, NCI-358, gi~6531971 BT474 316919 Hs.204520 2.24 NC1-H23, NCI-H345, AA845382 ESTs NCI-H520 316361 Hs.164159 2.24 DU145, EB, PC3 AI433833 ESTs;
Weakly similar to !!!!
ALU SUBFAMI

315772 Hs.158893 2.24 OVCA-R, EB, LnCap AW515373 ESTs 320236 EST cluster 2.24 NCI-358, DU145, H03688 (not in NCI-H23 UniGene) 315444 Hs.221737 2.24 NCI-358, CALU6, AW138821 ESTs PRSC_con 333903 CH22_FGENES.294_1 2.24 MB-MDA-231, BT474, 335234 CH22_FGENES.515 2.24 NCI-H69, PRSC_con, 3 PRSC_log 333727 CH22_FGENES.256-1 2.23 MB-MDA-231, NCI-H69, 332002 Hs.105104 2.23 EB, NCI-H520, HT29 AA482009 ESTs 329611 CH.10_p2 2.23 BT474, HT29, MB-MDA-231 gi~3962478 310559 Hs.155718 2.22 BT474, MCF7, MB-MDA-231 AI783594 ESTs 327315 CH.01 hs 2.22 NCI-H69, EB, EB
gi~5867508 323170 EST cluster 2.22 EB, DU145, LnCap 083527 (not in UniGene) 331522 Hs.117012 2.22 A549, LnCap, DU145 N49309 ESTs 313261 Hs.142805 2.22 OVCA-R, PC3, LnCap AA730472 ESTs 312740 Hs.134106 2,22 BT474, MCF7, OVCA-R
897191 ESTs 325055 Hs.21658 2,22 MB-MDA~153, DU145, 244631 ESTs CALU6 337895 CH22_EM:AC005500.GENSCAN.56-2 2.22 NCI-H345, PRSC
log, PRSC_con 307140 EST singleton 2.22 NCI-H520, NCI-H460, AI185762 (not in EB
UniGene) with exon 321643 Hs.32094 2.21 EB, NCI-H345, PRSC_con W76005 ESTs 302683 EST cluster 2.21 BT474, MB-MDA-231, X85153 (not in MCF7 UniGene) with exon h 322644 EST cluster 2.21 NCI-H460, NCI-H23, AA340904 (not in NCI-H520 UniGene) 330415 Hs.75137 2.21 CALU6, A549, Caco2 gene product 302334 EST cluster 2.21 NCI-H69, NCI-H345, AF120491 (not in PC3 UniGene) with exon h 326710 CH.20 hs 5867593 2.21 NCI-H520, NCI-358, gi~ NCI-H23 323561 Hs.238832 y similar 2.21 NCI-H345, DU145, AA825426 ESTs; to !!!! ALU NCI-H69 Weakl SUBFAMI

337706 CH22_EM:AC000097.GENSCAN.87-11 2.21 MB-MDA~135s, NCI-358, 339309 CH22_BA354112.GENSCAN.22-7 2.21 BT474, HT29, PC3 330436 Oncogene 2.21 PRSC_con, NCI-H69, HG2724-H TIsIChop, Caco2 Fusion Activated 312360 Hs.196073 2.21 OVCA-R, MB-MDA-435s, AI922972 ESTs DU145 301855 multiple 2.2 NCI-H69, HT29, AF053356 UniGene NCI-H23 matches 331192 Hs.152571 2.2 OVCA-R, PC3, CALU6 T55182 ESTs;
Highly s!milarto IGF-II
mRNA-bind 315872 Hs.204516 2.2 LnCap, OVCA-R, AW051819 ESTs EB

337904 CH22_EM:AC005500.GENSCAN.56-17 2.2 OVCA-R, LnCap, EB

308258 EST s!ngleton 2.2 DU145, MB-MDA-231, AI565612 (not in CALU6 UniGene) with exon 320965 EST cluster 2.2 DU145, EB, LnCap H18166 (not in UniGene) 333910 CH22_FGENES.295_3 2.2 DU145, MB-MDA-231, EB

300707 EST cluster 2.2 BT474, MCF7, HT29 AA080921 (not in UniGene) with exon h 336011 CH22_FGENES.668_9 2.19 NCI-H460, BT474, 325712 CH.14_hs ~6682473 2.19 NCI-H460, NCI-H23, gi NCI-358 322738 EST clusternot in UniGene)2.19 PC3, RPWE-2, PRSC-con AF201832 ( 335339 CH22_FGENES.535_16 2.19 HT29, PRSC_log, 320733 Hs.134407 2.19 DU145, EB, Caco2 AA738436 ESTs 319412 Hs.187505 2.19 NCI-H345, PRSC_log, AA679426 ESTs PRSC_con 337132 CH22_FGENES.526-3 2.19 NCI-H69, NCI-H345, PRSC_con 301544 Hs.224290 2.19 PRSC_con, MB-MDA-231, AI951651 ESTs NCI-H23 325285 CH.11 hs 2.18 PRSC con, PRSC_log, gi~5866903 MB-MDA-231 338280 CH22_EM:AC005500.GENSCAN.290-11 2.18 PC3, NCI-358, HT29 311421 Hs.207077 2.18 RPWE-2, NCI-H345, AI701635 ESTs NCI-358 330638 Hs.159581 2.18 HT29, MB-MDA-435s, X89576 matrix MB-MDA-453 metalloproteinase 17 (membrane-in 326603 CH.20_hs ~6056312 2.18 CALU6, DU145, HT29 gi 319055 EST cluster(not in Un!Gene)2.18 A549, OVCA-R, MB-MDA-035s 335451 CH22_FGENES.562_9 2.18 DU145, LnCap, CALU6 317989 Hs.130664 2.18 NCI-H345, NCI-H69, AI203009 ESTs NCI-H520 322024 EST cluster 2.18 Caco2, PC3, NCI-H520 AA334384 (not in UniGene) 300734 Hs.240951 2.18 NCI-358, A549, AW205197 ESTs EB

304022 EST singleton 2.18 NCI-H23, NCI-358, T02990 (not in NCI-H460 UniGene) with exon 330082 CH.19_p2 2.18 NCI-H23, Caco2, gi~6015314 Caco2 312516 Hs.189831 2.18 BT474, HT29, MB-MDA-231 AA363245 ESTs 333932 CH22 FGENES.300 2.17 PC3, Caco2, EB

308115 EST s!ngleton 2.17 BT474, OVCA-R, AI479071 (not in OVCA-R
UniGene) with exon 320184 Hs.123036 2.17 NCI-H520, NCI-358, 091510 CD39-like NCI-H23 324432 EST cluster 2.17 CALU6, RPWE-2, AA464510 (not in HT29 UniGene) 320882 EST cluster 2.17 OVCA-R, PC3, BT474 AI832098 (not in UniGene) 312251 EST cluster (not in 2.17 NCI-H460, NCI-H23, H03952 UniGene) NCI-358 315049 2.17 NCI-H520, NCI-358, Hs.121210 ESTs 305018 EST singleton (not in 2.17 MB-MDA-231, MB-MDA-453, AA627127 UniGene) with exon EB

303807 Hs.130434 ESTs . 2.16 NCI-H345, PRSC_con, AI792785 PRSC_log 317792 Hs.196121 ESTs 2.16 NCI-H345, PRSC_con, AI653389 LnCap 321668 Hs.125229 ESTs 2.16 OVCA-R, PC3, MCF7 328863 CH.07_hs gi~6381929 2.16 PRSC_con, NCI-H345, 319373 EST cluster (not in 2.16 PRSC_con, RPWE-2, 800371 UniGene) NCI-H345 320069 Hs.189732 ESTs 2.16 NCI-H23, NCI-358, 320235 Hs.129708 tumor necrosis2.16 NCI-H23, NCI-H460, AF064090 factor (ligand) superfami NCI-H520 338880 CH22_DJ32110.GENSCAN.6-22.16 BT474, MCF7, OVCA-R

318314 Hs.161133 ESTs 2.16 NCI-H23, NCI-H520, 332696 Hs.75354 GCN1 (general 2.16 A549, PC3, DU145 D86973 control of amino-acid synt 331352 Hs.7482 KIAA0682 gene 2.16 PC3, EB, MB-MDA-231 AA406133 product 339019 CH22 DA59H18.GENSCAN.21-152.15 LnCap, EB, OVCA-R

306975 EST singleton (not in 2.15 MB-MDA-035s, NCI-H520, AI127042 UniGene) with exan NCI-358 318069 Hs.131540 ESTs 2.15 Caco2, Caco2, BT474 312997 Hs.135130 ESTs 2.15 NCI-H460, NCI-H23, 331372 Hs.55044 DKFZP586H2123 2.15 PRSC_con, HT29, AA433935 protein CALU6 335049 CH22_FGENES.481 5 2.15 NCI-H69, NCI-H345, PRSC_log 324280 Hs.191610 ESTs 2.15 MB-MDA-453, MB-MDA-435s, 330363 CH.~p2 gi~3126882 2.15 NCI-H23, NCI-H460, 322896 Hs.144830 ESTs 2.15 HT29, CALU6, EB

321981 Hs.127361 ESTs 2.15 MB-MDA-231, DU145, 333294 CH22_FGENES.130 8 2.14 EB, DU145, MB-MDA-453 330170 CH.02_p2 gi~6648220 2.14 HT29, MB-MDA-453, 312973 Hs.135241 ESTs 2.14 LnCap, DU145, EB

311104 Hs.201449 ESTs 2.14 NCI-H520, NCI-H23, A1627352 LnCap 325086 Hs.4194 ESTs 2.14 NCI-H460, NCI-H23, 317182 Hs.192298 ESTs 2.14 HT29, BT474, MB-MDA-035s 323644 Hs.124340 ESTs 2.14 RPWE-2, PRSC_con, AA310711 PRSC_log 308092 EST singleton (not in 2.14 BT474, MCF7, MB-MDA-231 AI474896 UniGene) with exon 322265 EST cluster (not in 2.14 NCI-H345, RPWE-2, AF086244 UniGene) PRSC-con 303521 EST cluster (not in 2.14 DU145, MB-MDA-453, AA746272 UniGene) with exon EB
h 312102 Hs.189720 ESTs 2.14 NCI-H23, NCI-H460, AW439340 MB-MDA-435s 316559 Hs.228251 EST 2.14 NCI-H460, NCI-358, 338486 CH22_EM:AC005500.GENSCAN.382-82.14 NCI-H520, NCI-H23, 301302 Hs.210956 ESTs 2.14 BT474, HT29, MB-MDA-231 310591 Hs.195979 ESTs 2.14 CALU6, CALU6, Caco2 316231 EST cluster (not in 2.14 NCI-H23, NCI-H520, AA732301 UniGene) NCI-358 326559 CH.19_hs gi~5867310 2.14 DU145, NCI-H460, 324062 Hs.204099 ESTs; Weakly 2.13 OVCA-R, DU145, EB
AA525291 similar to !!!! ALU
SUBFAMI

323844 Hs.143490 ESTs 2.13 MB-MDA~453, MCF7, AI811303 MB-MDA-435s 333895 CH22_FGENES.293_2 2.13 CALU6, LnCap, DU145 308264 Hs.171454 EST 2.13 DU145, CALU6, MB-MDA-453 306081 EST singleton (not in 2.13 HT29, BT474, MB-MDA-231 AA908472 UniGene) with exon 333101 CH22 FGENES.79_6 2.13 NCI-H345, NCI-H69, PRSC_log 328544 CH.07_hs gi~5868486 2.13 NCI-H23, NCI-H69, PRSC_log 333355 CH22_FGENES.141 6 2.13 DU145, EB, CALU6 323397 Hs.239699 ESTs 2.13 EB, NCI-H460, NCI-H345 305697 EST singleton (not in 2.13 NCI-H520, NCI-H460, AA814956 UniGene) with exon NCI-358 327809 CH,05_hs gi~5867968 2.13 HT29, PC3, OVCA-R

325092 Hs.92423 ESTs 2.13 HT29, NCI-358, MB-MDA-231 322299 Hs.252784 ESTs 2.13 PRSC_con, DU145, 312145 Hs.126706 ESTs 2.12 OVCA-R, A549, MB-MDA~35s 323704 Hs.193577 ESTs 2.12 Caco2, LnCap, OVCA-R

328971 CH.08_hs gi~6478806 2.12 NCI-358, NCI-H23, 325338 CH.11 hs gi~5866883 2.12 LnCap, NCI-H69, 331332 Hs.89034 ESTs 2.12 NCI-H520, NCI-H23, AA282554 Caco2 327159 , CH.01_hs gi~5867550 2.12 EB, DU145, PC3 335180 CH22_FGENES.505_2 2.12 LnCap, NCI-H69, 338062 CH22_EM:AC005500.GENSCAN.162-32.12 PRSC_con, PRSC_log, 318350 Hs.135538 ESTs 2.12 EB, HT29, DU145 312070 Hs.108790 ESTs 2.11 Caco2, NCI-H23, 328314 CH.07_hs gi~5868371 2.11 HT29, NCI-H23, NCI-H460 315869 Hs.132826 ESTs 2.11 BT474, CALU6, MCF7 339246 CH22_BA354112.GENSCAN.S-92.11 CALU6, CALU6, BT474 329921 CH.16_p2 gi~6165205 2.11 BT474, MB-MDA-231, 324981 Hs.4947 ESTs 2.11 A549, NCI-H460, 331291 Hs.109929 ESTs 2.11 NCI-H345, A549, AA159323 PRSC con 332729 Hs.83190 fatty acid 2.11 NCI-358, LnCap, AA058907 synthase MB-MDA-453 325448 CH.12_.hs gi~5866941 2.11 DU145, MCF7, CALU6 314929 Hs.143612 ESTs 2.1 EB, BT474, MB-MDA-231 301063 Hs.124596 ESTs 2.1 NCI-H23, NCI-H460, 301952 Hs.117333 KIAA1093 protein2.1 OVCA-R, A549, CALU6 326309 CH.17_hs gi~5867277 2.1 MB-MDA~435s, NCI-H69, 315406 Hs.146625 ESTs 2,1 OVCA-R, DU145, EB

302376 Hs.200480 KIAA0407 protein2.1 OVCA-R, Caco2, HT29 312181 Hs.191595 ESTs 2.1 OVCA-R, A549, DU145 334254 CH22_FGENES,366 4 2.1 LnCap, OVCA-R, DU145 318073 Hs.131562 ESTs 2.1 A549, CALU6, EB

304724 Hs.65114 keratin 18 2.1 NCI-H23, NCI-H520, 332359 Hs.211558 ESTs 2.1 MB-MDA-035s, PRSC
W87704 con, NCI-H460 331884 Hs.98721 EST; Weakly 2.1 NCI-H345, MB-MDA-231, AA431302 similar to N-copine PRSC_con [H.sapie 308226 Hs.181165 eukaryotic 2.1 EB, CALU6, OVCA-R
AI559106 translation elongation factor 324279 Hs.191688 ESTs; Weakly 2,09 OVCA-R, LnCap, PC3 AA501412 similar to Pro-PohdUTPase 337203 CH22 FGENES.591-3 2,09 NCI-H69, NCI-H345, 322346 Hs.10882 HMG-box containing2.09 HT29, BT474, MB-MDA-231 AA227618 protein 1 304470 Hs.195188 glyceraldehyde-3-phosphate2.09 NCI-H23, CALU6, AA426654 dehydrogenase NCI-H520 325977 CH.16 hs gi~6249602 2.09 NCI-H23, NCI-H520, 304696 EST singleton (not in 2.09 MB-MDA~l35s, NCI-H23, AA554758 UniGene) with exon BT474 317412 Hs.132604 ESTs 2.09 Caco2, EB, NCI-358 315570 Hs.160316 ESTs 2.08 PRSC_con, PRSC_log, 327341 CH.01 hs gi~6017016 2.08 MB-MDA-231, PRSC_con, 327431 CH.02 hs gi~5867754 2.08 NCI-H23, NCI-358, 314685 Hs.158709 ESTs; Weakly 2.08 MB-MDA-053, MCF7, AI870811 similar to KIAA0938 OVCA-R
profein 328624 CH.07_hs gi~5868246 2.08 MCF7, NCI-358, RPWE-2 303596 EST cluster (not in UniGene)2.08 RPWE-2, PRSC_con, AW303377 with exon h PRSC_log 336717 CH22_FGENES.81-1 2.08 BT474, HT29, MCF7 317370 Hs.174424 ESTs; Weakly 2.08 NCI-H23, NCI-H460, AW204139 similar to p140mDia NCI-H69 [M.musc 331287 Hs.172971 ESTs 2.08 OVCA-R, EB, NCI-H345 304211 EST singleton (not in 2.08 BT474, MCF7, MB-MDA-231 N62228 UniGene) with exon 315613 Hs.192311 ESTs 2.08 PRSC_con, PRSC_log, AW137420 PRSC_log 325636 CH.14_hs gi~5867002 2.08 NCI-358, NCI-H460, 336406 CH22_FGENES.823 21 2.08 HT29, EB, DU145 301714 EST cluster (not in UniGene)2.08 LnCap, PRSC_log, F06529 with exon h PRSC-con 300496 Hs.221804 ESTs 2.08 PRSC_con, LnCap, 318970 Hs.21383 ESTs 2.08 NCI-H23, NCI-H520, 334115 CH22_FGENES.330_15 2.08 BT474, NCI-H69, 308082 EST singleton (not in 2.08 MB-MDA-435s, NCI-H345, AI473682 UniGene) with exon MB-MDA-231 308282 EST singleton (not in 2.08 LnCap, EB, PRSC_con AI569456 UniGene) with exon 313038 Hs.124195 ESTs 2.07 NCI-H345, PRSC-con, AW451618 LnCap 317974 Hs.144900 ESTs 2.07 NCI-358, NCI-H23, 324063 Hs.254815 ESTs 2.07 Caco2, NCI-358, 334759 CH22 FGENES.428 8 2.07 CALU6, HT29, NCI-H520 307864 EST singleton (not in 2.07 NCI-H460, NCI-358, AI367417 UniGene) with exon NCI-H23 304356 Hs.195188 glyceraldehyde-3-phosphate2.07 HT29, MCF7, MB-MDA-435s AA196027 dehydrogenase 303929 EST singleton (not in 2.07 NCI-H345, PRSC_con, AW470753 UniGene) with exon RPWE-2 331857 Hs.9456 SWIISNF related;2.07 EB, A549, PC3 AA421160 matrix assocd; actin de 322814 Hs.211038 ESTs 2.06 PRSC_con, RPWE-2, AI824495 Caco2 303650 EST cluster (not in UniGene)2.06 RPWE-2, NCI-H345, AA430709 with exon h PRSC_con 333403 CH22_FGENES.144_21 2.06 OVCA-R, CALU6, PC3 313663 Hs.169813 ESTs 2.06 NCI-H345, OVCA-R, 338594 CH22_EM:AC005500.GENSCAN.435-42.06 DU145, LnCap, EB

334676 CH22_FGENES.418_29 2.06 NCI-H69, PRSC_log, PRSC_con 310046 Hs.210356 ESTs 2.06 MB-MDA~435s, NCI-H23, AI198032 Caco2 309169 EST singleton (not in 2.06 CALU6, EB, NCI-358 AI949216 UniGene) with exon 329752 CH.14_p2 gi~6065777 2.06 CALU6, HT29, DU145 325085 Hs.4188 ESTs 2.06 EB, OVCA-R, MB-MDA-435s 332062 Hs.185375 ESTs 2.06 OVGA-R, MB-MDA-453, 302074 Hs.132794 phosphate cytidylylUansferase2.06 LnCap, EB, NCI-H69 AA382871 1; cholin 326344 CH.17_hs gi~6525295 2.06 HT29, BT474, MB-MDA-453 330855 zm98c2.s1 SUatagene colon AA079318 HT29 (#937221 IMAGE:545954 3', mRNA 2.06 RPWE-2, LnCap, PRSC_con seq 302525 Hs.248056 G protein-coupled2.05 NCI-358, NCI-H23, AF024690 receptor 43 DU145 331903 Hs.29417 H sapiens mRNA; 2.05 Caco2, DU145, AA436673 cDNA DKFZp586B0323 (from A549 316322 Hs.120637 ESTs 2.05 BT474, MB-MDA-453, 321525 EST cluster (not in UniGene)2.05 NCI-H23, PRSC_con, 305071 EST singleton (not in 2.05 MB-MDA-231, BT474, AA640579 UniGene) with exon HT29 326033 CH.17 hs gi~5867178 2.05 HT29, DU145, BT474 334730 CH22_FGENES.424 5 2.05 BT474, EB, OVCA-R

305335 EST singleton (not in 2.05 MCF7, OVCA-R, MB-MDA-453 AA704235 UniGene) with exon 320521 Hs.24743 ESTs 2.05 MB-MDA-453, MB-MDA-231, 333515 CH22_FGENES.172 5 2.04 NCI-H345, RPWE-2, PRSC-con 311020 Hs.213783 ESTs 2.04 NCI-H460, NCI-H23, 324323 EST cluster (not in UniGene)2.04 OVCA-R, PC3, LnCap 305486 EST singleton (not in 2.04 NCI-H345, PRSC_log, AA748889 UniGene) with exon CALU6 312162 EST cluster (not in UniGene)2.04 NCI-H520, NCI-H23, 330980 Hs.6659 ESTs 2.04 MCF7, MB-MDA-453, H28794 MB-MDA-435s 317463 Hs.130462 ESTs 2.04 NCI-H23, Caco2, 303460 Hs.117900 ESTs 2.04 DU145, EB, CALU6 337435 CH22_FGENES.766-2 2.03 NCI-H345, OVCA-R, LnCap 305464 EST singleton 2.03 CALU6, NCI-H520, AA742425 (not in NCI-358 UniGene) with exon 307918 EST singleton 2.03 NCI-H23, BT474, AI383496 (not in MB-MDA-231 UniGene) with exon 322209 EST cluster 2.03 DU145, OVCA-R, H89360 (not in MB-MDA-453 UniGene) 310295 Hs.149146 2.03 NCI-H23, NCI-H460, AW205198 ESTs NCI-358 325886 , CH.16_hs 2.03 NCi-H345, NCI-H345, gi~5867087 RPWE-2 329719 CH.14_p2 2.03 NCI-H69, RPWE-2, gi~6065785 PRSC_con 309247 EST singleton 2.03 LnCap, PRSC_con, AI972768 (not in RPWE-2 UniGene) with exon 328277 CH.07_hs 2.03 LnCap, RPWE-2, gi~6004471 A549 307296 Hs.147222 2.03 NCI-H460, NCI-358, 327203 CH.01 hs 2.03 HT29, BT474, MB-MDA-231 gi~5867447 306866 EST singleton 2.03 BT474, NCI-H345, A1086683 (not in HT29 UniGene) with exon 333339 CH22_FGENES.139 2.03 HT29, DU145, CALU6 323115 EST cluster 2.03 BT474, BT474, AI921875 (not in MB-MDA-231 UniGene) 304811 EST singleton 2.03 NGI-H23, NCI-358, AA584361 (not in NCI-H460 UniGene) with exon 323372 Hs.13913 2.02 DU145, EB, A549 AL135125 ESTs 312854 EST cluster 2.02 NCI-H345, PRSC_con, AA828713 (not in PRSC log UniGene) 307904 EST singleton 2.02 HT29, MCF7, MB-MDA-453 AI381019 (not in UniGene) with exon 332099 af5d4.s1 PRSC_con, NCI-H345, AA608983 Soares RPWE-2 tesUs_NHT
H sapiens cDN 2.02 324634 Hs.175831 2.02 NCI-H460, Caco2, AI684571 ESTs NCI-358 335721 CH22_FGENES.599_24 2.02 NCI-H69, PRSC_log, 312452 Hs.172749 2.02 HT29, Caco2, MB-MDA-231 AI692643 ESTs -325396 CH.12_hs 5866921 2.01 HT29, NCI-H520, gi~ NCI-H460 328770 CH.07 hs 6017031 2.01 NCI-H23, NCI-H460, gi~ NCI-358 335585 CH22~FGENES.581 2.01 MB-MDA-453, DU145, 335634 CH22_FGENES.584_14 2.01 NCI-H23, NCI-H460, 338271 CH22_EM:AC005500.GENSCAN.287-1 2.01 MCF7, DU145, PC3 328607 CH.07_hs 2.01 NCI-H460, NCI-H23, gi~5868233 NCI-358 307050 Hs.146734 2.01 NCI-H520, NCI-H23, 334946 CH22_FGENES.465-13 2.01 CALU6, BT474, 319793 EST cluster 2.01 NCI-H460, HT29, 856360 (not in NCI-358 UniGene) 307223 Hs.184776 2.01 NCI-358, NCI-H520, AI193698 ribosomal NCI-H23 protein L23a 312627 Hs.133169 2.01 PC3, LnCap, MB-MDA-231 AA344698 ESTs 329221 CH.~hs gi~5868727 2.01 NCI-H345, NCI-H69, NCl-358 305145 EST singleton 2.01 LnCap, EB, OVCA-R
AA653589 (not in UniGene) with exon 328428 CH.07_hs 2.01 NCI-H69, MB-MDA-453, gi~5868417 BT474 305990 Hs.125919 2.01 NCI-H520, NCI-358, AA888866 EST NCi-H23 319368 Hs.133171 2 OVCA-R, LnCap, 800003 ESTs PC3 324805 Hs.131350 2 NCI-H460, NCI-H23, AA927002 ESTs NCI-358 301138 Hs.189419 2 NCI-H69, NCI-H23, AA719179 ESTs PRSC_con 304675 EST singleton 2 NCI-H460, NCI-H520, AA541740 (not in MB-MDA-231 UniGene) with exon 326194 CH.17_hs 2 HT29, NCI-358, gi~5867213 BT474 Table 5: H chip - B. survivor vs Met query -. up in Mets Pkey: Unique Eos probeset identifier number ExAcen: Exemplar Recession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit-ID Complete-Title Ratio MetIB surv.
102193 U20758 Hs.313 secreted phosphoprotein 1 (osteopontin; 5.56 128530 AA504343 Hs.183475 Homo sapiens clone 25061 mRNA sequence 4.62 129093 AA262710 Hs.108614 KIAA0627 protein 4.23 124690 805818 Hs.173830 ESTs 3.96 115558 AA393806 Hs.1010 regulator of mitotic spindle assembly 1 3.39 134261 AA227678 Hs.8084 Humn DNA sequence from clone 465N24 on c3.22 104792 AA029288 Hs.29147 ESTs; Highly similar to ZINC FINGER PROT 3.17 133770 M69197 Hs.242279 haptoglobin-related protein 3.07 Table 6: H chip - B survivor vs Met query - down in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit ID Complete Title Ratio MetIB surv.
100116 D00654 Hs.77443 actin; gamma 2; smooth muscle; enteric 0.07 101923 S75256 HNL=neutrophil lipocalin [human, ovarian 0.2 129982 M87789 Hs.140 immunoglobulin gamma 3 (Gm marker) 0.2 130064 T67053 Hs.181125 immunoglobulin lambda gene cluster 0.2 Table 7: I chip - B survivor vs Met query - up in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene Ntle Pkey Ex-Accn UniG_ID Title Ratio MetIB surv 319379 Hs.193963 ESTs 19.65 321920 11.9 324302 Hs.136806 ESTs; Weakly 9.31 AA543008 similar to !!!! ALU
SUBFAMI

314522 Hs.187750 ESTs; Moderately5.79 AI732331 similar to 1!!1 ALU
CLA

331433 Hs.161023 EST 4.79 324643 Hs.130729 ESTs 4.59 332471 Hs.120980 nuclear receptor4.58 AA416967 co-repressor 2 314915 Hs.187748 ESTs; Weakly 4.3 AA573072 similarto !!!! ALU
SUBFAMI

321354 EST cluster (not in 4.26 AA078493 UniGene) 322309 EST cluster (not in 3.89 AF086372 UniGene) 325100 Hs.116122 ESTs; Weakly 3.81 T10265 similar to coded for by C.

314071 Hs.188690 ESTs 3.74 315178 Hs.162459 ESTs 3.66 330987 Hs.131965 ESTs; Weakly 3.51 H40988 similarto !!II ALU
SUBFAMI

337898 CH22_EM:AC005500.GENSCAN.56-53.21 319403 EST cluster (not in 3.2 T98413 UniGene) 331469 Hs.39140 ESTs 3.15 331549 Hs.237507 EST 3.14 331644 Hs.173734 ESTs; Weakly 3.14 T99544 similar to !II! ALU
CLASS B

313220 Hs.118241 ESTs 3.04 Table 8: I chip - B survivor vs Met query - down in Mets Pkey: Unique Eos probeset idenfifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex_Accn UniG_ID Title Ratio MetIB surv 333658 CH22 FGENES.241 4 0.06 333657 CH22_FGENES.241 2 0.07 333654 CH22_FGENES.240_2 0.07 332859 CH22_FGENES.27 2 0.07 333656 CH22-FGENES.240 4 0.07 304480 AA430373EST singleton (not 0.08 in UniGene) with exon 333737 CH22_FGENES.261 1 0.09 308601 AI719930EST singleton (not 0.1 in UniGene) with exon 334030 CH22_FGENES.320 2 0.1 333637 CH22_FGENES.229 2 0.13 302347 AF039400 0.16 Hs.194659 chloride channel;
calcium activated;
fam 333653 CH22_FGENES.239 2 0.16 333635 CH22 FGENES.228 2 0.19 333647 CH22 FGENES.235_2 0.19 307588 AI285535EST singleton (not 0.2 in UniGene) with exon 337954 CH22-EM:AC005500.GENSCAN.96-30.2 333588 CH22_FGENES.206 2 0.21 320244 AA296922 0.22 Hs.129778 gastrointestinal peptide 333642 CH22-FGENES.231 2 0.23 337951 CH22-EM:AC005500.GENSCAN.94-10.23 333730 CH22_FGENES.258 1 0.23 333646 CH22-FGENES.234 2 0.24 Table 9: H chip - B survivor vs Met query - up in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn UniGID Complete_Title Median Mets AI vs Median B-SurAl 100655 HG28d1-HT2970 Albumin, Alt. Splice 5 11.98 124875 870506 Hs,207693 ESTs; Weakly similar to !!!! ALU SUBFAMI 9.21 102193 U20758 Hs.313 secreted 6.73 phosphoprote!n 1 (osteopontin;

100654 HG2841-HT2969 Albumin, Alt. Splice 3, Missplic!ng In Alloalbumin Venezia 6.18 118828 N79496 Hs.50824 EST 5.93 128046 AA873285 Hs.137947 ESTs 5.9 128896 D14446 Hs.107 fibrinogen-like5.17 127917 AA211895 Hs.118831 EST; 5.11 Highly similar to dJ1163J1.2.1 [H.s 125090 T91518 ye20f05.s1 Stratagene4.47 lung (#937210) Hom 118579 N68905 small inducible 4.23 cytokine A5 (RANTES) 123526 AA608657 ESTs; Moderately4.21 s!m!lar to !!!! ALU SUB

128062 AA379500 Hs.193155 ESTs 4.14 119174 871234 y!54c08.s1 Soares 4.11 placenta Nb2HP Homo sa 128530 AA504343 Hs.183475 Homo 4.09 sapiens clone 25061 mRNA sequence 119404 T92950 ye27c10.s1 Stratagene3.98 lung (#937210) Hom 118475 N66845 Hs.165411 ESTs; 3.96 Weakly similar to I!!! ALU CLASS
B

129974 K00629 Hs.199300 Human 3.87 kpni repeat mma (cdna clone pcd-k 108888 AA135606 Hs.189384 ESTs; 3.85 Weakly similar to !!!! ALU SUBFAMI

123963 C13961 Hs.210115 EST 3.8 123523 AA608588 Ns.19363A ESTs 3.76 128230 AA984074 Hs.176757 ESTs 3.75 124090 H09570 Hs.143032 ESTs; 3.67 Weakly similar to neuronal thread 124690 805818 Hs.173830 ESTs 3.58 134261 AA227678 Hs.8084 Human 3.57 DNA sequence from clone 465N24 on 126917 AA176225 Hs.193929 ESTs 3.52 126050 H27267 Hs.75860 hydroxyacyl-Coenryme3.45 A dehydrogenase/3-k 126649 AA856990 Hs.125058 ESTs 3.42 115096 AA255991 Hs.175319 ESTs 3.4 129906 H39216 Hs.239970 ESTs; 3.38 Weakly similar to ZNF91L [H.sapien 123022 AA480909 aa28f10.s1 NCI_CGAP_GCB1 Homo sapiens cD 3.38 106145 AA424791 Hs.5734 KIAA06793.38 protein 125191 W67257 Hs.138871 ESTs; 3.36 Weakly similar to !!!! ALU CLASS
B

108836 AA132061 Hs.222727 ESTs; 3.3 Weakly s!milar to ubiquitous TPR m 128710 J04813 Hs.104117 cytochrome3.27 P450; subfamily IIIA (niphedi 123460 AA598981 Hs.251122 EST 3.25 133735 AC002045 Hs.251928 nuclear3.24 pore complex interacting protein 124696 806273 Hs.186467 ESTs; 3.24 Moderately similar to !!!! ALU
SUB

120748 AA303153 Hs.237994 EST; 3.21 Weakly similar to !!!! ALU SUBFAMIL

133770 M69197 Hs.242279 haptoglob!n-related3.17 protein 128336 AI242720 Hs,146043 ESTs; 3.14 Weakly similar to alternatively sp 135357 AA235803 Hs.79572 cathepsin3.12 D (lysosomal aspartyl protease 128088 802443 Hs.186467 ESTs; 3.08 Moderately similar to !!!! pLU
SUB

124055 F10904 Hs.100516 Homo 3.06 Sapiens clone 23605 mRNA sequence 124896 882063 Hs.101594 EST 3.06 127598 AA610677 Hs.168851 ESTs 3.04 116802 H44061 Hs.194026 ESTs 3.01 Table 10: H chip - B survivor vs Met query - Down in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit-ID Complete Title Ratio MetIB surv.
100116 D00654 Hs.77443 actin; gamma 2; smooth muscle; enteric 0.09 130064 T67053 Hs.181125 immunoglobulin lambda gene cluster 0.11 129982 Hs.140 immunoglobulin 0.12 M87789 gamma 3 (Gm marker) 131219 Hs.24395 small inducible0.13 C00476 cytokine subfamily B
(Cy 133806 Hs.76325 Human Ig J chain0.17 M12759 gene 132982 Hs.198118 immunoglobulin0.18 L02326 lambda-like polypeptide 131713 Hs.181125 immunoglobulin0.18 X57809 lambda gene cluster 131791 Hs.32225 immunoglobulin 0.2 S71043 alpha 1 133725 Hs.179543 immunoglobulin0.22 V00563 mu 101923 HNL=neutrophil lipocalin0.23 S75256 [human, ovarian 101461 Hs.76422 phospholipase 0.24 M22430 A2; group IIA (platelets;

103448 Hs.204238 lipocalin 2 0.24 X99133 (oncogene 24p3) Table 11: H chip - Met vs Normal query - up in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit-ID Complete-Title Median Mets AI vs Median Normal AI
100655 HG2841-HT2970 Albumin, 15.91 Alt. Splice 5 102193 020758 Hs.313 secreted 6.83 phosphoprotein 1 (osteopontin;

124875 870506 Hs.207693 ESTs; 6.68 Weakly similar to 111! ALU SUBFAMI

100654 HG2841-HT2969 A!bum!n, Alt. Splice 3, Missplicing !n Alloalbumin Venezia 5.28 124059 F13673 Hs.99769 ESTs 5.11 128896 D14446 Hs.107 fibrinogen-like5.05 134453 X70683 Hs.83484 SRY (sex 4.82 determ!ning region Y)-box 4 131564 AA491465 Hs.28792 ESTs 4.78 127917 AA211895 Hs.118831 EST;HighlysimilartodJ1163J1.2.1[H.s4.76 115096 AA255991 Hs.175319 ESTs 4.67 104558 856678 Hs.88959 Human DNA sequence from clone 967N21 on 4.63 123526 AA608657 ESTs; Moderately4.61 s!m!lar to !!!! ALU SUB

125090 T91518 ye20f05.s1 Stratagene4.59 lung (#937210) Hom 129666 M77349 Hs.118787 transforming4.58 growth factor, beta-induced 118828 N79496 Hs.50824 EST 4.56 128046 AA873285 Hs.137947 ESTs 4.45 133421 AA436560 Hs.7327 claudin 4.09 129158 J05257 Hs.109 dipeptidase4.04 1 (renal) 128062 AA379500 Hs,193155 ESTs 4.03 124696 806273 Hs.186467 ESTs; 4.01 Moderately similar to !!!! ALU
SUB

118475 N66845 Hs.165411 ESTs; 3.96 Weakly similar to 1!!! ALU CLASS
B

104755 AA024482 Hs.9029 DKFZP434G0323.83 protein 104978 AA088458 Hs.19322 ESTs 3.74 118579 N68905 small inducible 3.7 cytokine A5 (RANTES) 123796 AA620390 Hs.247444 ESTs 3.62 127240 AA888387 Hs.243845 ESTs; 3.61 Moderately similar to !!!! ALU
SUB

104105 AA422123 Hs.42457 ESTs 3.55 129349 D86974 Hs.110613 KIAA02203.54 protein 119329 T51832 ESTs; Moderately 3.53 similar to !!!! ALU SUB

114617 AA084148 Hs.110659 ESTs 3.52 123143 AA487595 aa95e2.s1 Stratagene3.48 fetal retina 93722 103119 X63629 Hs.2877 cadherin 3.48 3; P-cadherin (placental) 119404 T92950 ye27c10.s1 Stratagene3.47 lung (#937210) Hom 123963 C13961 Hs.210115 EST 3.47 116480 C14088 Hs.195188 glyceraldehyde-3-phosphate3.4 dehydrogenase 108836 AA132061 Hs.222727 ESTs; 3.39 Weakly similar to ubiquitous TPR m 120748 AA303153 Hs.237994 EST; 3.38 Weakly similar to !1!! ALU SUBFAMIL

133770 M69197 Hs.242279 haptoglobin-related3.38 protein 132358 X60486 Hs.46423 H4 histone3.37 family; member G

127759 AI369384 arylsulfatase 3.37 D

129095 L12350 Hs.108623 thrombospondin3.37 128261 A1061213 Hs.13179 ESTs; 3.36 Moderately sim!larto 1!!! ALU
SUB

126908 AA169866 ESTs; Weakly 3.36 similar to !!!! ALU SUBFAMI

128954 N32118 Hs.209100 DKFZP434C1713.34 protein 119174 871234 yi54cO8.s1 Soares 3.33 placenta Nb2HP Homo sa 106687 AA463234 Hs.119387 KIAA07923.32 gene product 128230 AA984074 Hs.176757 ESTs 3.3 126649 AA856990 Hs.125058 ESTs 3.25 124620 N74051 Hs.194092 ESTs; 3.24 Weakly similar to !!!! ALU SUBFAMI

135427 AFFX control: human alu 3.23 repeats 129967 H99653 Hs.138618 ESTs 3,22 125191 W67257 Hs.138871 ESTs; 3.2 Weakly similar to !!!! ALU CLASS
B

124684 802401 Hs.221078 ESTs 3.2 128010 AA856953 Hs.23348 S-phase3.17 kinase-associated protein 2 (p45 119423 T99544 Hs.173734 ESTs; 3.16 Weakly similar to 1!!! ALU CLASS
B

123022 AA480909 aa28f10.s1 NCI_CGAP_GCB1 Homo Sapiens cD 3.15 103654 270759 H.sapiens mitochondria)3.13 16S rRNA gene (p 128336 AI242720 Hs.146043 ESTs; 3.12 Weakly similar to alternatively sp 124690 805818 Hs.173830 ESTs 3.1 129791 F02778 Hs.173887 KIAA08763.07 protein 114472 AA028924 Hs.177407 ESTs; 3.07 Weakly similar to !!!! ALU SUBFAMI

115429 AA284139 Hs.89295 EST 3.06 130020 AA433930 Hs.240443 ESTs; 3.06 Weakly similar to HNK-1 sulfotrans 126050 H27267 Hs.75860 hydroxyacyl-Coenryme A dehydrogenasel3-k 3.05 129906 H39216 Hs.239970 ESTs; 3.04 Weakly similarto ZNF91L [H.sapien 123422 AA598484 Hs.238476 EST 3.03 103059 X57351 Hs.174195 interferon3.02 induced transmembrane protein 124253 H69742 Hs.102201 ESTs 3.02 123523 AA608588 Hs.193634 ESTs 3.02 132669 AA188378 Hs.54602 ESTs;
Weakly similarto 60S RIBOSOMAL
PR3.02 123196 AA489250 Hs.59403 serine3.01 palmitoyltransferase; subunit II

122948 AA477483 zu44h2.s1 Soares ovary tumor NbHOT Homo 3.01 119053 811501 yf28f1.s1Soaresfetalliverspleen1NFL3.01 125953 H40829 yo05d11.r1 Soares3 adult brain N2b5HB55Y

119155 861715 Hs.138237 ESTs 3 Table 12: H chip - Met vs Normal query - down in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit-ID Complete Title Median Mets AI vs Median Normal AI
103466 Y00339 Hs.155097 carbonic0.01 anhydrase II

104258 AF007216 Hs.5462 solute 0.02 tamer family 4; sodium bicarbon 108999 AA156064 Hs.72115 ESTs 0.04 101046 K01160 Accession not listed0.04 in Genbank 133565 H57056 Hs.204831 ESTs 0.05 101346 L76465 Hs.77348 hydroxyprostaglandin0.05 dehydrogenase 15-(N

123137 AA487468 Hs.100686 ESTs; 0.05 Weakly similar to secreted cement 134534 X73501 Hs.84905 H. Sapiens0.05 mRNA for cytokeratin 20 118823 N79237 Hs.50813 ESTs; 0.06 Weakly similar to long chain fatty 102095 011313 Hs.75760 sterol 0.06 tamer protein 2 111855 837362 Hs.21351 ESTs 0.06 129105 AA224351 Hs.108681 ESTs 0.07 130320 019495 Hs.237356 stromal 0.07 cell-derived factor 1 113778 W15263 Hs.5422 ESTs 0.07 116786 H25836 Hs.83429 tumor 0.07 necrosis factor (ligand) superfami 100116 D00654 Hs.77443 actin; 0.07 gamma 2; smooth muscle; enteric 104636 AA004415 Hs.106106 ESTs 0.07 107032 AA599472 Hs,247309 succinate-CoA0.08 fgase; GDP-forming; beta 106605 AA457718 Hs.21103 Homo Sapiens mRNA; cDNA DKFZp564B076 (fr 0.08 128906 AA487557 Hs.10706 ESTs 0.08 130016 AA055811 Hs.143131 transmembrane0.08 glycoprotein 113523 T90037 Hs.16686 ESTs 0.08 102638 067319 Hs.9216 , caspase 0.09 7; apoptosis-related cysteine pr 124308 H93575 Hs.227146 Homo (fr 0.09 sapiens mRNA; cDNA DKFZp564J142 129519 AA298786 Hs.112242 ESTs 0.09 134749 L10955 Hs.89485 carbonic 0.09 anhydrase IV

130366 L11708 Hs.155109 hydroxysteroid0.09 (17-beta) dehydrogenase 2 109272 AA195718 Hs.86030 ESTs 0.09 102124 014528 Hs.29981 solute 0.1 tamer family 26 (sulfate transp 132711 N73702 Hs.238927 ESTs 0.1 131861 D11925 Hs.184245 KIAA09290.1 protein Msx2 interacting nuclea 133806 M12759 Hs.76325 Human 0.1 Ig J chain gene 102571 060115 Homo Sapiens skeletal0.1 muscle L(M-protein 114846 AA234929 Hs.44343 ESTs 0.11 131328 V01512 Hs.25647 v-fos 0.11 FBJ marine osteosarcoma viral onto 106569 AA455983 Hs.117816 sorcin0.11 103542 211793 Hs.3314 selenoprotein0.11 P; plasma;1 128915 C02386 Hs.107139 ESTs 0.11 120914 AA377254 Hs.97107 EST 0.11 130867 J04093 Hs.2056 UDP glycosyltransferase0.11 110837 N30796 Hs.17424 ESTs; 0.12 Weakly similar to semaphorin F [H.

101877 M97496 Hs.778 guanylate 0.12 cyclase activator 1 B (retina) 132617 AA171913 Hs.5338 carbonic0.12 anhydrase XII

129113 AA147646 Hs.108740 DKFZP586A05220.12 protein 133435 T23983 Hs.7365 ESTs 0.13 132836 F09557 Hs.57929 slit (Drosophila)0.13 homolog 3 125832 AA628600 Hs.117587 ESTs 0.13 104613 AA001049 Hs.24713 Homo sapiens mRNA; cDNA DKFZp586G0123 (f 0.13 132903 AA235404 Hs.5985 Homo 0.13 Sapiens clone 25186 mRNA sequence 119479 W32094 Hs.55501 ESTs 0.14 131273 AA421139 Hs.173542 ESTs 0.14 106674 AA461303 Hs.7946 DKFZP586D15190.14 protein 108980 AA151676 Hs.33455 peptidyl0.14 arginine deiminase; type II

103211 X73079 Hs.205126 polymeric0.14 immunoglobulin receptor 131219 C00476 Hs.24395 small 0.15 inducible cytokine subfamily B (Cy 116459 AA621399 Hs.64193 ESTs 0.15 130219 877539 Hs.15285 ESTs 0.15 113863 W68388 Hs.21288 ESTs; 0.15 Weakly similar to KIAA0704 protein 101564 M32886 Hs.117816 sorcin 0.15 109502 AA233837 Hs.44755 ESTs; 0.15 Weakly similar to membrane glycopr 107222 D51235 Hs.82689 tumor 0.15 rejection antigen (gp96) 1 135237 AA454930 Hs.9691 ESTs 0.15 112483 866534 Hs.28403 ESTs 0.15 132387 870914 Hs.8997 heat shock 70kD protein 1 0.15 130343 AA490262 Hs.15485 ESTs; Weakly similar to APICAL-LIKE PROT 0.16 105496 AA256323 Hs.25264 DKFZP434N126 protein 0.16 104037 AA372630 Hs.100347 differentially expressed in hematopoieti 0.16 101461 M22430 Hs.76422 phospholipase A2; group IIA (platelets; 0.16 116551 D20458 Hs.229071 EST 0.16 133889 AA099391 Hs.211582 myosin; light polypeptide kinase 0.16 103653 270295 Hs.32966 guanylate cyclase activator 2B (uroguany 0.16 101070 L02785 Hs.1650 down-regulated in adenoma 0.17 131501 AA121127 Hs.181307 H3 histone; family 3A 0.17 133515 X98311 Hs.74466 carcinoembryonic antigen-related cell ad 0.17 108604 AA099820 Hs.49696 ESTs 0.17 132982 L02326 Hs.198118 immunoglobulin lambda-like polypeptide 2 0.17 131676 C20785 Hs.30514 ESTs 0.17 134675 AA250745 Hs.87773 protein kinase; CAMP-dependent; catalyti 0.17 133441 M82962 Hs.179704 meprin A; alpha (PABA peptide hydrolase) 0.18 130455 X17059 Hs.155956 N-aceiyltransferase 1 (arylamine N-acety 0.18 131734 D62965 Hs.31297 ESTs 0.18 100749 HG3521-HT3715 Ras-Related Protein Rap1 b 0.18 116724 F13665 Hs.65641 ESTs 0.18 129265 X68277 Hs.171695 dual specificity phosphatase 1 0.18 102347 U37518 Hs.83429 tumor necrosis factor (ligand) superfami 0.18 114542 AA055768 Hs.122576 ESTs 0.18 123900 AA621223 Hs.112953 EST 0.19 121780 AA422086 Hs.124660 ESTs 0.19 115662 AA405715 Hs.64179 hypothetical protein 0.19 113803 W42789 Hs.31446 ESTs 0.19 105493 AA256268 Hs.10283 ESTs 0.19 113195 T57112 yc20g11.s1 Stratagene lung (#937210) Hom 0.19 129462 D84239 Hs.111732 IgG Fc binding protein 0.19 133664 X86693 Hs.75445 hevin 0.2 126180 818070 Hs.3712 ubiquinol-cytochrome c reductase; Rieske 0.2 100687 HG3115-HT3291 Golii-Mbp (Gb:L18862) 0.2 130064 T67053 Hs.181125 immunoglobulin lambda gene cluster 0.2 101367 M12963 Hs.73843 alcohol dehydrogenase 1 (class I); alpha 0.2 132254 L20826 Hs.430 plastin 1 (I isoform) 0.2 105646 AA282147 Hs.5888 ESTs 0.2 132883 AA047151 Hs.5897 Homo Sapiens mRNA; cDNA DKFZp586P1622 (f 0.21 132618 AA253330 Hs.5344 adaptor-related protein complex 1; gamma 0.21 108931 AA147186 Hs.250746 ESTs 0.22 131421 X64177 Hs.2667 mefallothionein 1H 0.22 107295 T34527 Hs.80120 UDP-N-acetyl-alpha-D-galactosamine:polyp 0.22 103576 226317 Hs.2631 desmoglein 2 0.22 105173 AA182030 Hs.8364 ESTs 0.22 134843 H60595 Hs.90061 progesterone binding protein 0.22 102009 U02680 Hs.82643 protein Tyrosine kinase 9 0.23 123991 D51171 Hs.78902 voltage-dependent anion channel 2 0.23 106609 AA458652 Hs.32181 ESTs 0.23 101300 L40391 Hs.6445 Homo Sapiens (clone s153) mRNA fragment 0.23 129717 AA481670 Hs.12150 ESTs; Weakly similar to retinal short-ch 0.23 108565 AA085342 Hs.1526 ATPase; Ca++transporting; cardiac muscl 0.23 121314 AA402799 Hs.182538 ESTs 0.23 124803 845480 Hs.164866 cyclin K 0.23 130208 AA620556 Hs.15250 peroxisomal D3;D2~noyl-CoA isomerase 0.23 132888 AA490775 Hs.5920 UDP-N-acetylglucosamine-2-epimeraselN-ac 0.23 132720 269881 Hs.5541 ATPase; Ca++transporting; ubiquitous 0.23 102239 U26726 Hs.1376 hydroxysteroid (11-beta) dehydrogenase 2 0.23 115764 AA421562 Hs.91011 anterior gradient 2 (Xenepus laevis) hom 0.24 130558 H96654 Hs.15984 ESTs; Weakly similar to gene pp21 protei 0.24 122666 AA455052 Hs.99387 ESTs 0.24 134495 D63477 Hs.84087 KIAA0143 protein 0.24 124017 F02202 Hs.100960 ESTs 0.24 106925 AA491261 Hs.37558 Homo Sapiens clone 23923 mRNA sequence 0.24 115187 AA261805 Hs.44021 ESTs 0.24 105309 AA233790 Hs.4104 ESTs; Weakly similar to cDNA EST yk386g7 0.24 124457 N50114 Hs.128704 ESTs 0.24 130616 AA233763 Hs.16726 Homo Sapiens mRNA; cDNA DKFZp564A132 (fr 0,25 105795 AA369245 Hs.17448 ESTs; Weakly similar to !!!! ALU SUBFAMI 0.25 134579 N23222 Hs.85963 CD36 antigen (collagen type I receptor, 0.25 Table 13: H chip - Met vs Normal query - up in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn UniG_ID Complete_Tftle Ratio MetINormal 102193 020758 Hs,313 secreted phosphoprotein 1 (osteopontin; 8.457 111307 N73988 Hs.37477 ESTs; Weakly similar to CGI-141 protein 6.05 103119 X63629 Hs.2877 cadherin 3; P-cadherin (placental) 5.207 131564 AA491465 Hs.28792 ESTs 5.136 119729 W69747 Hs.94806 KIAA1062 protein 4.667 124059 F13673 Hs.99769 ESTs 4.398 123987 C21171 Hs.95497 ESTs; Weakly similar to GLUCOSE TRANSPOR 4.292 128817 N47524 Hs.28491 spermidine/spermine N1-acetyltransferase 3.964 133770 M69197 Hs.242279 haptoglobin-related protein 3.823 130412 AA406554 Hs.241572 golgi autoan6gen; golgin subfamily a; 5 3.719 104755 AA024482 Hs.9029 DKFZP434G032 protein 3.702 132676 AA283035 Hs.54813 ESTs 3.645 134453 X70683 Hs.83484 SRY (sex determining region Y)-box 4 3.581 124690 805818 Hs.173830 ESTs 3.446 106949 AA496805 Hs.177425 KIAA0964 protein 3.42 130724 AA370091 Hs.179680 ESTs 3.402 128992 849693 Hs.107708 ESTs 3.32 133421 AA436560 Hs.7327 claudin 1 3.255 103047 X55990 Hs.73839 ribonuclease; RNase A family; 3 (eosinop 3.229 102990 X51441 Hs.181062 serum amyloid A1 3.149 115429 AA284139 Hs.89295 EST 3.114 129158 J05257 Hs.109 dipeptidase 1 (renal) 3.019 123533 AA608751 Hs.244904 ESTs; Weakly similar to !!!1 ALU SUBFAMI 3.011 Table 14: H chip - Met vs Normal query - down in Mets Pkey: Unique Eos probeset identitier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title PkeyY Ex Accn UniG_ID Complete_Title Ratio MetINormal 103466 Y00339 Hs.155097 carbonic0.012 anhydrase II

104258 AF007216 Hs.5462 solute 0.025 camerfamily 4; sodium bicarbon 108999 AA156064 Hs.72115 ESTs 0.034 101046 K01160 Accession not listed0.041 in Genbank 133565 H57056 Hs.204831 ESTs 0.042 101346 L76465 Hs.77348 hydroxyprostaglandin0.043 dehydrogenase 15-(N

102095 011313 Hs.75760 sterol 0.054 carrier protein 2 111855 837362 Hs.21351 ESTs 0.055 130320 019495 Hs.237356 stromal 0.058 cell-derived factor 1 123137 AA487468 Hs.100686 ESTs; 0.06 Weakly similar to secreted cement 107222 D51235 Hs.82689 tumor 0.06 rejection antigen (gp96) 1 102638 067319 Hs.9216 caspase 0.063 7; apoptosis-related cysteine pr 128906 AA487557 Hs.10706 ESTs 0.065 129105 AA224351 Hs.108681 ESTs 0.069 110837 N30796 Hs.17424 ESTs; 0.069 Weakly similar to semaphorin F [H.

100116 D00654 Hs.77443 actin; 0.071 gamma 2; smooth muscle; enteric 116786 H25836 Hs.83429 tumor 0.074 necrosis factor (ligand) superfami 130867 J04093 Hs.2056 UDP glycosyltransferase0.075 132836 F09557 Hs.57929 slit (Drosophila)0.076 homolog 3 131861 D11925 Hs.184245 KIAA09290.081 protein Msx2 interacting nuclea 106674 AA461303 Hs.7946 DKFZP586D15190.084 protein 109272 AA195718 Hs.86030 ESTs 0.088 132711 N73702 Hs.238927 ESTs 0.091 106569 AA455983 Hs.117816 sorcin0.092 104636 AA004415 Hs.106106 ESTs 0.093 118823 N79237 Hs.50813 ESTs; 0.094 Weakly similar to long chain fatty 134534 X73501 Hs.84905 H. Sapiens0.095 mRNA for cytokeratin 20 119479 W32094 Hs.55501 ESTs 0.096 113778 W15263 Hs.5422 ESTs 0.098 128482 083908 Hs.100407 programmed0.102 cell death 4 124653 N92884 Hs.109641 ESTs 0.106 133407 AA093348 Hs.7306 secreted0.108 frizzled-related protein 1 135237 AA454930 Hs.9691 ESTs 0.109 116250 AA480975 Hs.44829 ESTs 0.111 132617 AA171913 Hs.5338 carbonic0.112 anhydrase XII

131273 AA421139 Hs.173542 ESTs 0.113 116710 F10577 Hs.70312 ESTs 0.114 131791 S71043 Hs.32225 immunoglobulin0.114 alpha 1 112483 866534 Hs.28403 ESTs 0.115 132017 W67251 Hs.37331 Homo sapiens vav 3 oncogene (VAV3) mRNA0.116 124308 H93575 Hs.227146 Homo (fr 0.117 sapiens mRNA; cDNA DKFZp564J

114846 AA234929 Hs.44343 ESTs 0.119 116551 D20458 Hs.229071 EST 0.12 105299 AA233511 Hs.194720 ATP-binding0.122 cassette; sub-family G (WHIT

130366 L11708 Hs.155109 hydroxysteroid0.122 (17-beta) dehydragenase 2 133806 M12759 Hs.76325 Human 0.122 Ig J chain gene 104776 AA026349 Hs.31412 ESTs 0.125 129565 X77777 Hs.198726 vasoactive0.125 intestinal peptide receptor 131272 AA423884 Hs.139033 paternally0.127 expressed gene 3 105774 AA348014 Hs.23412 ESTs 0.128 134604 M22995 Hs.865 RAP1A; member0.128 of RAS oncogene family 134711 X04011 Hs.88974 cytochrome0.128 b-245; beta polypeptide (chro 129113 AA147646 Hs.108740 DKFZP586A05220.133 protein 123995 D51119 Hs.100090 tetraspan0.133 129168 T90621 Hs.109052 chromosome0.133 14 open reading frame 2 123891 AA621103 Hs.99216 ESTs; 0.135 Moderately similar to !!!! ALU
SUB

132694 M60830 Hs.5509 ecotropic 0.135 viral integration site 2B

135342 W60097 Hs.99120 DEADIH 0.135 (Asp-Glu-Ala-AspIHis) box polypep 131510 AA207114 Hs.27842 ESTs; 0.137 Weakly similar to similar to 1-acy 133652 AA287383 Hs.7540 ESTs 0.137 134749 L10955 Hs.89485 carbonic 0.139 anhydrase IV

106586 AA456598 Hs.256269 ESTs 0.139 106893 AA489636 Hs.25253 ESTs 0.139 101070 L02785 Hs.1650 down-regulated in adenoma 0.14 114293 240718 Hs.20196 adenylate cyclase 9 0.14 113966 W86600 Hs.9842 ESTs 0.141 101185 L19872 Hs.170087 aryl hydrocarbon receptor 0.145 131492 AA393876 Hs.1255 nuclear receptor subfamily 2; group F; m 0.145 133889 AA099391 Hs.211582 myosin; light polypeptide k!nase 0.145 120914 AA377254 Hs.97107 EST 0.147 118771 N74690 Hs.50547 ESTs 0.149 105496 AA256323 Hs.25264 DKFZP434N126 prote!n 0.151 131011 841771 Hs.22146 ESTs 0.153 106210 AA428239 Hs.10338 ESTs 0.154 114069 238161 Hs.197335 plasma glutamate carboxypeptidase 0.154 133011 AA042990 Hs.171921 sema domain; immunoglobulin domain (Ig); 0.154 115967 AA446887 Hs.42911 ESTs 0.154 102571 U60115 Homo Sapiens skeletal muscle LIM-protein 0.155 100687 HG3115-HT3291 Golli-Mbp (Gb:L18862) 0.155 132903 AA235404 Hs.5985 Homo Sapiens clone 25186 mRNA sequence 0.155 125832 AA628600 Hs.117587 ESTs 0.155 130064 T67053. Hs.181125 immunoglobulin lambda gene cluster 0.157 123264 AA491003 Hs.99824 BCE-1 protein 0.159 130919 AA291710 Hs.21276 collagen; type IV; alpha 3 (Goodpasture 0.159 103542 211793 Hs.3314 selenoprotein P; plasma;1 0.161 101478 M23379 Hs.758 RAS p21 protein activator (GTPase activa 0.162 108921 AA142913 Hs.71721 ESTs 0.164 100642 HG2743-HT3926 Caldesmon 1, Alt. Splice 6, Non-Muscle 0.167 132109 AA599801 Hs.40098 ESTS 0.167 115719 AA416997 Hs.59622 ESTs 0.169 128915 C02386 Hs.107139 ESTs 0.171 117634 N36421 Hs.107854 ESTs; Weakly similar to SODIUM-AND CHLO 0.172 129462 D84239 Hs.111732 IgG Fc b!nding protein 0.174 131328 V01512 Hs.25647 v-fos FBJ murine osteosarcoma viral onto 0.176 130343 AA490262 Hs.15485 ESTs; Weakly similar to APICAL-LIKE PROT 0.177 115764 AA421562 Hs.91011 anterior gradient 2 (Xenepus laevis) hom 0.177 122261 AA436830 Hs.98902 ESTs 0.179 106605 AA457718 Hs.21103 Homo sap!ens mRNA; cDNA DKFZp564B076 (fr 0.179 109991 H09813 Hs.12896 KIAA1034 prote!n 0.181 101300 L40391 Hs.6445 Homo sapiens (clone s153) mRNA fragment 0.181 123080 AA485303 Hs.205126 polymeric immunoglobulin receptor 0.182 130016 AA055811 Hs.143131 transmembrane glycoprotein 0.186 122666 AA455052 Hs.99387 ESTs 0.188 105453 AA252893 Hs.9001 ESTs 0.189 108980 AA151676 Hs.33455 peptidyl arginine deiminase; type II 0.19 100248 D31888 Hs.78398 KIAA0071 prote!n 0.192 130036 AA195260 Hs.206738 ESTs; Moderately similar to !!!! ALU SUB 0.192 110882 N36001 Hs.17348 ESTs; Weakly similar to i!!1 ALU SUBFAMI 0.193 131676 C20785 Hs.30514 ESTs 0.195 111029 N54792 Hs.24697 cytidine monophosphate-N-acetylneuramini 0.196 131257 AA256042 Hs.24908 ESTs 0.196 133348 T23517 Hs.7149 ESTs 0.196 133784 AA214305 Hs.76173 ESTs 0.196 113863 W68388 Hs.21288 ESTs; Weakly similar to KIAA0704 protein 0.197 103158 X67235 Hs.118651 hematopo!etically expressed homeobox 0.198 102347 U37518 Hs.83429 tumor necrosis factor (ligand) superfami 0.2 111351 N90223 Hs.23392 ESTs 0.2 123495 AA599850 Hs.106747 ESTs; Weakly similar to similar to BPTII 0.2 123802 AA620448 Hs.61408 Homo Sapiens clone 24760 mRNA sequence 0.2 129243 H88033 Hs.109727 KIAA0733 protein 0.2 130219 877539 Hs.15285 ESTs 0.2 131171 H04644 Hs.167619 ESTs; Weakly similar to !!!! ALU SUBFAMI 0.2 133746 U44378 Hs.75862 MAD (mothers against decapentapleg!c; Dr 0.2 116459 AA621399 Hs.64193 ESTs 0.201 109613 F03031 Hs.27519 ESTs 0.202 133435 T23983 Hs.7365 ESTs 0.202 103002 X52001 Hs.1408 endothelin 3 0.204 125153 W38294 Accession not listed in Genbank 0.204 131919 AA121266 Hs.34641 ESTs 0.204 100749 HG3521-HT3715 Ras-Related Protein Rap1b 0.205 105085 AA147537 Hs.4811 ESTs 0.208 124571 N67470 Hs.173074 DKFZP56401863 protein 0.21 129519 AA298786 Hs.112242 ESTs ' 0.21 116724 F13665 Hs.65641 ESTs 0.21 132932 T15482 Hs.6093 ESTs 0.21 113803 W42789 Hs.31446 ESTs 0.211 110792 N24899 Hs.6630 ESTs 0.212 105178 AA187490 Hs.21941 ESTs 0.212 107295 T34527 Hs.80120 UDP-N-acetyl-alpha-D~galactosamine:polyp 0.212 115262 AA279112 Hs.88594 ESTs 0.213 115839 AA429038 Hs.40541 ESTs 0.213 103211 X73079 Hs.205126 polymeric immunoglobulin receptor 0.214 108604 AA099820 Hs.49696 ESTs 0.215 105173 AA182030 Hs.8364 ESTs 0.217 108539 AA084677 Hs.54558 ESTs; Weakly similar to protein B [H.sap 0.217 109984 H09594 Hs.10299 ESTs 0.217 133536 Y00264 Hs.177486 amyloid beta {A4) precursor protein (pro 0.217 129965 T71333 Hs.13854 ESTs 0,219 114542 AA055768 Hs.122576 ESTs 0.219 132982 L02326 Hs.198118 immunoglobulin lambda-like polypeptide 2 0.22 101809 M86849 Homo Sapiens connexin 26 (GJB2) mRNA, co 0.222 105795 AA369245 Hs.17448 ESTs; Weakly similar to II!! ALU SUBFAMI 0.222 132119 H99211 Hs.40334 ESTs 0.222 132733 825385 Hs.123654 KIAA0824 protein 0.222 109415 AA227219 Hs.110826 trinucleoGde repeat containing 9 0.222 113083 T40530 Hs.8241 ESTs; Weakly similar to heat shock prote 0.223 107053 AA600147 Hs.5741 ESTs; Weakly similar to NADH-cytochrome 0.224 103653 270295 Hs.32966 guanylate cyclase activator 2B (uroguany 0.225 104613 AA001049 Hs.24713 Homo Sapiens mRNA; cDNA DKFZp586G0123 (f 0.225 126180 818070 Hs.3712 ubiquinol-cytochrome c reductase; Rieske 0.227 132015 D11900 Hs.3731 ESTs 0.227 130616 AA233763 Hs.16726 Homo sapiens mRNA; cDNA DKFZp564A132 (fr 0.227 132883 AA047151 Hs.5897 Homo Sapiens mRNA; cDNA DKFZp586P1622 (f 0.23 123169 AA488892 Hs.104472 ESTs; Weakly similar to Gag-Pol polyprot 0.233 115187 AA261805 Hs.44021 ESTs 0.234 116787 H28581 Hs.15641 ESTs 0.234 113195 T57112 yc20g11.s1 Stratagene lung (#937210) Hom 0.235 130707 W45457 Hs.203559 ESTs 0.235 124803 845480 Hs.164866 cyclin K 0.235 116844 H64938 Hs.38331 ESTs 0.235 102759 081607 Hs.788 A kinase {PRKA) anchor protein (gravin) 0.238 130584 AA009839 Hs.180841 tumor necrosis factor receptor superfami 0.238 133240 D31161 Hs.68613 ESTs 0.238 132952 AA425154 Hs.61426 ESTs 0.239 132720 269881 Hs.5541 ATPase; Ca++transporting; ubiquitous 0.24 131734 D62965 Hs.31297 ESTs 0.24 111890 836678 Hs.12365 ESTs 0.241 102325 035139 Hs.50130 necdin {mouse) homolog 0.244 104968 AA084602 Hs.29669 ESTs 0.244 105674 AA284755 Ns.214742 CDW52 antigen {CAMPATH-1 antigen) 0.244 120519 AA258585 Hs.129887 cadhedn 19 (NOTE: redefinition of symbo 0.244 134675 AA250745 Hs.87773 protein kinase; CAMP-dependent; catalyti 0.244 130642 M63438 Hs.156110 Immunoglobulin kappa variable 1D-8 0.245 134418 878190 Hs.82933 ESTs; Weakly similar to cDNA EST EMBL:TO 0.245 115137 AA257976 Hs.56156. ESTs 0.245 131713 X57809 Hs.181125 immunoglobulin lambda gene cluster 0.246 108931 AA147186 Hs.250746 ESTs 0.246 106609 AA458652 Hs.32181 ESTs 0.248 115559 AA393810 Hs.41067 ESTs 0.25 133985 L34657 Hs.78146 plateletlendothelial cell adhesion molec 0.25 134088 D43636 Hs.79025 KIAA0096 protein 0,25 134487 838185 Hs.83954 Homo Sapiens unknown mRNA 0.25 Table 15: I chip - Met vs Normal query - up in Mets Pkey: Unique Eos pmbeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey E~Accn UniG_ID Title Ratio MetINormal 319379 Hs.193963 ESTs 18.71 321920 EST cluster (not in 11.9 N63915 UniGene) 314522 Hs.187750 ESTs; Moderately7.23 A1732331s!milar to 1!!1 ALU
CLA

315720 Hs.163900 ESTs 6.06 308010 Hs.181165 eukaryotic 5.76 AI439190translation elongation factor 313774 Hs.144583 ESTs 5.01 300734 Hs.240951 ESTs 3.98 337895 CH22 EM:AC005500.GENSCAN.56-23.98 312339 EST cluster (not in 3.66 AA524394UniGene) 331644 Hs.173734 ESTs; Weakly 3.53 T99544 s!milar to !!!! ALU
CLASS B

324643 Hs.130729 ESTs 3.52 324302 Hs.136806 ESTs; Weakly 3.41 AA543008similar to !!!! ALU
SUBFAMI

314912 Hs.161784 ESTs 3.33 319403 EST cluster (not in 3.32 T98413 UniGene) 308676 EST singleton (not in 3.27 AI761036UniGene) with exon 331858 Hs.163848 ESTs 3.22 315178 Hs.162459 ESTs 3.21 321354 EST cluster (not !n 3.18 AA078493UniGene) 337898 CH22_EM:AC005500.GENSCAN.56-53.16 322682 EST cluster (not in 3.15 AI110679UniGene) 313197 Hs.222487 ESTs 3.1 308991 EST singleton (not in 3.08 AI879831UniGene) with exon 310016 Hs.152475 ESTs 3.05 Table 16: I chip - Met vs Normal query - down in Mets Pkey: Unique Eos pmbeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex~4ccn UniG_ID title Ratio MetINormal 303041 EST cluster (not in UniGene)0.02 AF127035with exon h 302360 Hs.198267 mucin 4; tracheobronchial0.03 301948 Hs.116724 aldo-keto reductase0.03 AA344647family 1; member B11 336091 CH22-FGENES.689 3 0.04 333657 CH22-FGENES.241 2 0.04 333658 CH22 FGENES.241 4 0.04 333737 CH22_FGENES.261 1 0.05 333656 CH22_FGENES.240 4 0.05 302347 Hs.194659 chloride channel;0.06 AF039400calcium activated; fam 336084 CH22_FGENES.688_13 0.06 330385 Hs.31386 ESTs; Highly 0.06 AA449749similar to secreted apoptos 304487 EST singleton (not in 0.07 AA434241UniGene) with exon 302292 EST cluster (not in UniGene)0.07 AF067797with exon h 334030 CH22-FGENES.320 2 0.07 332859 CH22_FGENES.27_2 0.07 333654 CH22_.FGENES.240_2 0.07 303270 Hs.105352 ESTs 0.08 320352 Hs.145296 disintegrin 0.08 Y13323 protease 333637 CH22_FGENES.229 2 0.08 324094 EST cluster (not in UniGene)0.08 320590 Hs.168102 Human proteinase0.08 067058 activated receptor-2 mR

330622 Hs.2996 sucrase-isomaltase0.08 331441 Hs.39720 ESTs 0.08 308601 EST singleton (not in 0.09 AI719930UniGene) with exon 323770 EST cluster (not in UniGene)0.09 335188 CH22 FGENES.507 3 0.09 333730 CH22_FGENES.258_1 0.09 304480 EST singleton (not in 0.09 AA430373UniGene) with exon 336081 CH22_FGENES.688_10 0.1 332071 Hs.112475 ESTs _ 0.1 318538 Hs.74034 caveolin 1; 0.1 N28625 caveotae protein; 22kD

311331 Hs.32225 immunoglobulin 0.1 AI679622alpha 1 319668 1 EST cluster (not in 0.11 NM_00273UniGene) 332567 Hs.25647 v-fos FBJ murine0.11 N23730 osteosarcoma viral onto 319395 Hs.13809 ESTs 0.11 315594 Hs.155145 ESTs 0.11 321539 Hs.62461 ARP2 (actin-related0.12 N98619 protein 2; yeast) ho 333647 CH22_FGENES.235 2 0.12 333588 CH22_FGENES,206 2 0.12 321286 EST cluster (not in UniGene)0.12 320727 EST cluster (not in UniGene)0.13 335687 CH22_FGENES.596-2 0.13 324611 Hs.165337 ESTs 0.14 335115 CH22_,FGENES.496 2 0.14 324660 Hs.186044 ESTs 0.14 337951 CH22_EM:AC005500.GENSCAN.94-10.14 302332 Hs.184507 Homo sapiens AI833168Chromosome 16 BAC clone CIT 0.14 300921 Hs.232165 ESTs 0.14 333646 CH22_FGENES.234 2 0.14 335116 CH22_FGENES.496 3 ~ 0.14 320211 Hs.125783 DEME-6 protein0.15 336092 CH2~FGENES.689 6 0.15 330673 Hs.92962 Sec23 (S. cerevisiae)0.16 D57823 homolog A

303042 EST cluster (not in UniGene)0.16 AF129532with exon h 337954 CH22_EM:AC005500.GENSCAN.9630.16 336645 CH22 FGENES.26-1 0.16 335651 CH22_FGENES.590_2 0.16 314499 Hs.147975 ESTs 0.17 336124 CH22_FGENES.701 9 0.17 315199 Hs.125376 ESTs 0.17 324525 Hs.196284 ESTs 0.17 320825 1 EST cluster (not in 0.18 NM_00475UniGene) 302049 Hs.129792Homo sapiens ChromosomeCIT 0.18 AA377072 16 BAC clone 336083 CH22_FGENES.688_120.18 333653 CH22 FGENES.239 0.18 323243 EST cluster (not 0.19 W44372 in UniGene) 316610 Hs.126731ESTs 0,19 315033 Hs.146133ESTs 0.19 330551 Hs.105440hepatocyte nuclearfactor3;0.19 U39840 alpha 333642 CH22_FGENES,231 0,19 301281 Hs.190586ESTs 0.2 333626 CH22_FGENES,224 0.21 303792 Hs.199839ESTs; Highly similar0.21 C75094 to NG22 [H.sapiens]

332325 Hs.191264ESTs 0,21 321223 EST cluster (not 0.21 AA431366 in UnIGene) 333635 CH22_FGENES.228 0.22 314645 Hs.207570ESTs 0.22 322929 Hs.146246ESTs 0.22 324718 Hs.116467ESTs 0.22 335652 CH22_FGENES.590_3 0.22 307783 EST singleton (not0.22 AI347274 in UniGene) with exon 331344 Hs.70208ESTs 0.22 336088 CH22_FGENES.688_170.23 320802 Hs.185055BENE protein 0.23 335692 CH22_FGENES.596 0.23 333593 CH22_FGENES.210_2 0.23 335667 CH22_FGENES.590_180.24 314853 Hs.153279ESTs 0.24 320244 Hs.129778gastrointestinal 0.24 AA296922 peptide 300601 Hs.165619ESTs 0.24 305080 EST singleton (not0.25 AA641485 in UniGene) with exon 335189 CH22_FGENES.507 0.25 Table 17: B survivor vs Mets - Up in B survivor Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit-ID Complete Title Ratio BSIMet 101006 J04132 Hs.97087 CD3Z antigen; zeta polypeptide (TT3 com 7.28 114173 239050 Hs.21963 ESTs 6.13 130284 X82206 Hs.153961 ARP1 (actin-related protein 1; yeast) ho 5.77 100787 HG3872-HT4142 Immunoglobulin Gamma Heavy Chain, V(6)Djc Regions (Gb:U13200) 5.63 132461 AA405775 Hs.49005 hypothetical protein 5.62 133806 M12759 Hs.76325 Human Ig J chain gene 5.46 133747 086972 Hs.75863 KIAA0218 gene product 5.45 ' 123328 AA496968 Hs.105403 EST 5.28 132671 X76302 Hs.54649 putative nucleic acid binding protein RY 5.25 132018 AA293194 Hs.3737 ESTs 5.22 100186 017516 Hs.4748 adenylate cyclase activating polypeptide 5.14 107155 AA621202 Hs.7946 DKFZP586D1519 protein 5.1 103566 222555 Hs.180616 CD36 antigen (collagen type I receptor, 5.06 113355 T79203 Hs.14480 ESTs 4.99 129040 038864 Hs.108139 zinc finger protein 212 4.96 130214 H78003 Hs.15266 ESTs 4.93 129550 AA480991 Hs.113025 ESTs 4.92 129704 W81301 Hs.12064 ubiquitin specific protease 22 4.91 116425 AA609574 Hs.51483 ESTs 4.77 105166 AA179787 Hs.30570 polyglutamine binding protein 1 4.65 118765 N74442 Hs.183696 ESTs 4.6 108999 AA156064 Hs.72115 ESTs 4.57 112756 893908 Hs.35258 ESTs 4.54 111655 816884 Hs.187462 ESTs 4.48 119392 T90672 Hs.238859 ESTs 4.42 131957 AA609008 Hs.183232 ESTs 4.41 129275 082061 Hs.109993 Ke6 gene; mouse; human homolog of 4.4 113634 T95085 Hs.125182 ESTs 4.4 127187 AA297138 Hs.207422 ESTs 4.32 101147 L13266 Hs.105 glutamate receptor, ionotropic; N-methyl 4.3 134901 S78873 Hs.90875 RAB interacting factor 4.26 100896 HG4593-HT4998 Sodium Channel 1 4.24 100687 HG3115-HT3291 Golli-Mbp (Gb:L18862) 4.21 129758 AA599552 Hs.183770 Homo Sapiens mRNA; cDNA DKFZp566P2346 (f 4.19 105440 AA252243 Hs.22851 ESTs 4.16 131551 AA127867 Hs.28608 ESTs 4.15 113761 T99373 Hs.189786 ESTs 4.09 105897 AA401091 ESTs 4.07 129495 AA382529 Hs.239676 ESTs 4.06 103436 X98206 H.sapiens mRNA for UV-B repressed sequen 4.03 104673 AA007633 Hs.20010 ESTs 4.03 128886 L36720 Hs.106880 bystin-like 4.02 100702 HG3236-HT3413 Neurofibromatosis 2 Tumor Suppressor (Gb:L27065) 3.99 123547 AA608820 Hs.124085 KIAA0921 protein 3.98 134877 AA455241 Hs.90527 ESTs 3.97 123650 AA609332 Hs.180696 ESTs 3.94 106482 AA451672 Hs.108824 ESTs; Weakly similar to cDNA EST yk415c1 3.94 101909 S69265 Homo Sapiens mRNA for PLE21 protein; com 3.93 108390 AA075070 zm86b6.s1 Stratagene ovarian cancer (#93 LYMPHOCYTE ANTIGEN LY-6A.21LY-6E.1 PREC 3.93 135403 006643 Hs.99923 lectin; galactoside-binding; soluble; 7 3.89 121038 AA398536 Hs.97365 ESTs 3.88 128496 T83496 Hs.100610 ESTs 3.86 108785 AA128946 ESTs 3.86 119838 W79499 Hs.58580 ESTs 3.85 130109 L12060 Hs.1497 retinoic acid receptor, gamma 3.84 134538 079288 Hs.85053 KIAA0513 gene product 3.83 110310 H38209 Hs.32728 EST 3.81 110433 H49425 Hs.32992 ESTs 3.78 111834 836138 Hs.152458 ESTs 3.76 130903 N27086 Hs.21068 ESTs 3.74 105142 AA164851 Hs.15380 ESTs; Weakly similar to HERV-E envelope 3.73 130248 084569 Hs.153452 chromosome3.73 21 open reading frame 2 130645 AA020942 Hs.17200 STAM-like3.73 protein containing SH3 and ITA

123378 AA521043 Hs,185832 ESTs 3.73 103985 AA313880 EST185737 Colon 3.73 carcinoma (NCC) cell lin 112397 860822 Hs.26805 EST 3.72 100980 J03069 Hs.72931 v-myc 3.72 avian myelocytomatosis viral oncog 102609 064863 Hs.158297 programmed3.7 cell death 1 108974 AA151402 Hs.46531 ESTs 3.7 130192 Y12661 Hs.171014 VGF nerve3.69 growth factor inducible 131318 X51699 Hs.2558 bone gamma-carboxyglutamate3.68 (gla) protei 113759 T99364 Hs.16074 Homo sapiens(fr 3.66 mRNA; cDNA DKFZp5641153 133712 L19267 Hs.198836 dystrophia3.65 myotonica-containing WD repea 134229 815108 Hs.8037 ESTs 3.65 134241 AA300265 Hs.80540 KIAA01953.65 gene product 124699 806413 Hs.112278 arestin;3.62 beta 1 107343 003115 Hs.103945 Human 3.62 V beta T-cell receptor (TCRBV) gen 128511 AA425636 Hs.10082 potassium3.62 intermediatelsmall conductance 105466 AA253412 Hs.21489 ESTs 3.61 131377 841389 Hs.26159 ESTs 3.6 119135 849548 Hs.169681 death 3.6 effector domain-containing 132982 L02326 Hs.198118 immunoglobulin3.59 lambda-like polypeptide 2 128514 H84261 Hs.100843 ESTs; 3.56 Weakly similar to similar to GTP-b 102396 041804 Hs.54411 putative 3.55 T11ST2 receptor binding protein 134945 850247 Hs.91600 ESTs 3.55 134913 X60483 Hs.91031 H4 hislone3.54 family; member D

102053 007664 Hs.37035 homeo 3.52 box HB9 121569 AA412686 Hs.97955 ESTs 3.52 132560 AA005315 Hs.204524 ESTs; 3.51 Weakly similar to KIAA0747 protein 118456 N66580 Hs.161496 EST; 3.51 Weakly similar to HC1 ORF [M.muscul 111518 808160 Hs.222529 ESTs; 3.51 Weakly similarto !!Il ALU SUBFAMI

116795 H38858 Hs.251783 EST 3.5 130377 AA378316 Hs.155182 KIAA10363.5 protein ~

121774 AA421758 Hs.98361 ESTs 3.49 123413 AA521448 Hs.103845 ESTs 3.49 133798 AA444115 Hs.76277 ESTs; 3.49 Weakly similar to salivary proline 135183 X93996 Hs.239663 myeloidllymphoid3.48 or mixed-lineage leukem 132479 AA477715 Hs.4953 golgi 3.47 autoantigen; golgin subfamily a; 3 117191 H99394 Hs.40339 EST 3.47 130942 X87852 Hs.21432 H.sapiens3.46 mRNA for SEX gene 130700 D55696 Hs.18069 protease;3.43 cysteine;1 (legumain) 131301 T17386 Hs.164501 ESTs 3.43 100818 HG4018-HT4288 Opioid-Binding3.43 Cell Adhesion Molecule 103393 X94612 Hs.41749 protein 3.43 kinase; cGMP-dependent; type II

131337 AA228116 Hs.170204 KIAA05513.42 protein 133403 X68688 Hs.72991 zinc finger3.42 protein 33b (KOX 31 ) 124728 816231 Hs.106620 Homo 3.41 sapiens clone 23950 mRNA sequence 123168 AA488881 Hs.105218 EST 3.39 123324 AA496932 Hs.105399 KIAA08093.38 protein 106947 AA496685 Hs.37936 suppressor3.38 of variegation 3-9 (Drosophil 116717 F11065 Hs.79363 ESTs 3.36 102794 088629 Hs.173334 ELL-RELATED 3.34 RNA POLYMERASE II; ELONGATIO

117503 N31963 Hs.44286 ESTs 3.33 112220 850295 Hs.25703 ESTs 3.33 106340 AA441792 Hs.22857 chord 3.33 domain-containing protein 1 106308 AA436186 Hs.30662 ESTs 3.32 130894 D16105 Hs.210 leukocyte 3.31 tyrosine kinase 120039 W92548 Hs.94985 ESTs 3.31 131428 017838 Hs.26719 PR domain3.3 containing 2; with ZNF domain 113285 T66830 Hs.182712 ESTs 3.3 109458 AA232648 Hs.87068 ESTs 3.29 132134 AA242904 Hs.40637 proline-rich3.29 Gla (G-carboxyglutamic acid 118964 N93330 Hs.54937 Homo sapiensp 3.29 clone 24722 unknown mRNA;

127621 AI218205 Hs.116204 ESTs 3.29 135149 040002 Hs.95351 lipase; 3.28 hormone-sensitive 114371 241835 Hs.27810 ESTs 3.28 130043 AA055404 Hs.193953 ESTs; 3.27 Weakly similar to 1!!! ALU SUBFAMI

121347 AA405181 Hs.97972 ESTs 3.25 105754 AA302657 Hs.192028 ESTs 3.25 121327 AA404286 Hs.173125 peptidylprolyl3.25 isomerase F (cyclophilin 111204 N68295 Hs.37982 ESTs 3.25 120949 AA397830 Hs.98347 ESTs; 3.25 Weakly similar to GLIOMA PATHOGENE

130024 015197 Hs.241560 Human histo-blood group ABO protein mRNA 3.24 125005 T61449 Hs.193727 ESTs 3.24 121067 AA398662 Hs.97302 ESTs 3.24 120996 AA398281 Hs.143684 ESTs 3.23 117101 H94043 Hs.24341 DKFZP586114193.23 protein 130708 040490 Hs.18136 nicotinamide nucleotide transhydrogenase 3.23 130270 L40399 Hs.153820 hypothetical protein 3.22 131605 AA256220 Hs.29383 ESTs 3.22 100854 HG4194-HT4464 SodiumlHydrogenExchanger5 3.22 123026 AA481072 Hs.99743 ESTs 3.21 108328 AA070204 zm68b3.s1 Stratagene neuroepithelium (#9 3.2 104259 AF007833 Hs.159265 Homo sapiens kruppel-related zinc finger 3.2 133711 J04130 Hs.75703 small inducible cytokine A4 (homologous 3.2 112261 852145 Hs.25894 ESTs; Highly similar to hypothetical pro 3.19 119529 W38053 Accession not listed in Genbank 3.19 122386 AA446221 Hs.6092 F-box protein containing leucine-rich re 3.19 109157 AA179161 Hs.73562 ESTs 3.19 119903 W85707 Hs.75936 erythrocyte membrane protein band 4.9 (d 3.18 127452 AA491317 aa65c01.r1 NCI_CGAP_GCB1 Homo Sapiens cD 3.18 124229 H62793 Hs.221892 ESTs 3.18 129221 AA417126 Hs,109571 translocase of inner mitochondrial membr 3.17 133185 AA481404 Hs.6686 ESTs 3.16 121479 AA411911 Hs.98110 ESTs 3.16 133872 779868 Hs.180903 hypothetical protein 3.16 132504 012897 Hs.5022 imprinted in Prader-Willi syndrome 3.16 103089 X60382 Hs.179729 collagen; type X; alpha 1 (Schmid metaph 3.15 129654 AA019943 Hs.118463 H.sapiens mRNA for unknown liver orphan 3.15 117295 N22360 Hs.43153 ESTs 3.15 107349 048224 Hs.158321 beaded filament structural protein 2; ph 3.14 103451 X99459 Hs.154782 adaptor-related protein complex 3; sigma 3.14 114854 AA235056 Hs.120244 ESTs 3.14 121044 AA398551 Hs.97374 ESTs 3.13 128582 022963 Hs.101840 major histocompatibility complex; class 3.13 112598 878565 Hs.138395 EST 3.13 113170 754342 Hs.222506 ESTs 3.13 111714 823146 Hs.23466 ESTs 3.13 111809 833616 Hs.24688 EST 3.12 115249 AA278961 Hs.71124 ESTs 3.11 103228 X75546 Hs.230 fibromodulin 3.11 129944 L00389 Hs.1361 cytochrome P450; subfamily I (aromatic c 3.11 107927 AA028915 Hs.237709 EST 3.11 130297 H94949 Hs.171955 trophininassisting protein (tastin) 3.1 125742 H81181 Hs.183654 ESTs; Weakly similar to unknown [S.cerev 3.1 134802 L35546 Hs.89709 glutamate-cysteine ligase (gamma-glutamy 3.1 112560 872293 Hs.6179 Homo sapiens mRNA; cDNA DKFZp586K2322 (f 3.1 129266 AA343881 Hs.209061 sudD (suppressor of bimD6; Aspergillus n 3.09 126982 AA211419 small inducible cytokine A5 (RANTES) 3.09 131594 H29723 Hs.29261 ESTs; Weakly similarto serine protease 3.08 134910 AA431320 Hs.9100 ESTs 3.08 103505 Y09912 Hs.33102 transcription factorAP-2 beta (activati 3.08 110525 H57330 Hs.37430 EST 3.07 123276 AA491270 Hs.187946 ESTs 3.06 130519 H91819 Hs.10669 ESTs; Moderately similarto KIAA0400 [H. 3.06 126621 AA192638 zq01h08.r1 Stratagene muscle 937209 Homo 3.05 134327 AF006041 Hs.178743 death-associated protein 6 3.04 103513 Y10209 H.sapiens mRNA for CD3L protein 3.04 131243 816667 Hs.24752 spectrin SH3 domain binding protein 1 3.04 115187 AA261805 Hs.44021 ESTs 3.04 107543 243703 Hs.4552 Homo Sapiens HRIHFB2157 mRNA; partial cd3.04 134051 S67070 Hs.78846 heat shock 27kD protein 2 3.04 113461 786737 Hs.193536 ESTs 3.03 130490 X57522 Hs.158164 ATP-binding cassette; sub-family B (MDRI 3.03 128843 AA234141 Hs.203004 katanin p80 (WD40-containing) subunit B 3.03 100941 HG862-HT862 Transition Protein 2 3.03 122268 AA436855 Hs.178202 ESTs 3.02 107425 W26719 Hs.30204 ESTs ~ 3.02 130930 019261 TNF receptor associated factor 1 3.02 132958 W90398 Hs.6147 KIAA1075 protein 3.02 100973 J02888 Hs.73956 NAD(P)H menadione oxidoreductase 2; diox 3.01 104924 AA058532 Hs.28774 ESTs 3.01 129998 Y10055 Hs.162808 phosphoinositide-3-kinase; catalytic; de 3.01 130023 X13461 Hs.239600 calmodulin-like 3 3.01 129536 M33493 Hs.184504 tryptase; alpha 3 112015 842836 Hs.23198 ESTs 3 103036 X54925 Hs.83169 matrix metalloproteinase 1 (interstitial 2.99 100756 HG3565-HT3768 Zinc Finger Protein (Gb:M88357) 2.99 103425 X97301 H.sapiens mRNA for Ptg-11 protein 2.99 118291 N63076 Hs.138746 EST 2.98 125877 H15Z29 ym30g04.r1 Soares infant brain 1NI8 Homo repetitive element ;, mRNA sequence. 2.98 101371 M13232 Hs.36989 coagulation factor VII (serum prothrombi 2.98 102958 X15675 Hs.93174 Human endogenous retrovirus pHE.1 (ERV9) 2.97 121183 2.97 Hs.97703 ESTs 119241 Hs.221382 ESTs 2.96 115067 Hs.91299 postmeioticsegregation2.96 AA253458increased 2-like 126196 zn05g10.s1 Stratagene 2.96 AA084394hNT neuron (#93723 111642 Hs.128740 ESTs; Highly 2.95 816153 similarto DNb-5 [H.sapiens 100898 2.95 Spliceosomal Protein Sap 129370 Hs.110796 ESTs; Moderately2.94 AA287879similar to GTP-binding 128915 Hs.107139 ESTs 2.94 101868 Hs.82891 glutathione 2.94 M96233 S-transferase M4 124394 gamma2-adaptin 2.93 103559 Hs.75774 thrombospondin 2.93 107882 Hs.17801 ESTs; Moderately2.93 AA025630similar to serinelproli 134919 Hs.91142 KH-type splicing2.92 T99639 regulatory protein (FUS

110293 Hs.37165 collagen; type 2.92 H30258 IX; alpha 2 132433 . 2.92 AA082546Hs.48516 ESTs 127347 ESTs 2.92 121976 Hs.98632 ESTs . 2.91 133025 Hs.6318 ESTs; Highly 2.91 AA135492similar to peroxisomal shor 133413 Hs.73133 metallothionein2.91 S72043 3 (growth inhibitory far 111694 Hs.23331 ESTs 2.91 128369 Hs.205300 ESTs 2.9 102464 Hs.3828 mevalonate (diphospho)2.9 049260 decarboxylase 135358 Hs.99486 ESTs; Weakly 2.9 C21431 similar to aralarl [H.sapie 108661 Hs.65905 ESTs; Weakly AA113287similar to PTB-ASSOCIATED
S2.9 102185 Human guanyl cyclase 2.89 020230 C gene, partial cds 122071 Hs.98762 EST 2.89 102040 Hs.159479 galactosamine 2.89 006088 (N-acetyl)-6-sulfate sulfa 115689 Hs.199014 ESTs 2.88 135110 Hs.193788 nitric oxide 2.88 T15817 synthase 2A (inducible;
hep 118729 Hs.161526 EST 2.88 129518 Hs.112238 ESTs 2.88 125788 Hs.44499 small EDRK-rich2.87 874309 factor 2 128650 Hs.103124 ATPase; Ca++transporting;2.87 057971 plasma membra 125936 Hs.182859 lifeguard 2.87 100779 (Gb:L23566) HG3731-HT4001 2.87 Immunoglobulin Heavy Chain, Vdjrc Regions 104451 Hs.102119 blue cone pigment2.86 133539 Hs.74615 platelet-derived2.86 M21574 growth factor receptor;

119506 Hs.55563 ESTs 2.86 126568 zp85d12.r1 SUatagene 2.86 AA190515HeLa cell s3 93721 134184 Hs.79732 fibulin 1 2.86 127633 Hs.152733 potassium voltage-gated2.86 A1339609channel; Isk-rel 128716 Hs.173611 NADH dehydrogenase2.86 AA045978(ubiquinone) Fe-S pro 107135 Hs.23247 ESTs 2.85 117748 Hs.141858 ESTs 2.85 124030 Hs.151032 Homo Sapiens p 2.85 F04143 clone 23856 unknown mRNA;

135120 Hs.108300 NOT3 (negative2.84 AA449841regulator of transcriptio 102156 HSU17977 Humn fibroblastcDNA2.84 017977 H sapiens 129418 Hs.11127 PET112 (yeast 2.84 AA401401homology-like 103222 Hs.77171 minichromosome 2.84 X74795 maintenance deficient (S.

125145 Accession not listed 2.83 W38001 in Genbank 100560 2.83 Crystallin, Beta B

105370 Hs.22791 ESTs; Weakly 2.83 AA236476similar to transmembrane pr 127036 ESTs 2.83 128788 Hs.105685 ESTs 2.83 119523 Accession not listed 2.82 W38041 in Genbank ~

126436 Hs.211579 melanoma adhesion2.82 N31224 molecule 126559 Hs.170263 tumor protein 2.82 815866 53-binding protein;1 118183 Hs.48361 EST 2.82 101298 Hs.118633 2'-5'oligoadenylate2.81 L40387 synthetase-like 131830 Hs.32959 G protein-coupled2.81 033054 receptor kinase 2 (Dro 124173 Hs.107619 ESTs 2.81 102295 Homo Sapiens KIAA0421 2.81 032581 mRNA; partial cds 129719 Hs.167766 ESTs; Moderately2.81 N66396 similar to Pro-a2(XI) [

126573 Hs.155218 E18-55kDa-associated2.81 AA482023protein 5 125477 Hs.234642 aquaporin 3 2.81 106492 Hs.7922 ESTs; Weakly AA451896similarto contains similar p19; an RNA polymerise 2.8 II elongation fa 132881 Hs.58875 ESTs 2.8 114733 Hs.95734 ESTs 2.79 104618 Hs.186494 ESTs 2.79 134137 Hs.79347 KIAA0211 gene 2.79 F10045 product 133212 Hs.67846 leukocyte Ig-like2.78 082979 receptor, subfamily B

Immunoglobulin Heavy Chain, Vdjc Regions (Gb:L23564) 2.78 104756 Hs.15813 solute carrier 2.78 AA024622family 22 (organic ration 129861 Hs.129849 DKFZP564M182 2.78 N69507 protein 120824 AA347548 Hs.96876 ESTs 2.78 100684 HG3107-HT3283 Plasma Membrane Calcium Pump Hpmca2a 2.78 121789 AA423970 Hs.178111 ESTs 2.78 101647 M59941 Hs.118200 colony stimulating factor 2 receptor, be 2.78 113722 T97957 Hs.202948 ESTs; Weakly similar to alternatively sp 2.77 115107 AA256371 Hs.186645 ESTs 2.77 111464 805518 Hs.19521 ESTs 2.77 108446 AA079120 zm95e1.s1 Stratagene colon HT29 (#937221 2.77 123921 AA621329 Hs.250671 Hu DNA seq frm clone 1163J1 on chr 22q13 prot (similarto mouse Celsr1; rat MEGF 2.77 134445 M59488 Hs.83384 S100 calcium-binding protein; beta (neur 2.76 114132 238688 Hs.24192 ESTs 2.76 120500 AA256430 Hs.132525 ESTs 2.76 101860 M95610 Hs.37165 collagen; type IX; alpha 2 2.76 134430 H52105 Hs.8309 KIAA0747 protein 2.76 124152 H27216 Hs.107635 ESTs 2.76 132268 AA058833 Hs.23445 ESTs; Weakly smlr to similar to M. muscu 2.76 116257 AA481493 Hs.88537 ESTs 2.76 102438 U46570 Hs.7733 tetratricopep6de repeat domain 1 2.75 122393 AA446334 Hs.99064 ESTs 2.75 107653 AA010210 Hs.47041 ESTs 2.75 123674 AA609473 Hs.105187 ESTs; Moderately similarto kinesin like 2.75 129858 T66906 Hs.12970 ESTs 2.75 130117 U06641 Hs.150207 UDP glycosyltransferase 2 family; polype 2.75 133464 M13982 Hs.73917 interleukin 4 2.75 127039 AA233366 Hs.256491 ESTs 2.74 128318 AA418202 Hs.13810 ESTs 2.74 123363 AA504818 Hs.171279 ESTs 2.74 127654 AA649249 Hs.75640 natriuretic peptide precursorA 2.74 132067 L20860 Hs.178382 glycoprotein Ib (platelet); beta polypep 2.74 125664 AA948418 Hs.25744 ESTs; Weakly similar to Ydr412wp [S.cere 2.73 132354 L05187 Hs.211913 small proline-rich protein 1A 2.73 101568 M33764 Hs.75212 omithine decarboxylase 1 2.73 101438 M20777 Hs.159263 Homo Sapiens; alpha-2 (VI) collagen 2.73 116233 AA479082 Hs.61142 ESTs 2.73 122194 AA435882 Hs.97531 ESTs . 2.72 113995 W88466 Hs.22010 ESTs 2.72 124251 H68286 Hs.107924 ESTs 2.71 120583 AA281304 Hs.78614 complement component 1; q subcomponent b 2.71 134958 U72507 Hs.234216 Human 40871 mRNA partial sequence 2.71 124280 H85835 Hs.100058 dihydropyrimidinase-like 4 2.71 130113 M64673 Hs.1499 heat shock transcription factor 1 2.71 106588 AA456612 Hs.25682 ESTs; Weakly smlr to PHOSPHATIDYLETHANOL 2.71 132023 F01927 Hs.3743 ESTs; Weakly similar to proline-rich pro 2.7 112284 853558 Hs.26052 ESTs 2.7 107897 AA026240 Hs.61387 ESTs 2.7 122610 AA453598 Hs.99336 ESTs 2.7 119070 827788 Hs.52302 ESTs 2.7 103491 Y08836 Homo Sapiens mRNA for HRX-like protein 2.7 108225 AA058843 Hs.161620 EST 2.7 105829 AA398290 Hs.21965 ESTs 2.69 127749 AI251757 Hs.145234 ESTs 2.69 128428 AI185718 Hs.143900 ESTs 2.69 108409 AA075578 zm88h3.s1 Stratagene ovarian cancer (#93 2.69 114739 AA134923 Hs.103833 ESTs; Weakly similar to predicted using 2.68 128821 D87002 Hs.135 multiple UniGene matches 2.68 107412 W26105 Hs.8961 ESTs 2.68 117012 H85893 Hs.194387 ESTs; Weakly similar to !!!1 ALU SUBFAMI 2.68 135262 AA416551 Hs.9732 ESTs 2.68 105367 AA236397 Hs.20304 ESTs 2.68 134771 L13939 Hs.89576 adaptor-related protein complex 1; beta 2.68 105036 AA128617 Hs.25549 ESTs 2.68 125093 T92930 Hs.186750 ESTs 2.68 119340 T61899 Hs.90677 ESTs; Highly similarto CGI-82 protein [ 2.67 132603 H62900 Hs.53066 hsp70-interacting protein 2.67 113733 T98386 Hs.184548 ESTs 2.67 123564 AA608902 Hs.112612 ESTs 2.66 116059 AA454165 Hs.53455 ESTs 2.66 125803 879373 Hs.29852 ESTs 2.66 123012 AA479962 Hs.139636 EST 2.66 106080 AA418046 Hs.35124 ESTs 2.66 128809 T59668 Hs.102267 lysyl oxidase 2.66 104354 H08988 Hs.113759 ESTs 2.66 107068 AA609028 Hs.8032 ESTs 2.65 101418 M17754 Hs.1276 BN51 (BHK21) temperature sensitivity corn 2.65 135157 AA460138 Hs.95582 SRY (sex-determining region Y)-box 20 2.65 , 123312 AA496258 Hs,99601 ESTs 2.65 130034 C00350 Hs,14454 chromosome2.65 2 open reading frame 1 103897 AA248870 Hs.55058 ESTs 2.65 117771 N47961 Hs.46794 ESTs 2.65 109980 H09529 Hs.98693 DKFZP586J09172.64 protein 121966 AA429653 Hs.98616 EST 2.64 114233 239652 Hs,27457 ESTs 2.64 129594 870379 Hs,115396 Human 2,63 germline IgD chain gene; C-region;

102319 034587 Hs,66578 codicotropin2.63 releasing hormone receptor 111700 822212 Hs,23361 ESTs 2.63 127365 AA001628 Hs,74335 heat 2.63 shock 90kD protein 1; beta 104205 AA496240 Hs.17270 DKFZP434C2112.63 protein 124559 N66223 Hs.135928 ESTs; 2.63 Weakly similar to !1!1 ALU SUBFAMI

106351 AA442772 Hs.191987 ESTs; 2.63 Weakly similar to 7111 ALU SUBFAMI

121903 AA427605 Hs.258742 myosin-binding2.62 protein C; cardiac 116442 AA620310 Hs.184343 ESTs; 2.62 Weakly similar to KIAA0585 protein 127041 F06090 HSCOWG031 normalized infant brain cDNA H 2.62 132860 093049 Hs.58435 FYN-binding2.62 protein (FYB-1201130) 131591 L22454 Hs.180069 nuclear 2.61 respiratory factor 1 118118 N56901 Hs.47995 ESTs 2.61 134809 X52611 Hs.18387 transcription2.61 factor AP-2 alpha (activat 117706 N45091 Hs.46472 ESTs 2.61 127488 AA312179 Hs.178617 ESTs; 2.61 Weakly similar to CGI-82 protein [

114891 AA235984 Hs.87469 ESTs 2.6 116426 AA609668 Hs.71657 ESTs 2.6 132589 AA432197 Hs.5260 ESTs; 2.6 Weakly similarto CGI-08 protein [

128410 AA452788 zx39g11.r1 Soares_total-fetus_Nb2HF8_9w2.6 106081 AA418394 Hs.25354 ESTs 2.6 129919 802003 Hs.191208 ESTs; 2.59 Weakly similar to weak similarity 124672 800307 Hs.188504 ESTs 2.59 122758 AA459013 Hs.99742 X-ray 2.59 repair complementing defective rep 125656 AA040118 Hs.78687 neutral2.59 sphingomyelinase (N-SMase) activ 130052 J00220 Hs.145288 Human 2.59 Ig active epsilonl 5' UT; V-D-J
re 134878 028055 Hs.250826 macrophage2.59 stimulating; pseudogene 9 131908 L05624 Hs.3446 mitogen-activated2.59 protein kinase kinase 126470 AA843339 Hs.193165 ESTs; 2.59 Weakly similar to CGI-52 protein [

132353 M31651 Hs.46319 sex hormone-binding2.58 globulin 119588 W44559 Hs.142525 ESTs 2.58 131757 D17532 Hs.316 DEADIH (Asp-Glu-Ala-AspIHis)2.58 box polypep 118114 N56875 Hs.143212 cystatin2.58 F (leukocystatin) 128200 AI279952 Hs.158037 ESTs; 2.58 Weakly similarto transcription re 131208 C14586 Hs.24220 Homo sapiens mRNA; cDNA DKFZp566M051 (fr 2.58 124721 811131 Hs.154966 ESTs 2.57 108706 AA121820 Homo sapiens 2.57 mRNA for KIAA0842 protein;

118831 N79592 Hs.50838 ESTs 2.57 115708 AA412212 Hs.44033 ESTs 2.57 107233 D59322 Hs.22595 ESTs 2.57 129559 AA234945 Hs.11360 ESTs 2,57 126953 AA743849 Hs.127286 ESTs 2.56 108165 AA055221 Hs.63168 ESTs 2.56 104069 AA401547 Hs.172694 ESTs 2.56 112146 846512 Hs.25374 ESTs 2.56 108384 AA074891 Hs.124917 ESTs; 2.56 Highly similar to KIAA0838 protein 131779 849047 Hs.179779 ribosomal2.56 protein L37 111829 836070 Hs.25079 EST 2.55 103424 X97267 Hs.155975 protein 2.55 tyrosine phosphafase; receptor t 100133 D13118 Hs.80986 ATP synthase;2.55 H+transpoding; mitochond 130208 AA620556 Hs.15250 peroxisomal2.55 D3;D2-enoyl-CoA isomerase 124649 N92593 Hs.102907 ESTs 2.55 106511 AA452865 Hs.206713 UDP-Gal:betaGIcNAc2.55 beta 1;4-galactosylt 128467 AA176446 Hs.180428 ESTs; 2.55 Weakly similar to hypothetical 43.

113524 T90072 Hs.15060 ESTs 2.55 .

107821 AA020991 Hs.172856 ESTs 2.55 111900 839044 Hs.25318 Homo Sapiens2.54 clone 25194 mRNA sequence 109908 H05255 Hs.203237 EST 2.54 132069 D87454 Hs.192966 KIAA02652.54 protein 130660 T95262 Hs.17538 ESTs 2.54 112983 T23443 Hs.7111 ESTs 2.54 128279 H08885 y188bO8.r1 Soares 2.54 infant brain 1NIB Homo 106415 AA447994 Hs.29188 ESTs 2.53 116741 H03268 Hs.181746 EST 2.53 103148 X66362 Hs.2994 PCTAIRE 2.53 protein kinase 3 132336 AA342422 Hs.45073 ESTs 2.53 129484 892488 Hs.111989 ESTs 2.53 110169 H19696 Hs.31612 ESTs; 2.53 Moderately similar to CAGH4 [H.sap 116880 H6838D Hs.144174 EST 2.53 133511 Hs.74451 calpain; small2.53 X04106 polypeptide 126037 Hs.6066 KIAA1112 protein2.53 132678 Hs.5486 ESTs 2.53 128751 Hs.183176 ESTs 2.52 133664 Hs,75445 hevin 2.52 126977 EST180547 JurkatT-cells2.52 AA309665V Homo sapiens 120697 Hs.97250 EST 2.52 128571 Hs.101661 ESTs 2.52 104422 Hs.132909 ESTs 2.52 122372 Hs.99044 EST 2.52 112154 Hs,25388 ESTs 2.52 126900 Hs.12701 ESTs; Highly 2.51 816034 similar to plasmolip!n [H.s 115000 Hs.144584 ESTs 2.51 110632 Hs.171635 ESTs 2.51 129154 Hs.108969 mannosidase; 2.51 N23673 alpha; class 2B; member 107440 Hs.251993 ESTs; Weakly 2.51 W28069 s!m!lar to sim!lar to zinc 105694 Hs,37883 ESTs 2.51 106249 Hs.13144 ESTs; Weakly 2.51 AA430388sim!lar to ORF YGR038w [S.c 134462 Hs.83620 sel-1 (suppressor2.51 011037 of lin-12; C.elegans)-101800 Hs.105806 granulysin 2.51 119884 Hs.58662 Homo sapiens W81606 mRNA; cDNA DKFZp564G212 (fr 2.51 110289 Hs.31524 ESTs 2.51 125506 Hs.154073 UDP-galactose2.51 H54273 transporter related 102954 Hs.2813 moBlin 2.51 127851 Hs.130497 ESTs; Weakly AI469331similar to CHLORIDE
CONDUCT 2.5 126179 Hs.143855 ESTs; Highly 2.5 AI191445similar to IROQUOIS-CLASS
H

129443 Hs.111497 ESTs; Moderately2.5 W69967 s!milar to neuronal pro 104480 Hs.99654 protein-0-mannosyltransferase2.5 115580 Hs.144339 Hu DNA seq AA398695frm clone 495010 on chr 6q26-Prot L37A) pseudogene;
last exon of gene for a novel prot smlr to worm E04F6.2; ESTs;
STSs and GSSs 2.5 119595 Hs.55878EST 2.5 103336 Hs.183Duffy blood group 2.5 102792 Hs.227576GTP binding protein2.49 129643 Hs.250712calcium channel; 2.49 L27584 voltage-dependent;
beta 134503 Hs.84183diptheria toxin 2.49 034880 resistance protein reqrd 117245 Hs.42927ESTs 2.49 126888 Hs.1063small nuclear ribonucleoprotein2.49 H78745 polypept 135313 Hs.98508KIAA0150 protein 2.49 121186 Hs.183294ESTs 2.49 130651 Hs.1734inhibin; alpha 2.49 134218 Hs.80205pim-2 oncogene 2.49 104008 EST38874 Embryo, AA334630 9 week Homo sapiens cDN 2.49 129705 Hs.12068camitine acetyltransferase2.49 127900 Hs.121824ESTs 2.49 104609 Hs.107795ESTs 2.48 131628 Hs.2979trefoil factor 2 2.48 047292 (spasmolytic protein 1) 132184 Hs.419distal-less homeo 2.48 051003 box 2 130450 Hs.15591COP9 subunit 6 (MOV342.48 070735 homolog; 34 kD) 101679 Hs.163271Human alpha-1 Ig 2.48 M62628 germline C-region membr 120858 Hs.96940EST 2.48 101012 Hs.697cytochrome o-1 2.48 110453 Hs.33026ESTs; Weakly similar2.48 H52133 to similar to Enter 133771 Hs.760GATA-binding protein2.48 102944 Hs.37092fibroblast grwth 2.48 X14445 fctr 3 (murine mammary 113269 Hs.85044ESTs 2.48 107069 Hs.11759ESTs; Weakly similar2.48 AA609045 to !!!! ALU CLASS
B

100476 Serine Kinase Psk-H12.47 106457 Hs.27801zinc finger protein2.47 105718 Hs.74335heat shock 90kD 2.47 AA291629 protein 1; beta 104925 Hs.5548Homo sap!ens clone 2.47 AA058683 23765 mRNA sequence 109913 Hs.31588ESTs 2.47 103412 Hs.42957methyltransferase-like2.47 102326 Hs.226025vacuolar protein 2.47 035246 sorting 45A (yeast homo 116813 Hs.93102ESTs 2.47 123690 Hs.112723EST 2.47 124714 Hs.193118ESTs 2.47 126154 Hs.14232ESTs; Moderately 2.47 A1004105 similarto KIAA0563 pro 118880 Hs.54593EST 2.47 122274 Hs.184456ESTs; Weakly similar2.46 AA437094 to !!1! ALU SUBFAMI

129600 Hs.11567ESTs; Moderately 2.46 N78980 similar to unknown [H.s 121356 Hs.93581Homo sapiens mRNA; (fr 2.46 AA405437 cDNA DKFZp586E171 109560 Hs.8154ESTs 2.46 123342 Hs.31659thyroid hormone 2.46 AA504336 recepforassociated prof 128032 Hs.126678ESTs 2.46 129101 Hs.108665ESTs; Weakly similar H90310 to CELL-CYCLE NUCLE
2.46 131185 M25753 Hs.23960 cyclin 2.46 121451 AA411008 Hs.98085 EST 2.46 104328 D81932 HUM424C5B Hu fetal2.46 brain (TFujiwara) H s 126543 AA723810 Hs.69517 ESTs; 2.45 Highly similarto differentially a 123600 AA609106 Hs.112644 ESTs 2.45 131020 AA411756 Hs.20594 ESTs; 2.45 Weakly similar to misato [D.melano 134191 W28902 Hs.7979 KIAA0736 2.45 gene product 130446 X79510 Hs.155693 protein 2.45 tyrosine phosphatase; non-recept 131613 886228 Hs.29595 JM4 protein2.45 118864 N89670 Hs.42148 ESTs; 2.45 Weakly similarto Su(P) [D.melanog 104232 AB002351 Hs.10587 KIAA03532.45 protein 122604 AA453489 Hs.99333 ESTs 2.45 120626 AA285064 Hs.104485 EST 2.45 116655 F03866 Hs.68090 ESTs 2.44 116267 AA485080 Hs.256539 ESTs 2.44 114944 AA243172 Hs.87619 TED 2.44 protein 127629 AA293279 Hs.29173 ESTs 2.44 120350 AA211300 Hs.104166 ESTs 2.44 103620 247087 Hs.182643 transcription2.44 elongation factor B (SIII) 131420 211737 Hs.2664 flavin 2,44 containing monooxygenase 4 131312 AA399226 Hs.25527 tightjunction2.43 protein 3 (zona occludens 122812 AA461044 Hs.142980 EST 2.43 135100 AA398926 Hs.251108 Homo sapiens mRNA; chromosome 1 specific2.43 113464 T86931 Hs.16295 ESTs 2.43 100045 M11507 AFFX control: transfemn2.43 receptor 128975 AA092129 Hs.107538 ESTs; 2.43 Moderately similar to (prediction 103688 AA011479 Hs.154701 ESTs 2.43 127331 F20186 HSPD05873 HM3 Homo sapiens cDNA clone 05 2.43 107337 T97111 Hs.191235 ESTs; 2.43 Weakly similar to Ydr324cp [S.cere 122171 AA435750 Hs.98830 EST 2.43 107601 AA004636 Hs.50223 ESTs 2.43 119800 W73523 Hs.58314 ESTs 2.43 104886 AA053348 Hs.144626 growth2.42 differentiation factor 11 122899 AA469960 Hs.178420 ESTs; 2.42 Highly similar to WASP interacting 125933 AI308037 Hs.84120 ESTs; 2.42 Weakly similar to nucleoporin p62 121664 AA417291 Hs.97978 ESTs 2.42 125450 AA377194 Hs.238909 ESTs;
Weakly similarto POLYPOSIS LOCUS
2.42 114611 AA081374 Hs.108110 DKFZP547E21102.42 protein 111595 811492 Hs.191225 ESTs 2.42 111671 819368 Hs.229084 EST 2.42 110687 H93005 Hs.177311 ESTs 2.42 103019 X53414 Hs.144567 alanine-glyoxylate2.42 aminotransferase (oxa 119076 836634 Hs.235534 ESTs 2.42 130589 AA234308 Hs.16441 DKFZP434H2042.42 protein 125975 AA495891 Hs.152290 ESTs; 2.42 Highly similar to PACAP type~NIP

106380 AA446188 Hs.16614 ESTs 2.41 121965 AA429652 Hs.104901 EST 2.41 121604 AA416788 Hs.98259 EST 2.41 100885 HG4490-HT4876 Proline-Rich2.41 Protein Prb4, Allele 117807 N48701 Hs.46523 EST 2.41 119840 W79525 Hs.58586 ESTs 2.41 102458 U48861 Hs.54397 cholinergic2.41 receptor, nicotinic; beta po 116152 AA460920 Hs.215683 ESTs; 2.41 Moderately similar to !!!! ALU
SUB

126741 AA522512 Hs.29759 Homo sapiens mRNA; cDNA DKFZp586L2123 (f 2.41 103381 X92715 Hs.3057 zinc finger2.41 protein 74 (Cos52) 124837 855630 Hs.233602 KIAA05962.41 protein 129322 AA437153 Hs.110407 ESTs; 2.4 Weakly similar to coded for by C.

129291 AA281930 Hs.110099 core-binding2.4 factor, runt domain; alpha 124789 843803 Hs.78110 ESTs; 2.4 ' Weakly similar to F17A9.2 [C.elega 133253 Y00970 Hs.183088 acrosin 2.4 118990 N94447 Hs.55047 EST 2.4 134897 871427 Hs.9081 phenylalanyl-tRNA2.4 synthetase beta-subuni 116572 D45654 Hs.65582 DKFZP586C13242.4 protein 104294 D14539 Hs.234774 myeloidllymphoid2.4 or mixed-lineage leukem 118764 N74440 Hs.205264 ESTs 2.4 117437 N27645 yw5e3.s1 Weizmann Olfactory Epithelium H

3' similar to contains L1.t3 2.4 L1 repetit ~

111651 816733 Hs.20499 ESTs 2.39 109563 F02322 Hs.26135 ESTs 2.39 125969 894247 Hs.193879 ESTs 2.39 130647 AA457216 Hs.214190 interleukin2.39 enhancer binding factor 1 113708 T97467 Hs.18065 ESTs 2.39 133469 L03785 Hs.170482 myosin; 2.39 light polypeptide 5; regulatory 118266 N62837 Hs.48647 immunoglobulin-like2.39 transcript 7 121656 AA417248 Hs.98212 ESTs 2.39 126530 AI422841 Hs.180086 ESTs 2.39 123708 AA609648 Hs.207767 EST 2.39 107875 AA025308 Hs.61182 ESTs 2.39 111711 822891 Hs.7093 ESTs 2.39 131405 079255 Hs.26468 amyloid 2.39 beta (A4) precursor protein-bind 127454 AA502957 Hs.153590 ESTs 2.39 132341 AA448419 Hs.45209 ESTs 2.38 133673 D87673 Hs.75486 heat shock2.38 transcription factor 4 113213 T58607 ya94a02.s1 Sfrafagene2.38 placenta (#937225) 106230 AA429356 Hs.12047 ESTs 2.38 116692 F09261 Hs.66103 ESTs 2.38 126197 AA172284 Hs.103657 ESTs; 2.38 Weakly similar to CH-TOG PROTEIN
[

115966 AA446866 Hs.71371 ESTs 2.38 132636 065785 Hs.5417 oxygen 2.38 regulated protein (150kD) 109965 H09077 Hs.30895 EST 2.38 130203 L14754 Hs.1521 immunoglobulin2,38 mu binding protein 2 131332 850487 Hs.25717 ESTs 2.38 119105 842357 Hs.91453 ESTs 2.37 129253 W69316 Hs.109778 ESTs; 2.37 Weakly similar to similar to beta-113602 T92558 Hs.17036 ESTs 2.37 118102 N55272 Hs.145798 ESTs 2.37 100734 HG3432-HT3620 Fibroblast t, Splice 3, Growth Factor Receptor K-Sam, K-Sam Iii 2.37 Al 111533 808548 Hs.251651 EST 2.37 130813 012259 Hs.198 paired box 2.37 gene 3 (Waanfenburg syndrome 119180 880413 Hs.92520 ESTs 2.37 109335 AA211443 Hs.86492 ESTs 2.37 107386 097698 Hs.159593 mucin 2.36 6; gastric 122486 AA448328 Hs.115527 ESTs 2.36 112997 T23548 Hs.167467 ESTs 2.36 109674 F09051 Hs.21837 ESTs; 2.36 Weakly similar to KIAA0927 protein 128868 AA423827 Ns.106730 hypothetical2.36 protein 127027 817261 yg12g07.r1 Soares 2.36 infant brain 1NIB H sa 123099 AA485931 Hs.79 aminoacylase2.36 115716 AA416767 Hs.43498 ESTs; 2.36 Weakly similar to ORF YKL201 c [S.c 130830 D86982 Hs.20060 KIAA0229 2.36 protein 109051 AA159920 Hs.72322 ESTs 2.36 130181 839552 Hs.151608 Homo 2.36 Sapiens clone 23622 mRNA sequence 131114 846233 Hs.23107 ESTs 2.36 123589 AA609047 Hs.188922 ESTs 2.36 130872 003891 phorbolin (similarto2.36 , apolipoprotein B m 131962 H78550 Hs.2780 jun D prota-oncogene2.36 130502 M55067 Hs.1583 neutrophil2.36 cytosolic factor 1 (47kD; chr 121785 AA423883 Hs.142442 ESTs 2.35 125405 T97171 Hs.121570 ESTs 2.35 103682 AA000993 ESTs 2.35 125649 T77395 Hs.194816 stomatin-like2.35 protein 1 115452 AA285019 Hs.55263 ESTs; 2.35 Highly similar to mitochondria) di 129338 T56800 Hs.47274 Homo Sapiens mRNA; cDNA DKFZp564B176 (fr 2.35 106105 AA421268 Hs.149443 putative2.35 tumor suppressor 134770 872079 Hs.89575 CD79B 2.35 antigen (immunoglobulin-associated 119422 T99496 Hs.229598 EST 2.35 109869 H02849 Hs.30345 EST 2.35 134314 AA263032 Hs.81634 ATP 2.35 synthase; H+transporiing; mitochond 114989 AA251097 Hs.189119 ESTs 2.35 122619 AA453755 Hs.191515 ESTs 2.35 133129 AA428580 Hs.65551 ESTs 2.35 128465 AA416762 Hs.100221 nuclear2.35 receptor subfamily 1; group H; m 115636 AA402715 Hs.58389 ESTs 2.35 130836 J05068 Hs.2012 transcobalamin2.34 I (vitamin 812 binding pr 132385 Y10256 Hs.47007 serinelfhreonine2.34 protein-kinase 107776 AA018820 Hs.221147 ESTs 2.34 109791 F10669 Hs.13228 DRE-antagonist2.34 modulator, calsenilin 124409 N33212 Hs.107197 ESTs 2.34 131068 AA397916 Hs.22595 ESTs 2.34 121079 AA398719 Hs.14169 ESTs; 2.34 Weakly similar to CREB-binding pro 124662 N94340 Hs.171835 ESTs;
Weakly smlr to PUT PRE-MRNA
SPLICI 2.34 133820 M13686 Hs.177582 surfactant;2.34 pulmonary-associated protein 129424 M55593 Hs.111301 matrix 2.34 metalloproteinase 2 (gelatinase A

109066 AA161377 Hs.72404 EST 2.34 100339 D63485 Hs.181359 KIAA01512.34 gene product 100809 HG3991-HT4261 Cpg-Enriched2.34 Dna, Clone E18 120844 AA349417 Hs.96917 ESTs 2,33 124927 896146 Hs.221459 ESTs 2.33 109779 F10527 Hs.3353 Homo sapiens clone 24940 mRNA sequence 2.33 101171 L16842 Hs.119251 ubiquinol-cytochrome2,33 c reductase core pr 110805 N26904 Hs.24048 ESTs; 2.33 Weakly similar to FK5061rapamycin-125440 A1090982 Hs.31895 ESTs 2.33 133159 AC000061 Hs.663 cystic 2.33 fibrosis transmemb conductance re 101829 M91368 Hs.129763 solute 2.33 carrier family 8 (sodiumlcaicium 126492 AA778565 Hs.142505 ESTs 2,33 102774 U83303 Hs,164021 small 2.33 inducible cytokine subfamily B (CX

130480 N50809 Hs.15760 ESTs; 2.33 Weakly similar to similar to Yeast 126878 AI424759 Hs.236928 ESTs 2.33 117338 N23889 Hs.43466 ESTs 2.32 118662 N70877 Hs.13055 ESTs 2.32 130354 AA416685 Hs,155001 UNC13 2.32 (C. elegans)-like 106760 AA477330 Hs.12293 ESTs 2.32 124294 H90573 Hs.102298 EST 2.32 119428 W02129 Hs.55242 EST 2.32 132629 240942 Hs.5383 ESTs 2,32 127998 AA854161 Hs.143585 ESTs 2.32 132728 AA293334 Hs.5566 ESTs; 2.32 Highly similar to RAS-RELATED
PROT

120292 AA189116 Hs.96168 ESTs 2.32 107598 AA004528 Hs.169444 ESTs 2.32 128164 A1478174 Hs.144846 ESTs 2.32 105753 AA299789 Hs.15277 ESTs 2.31 131256 AA262340 Hs.24907 coronin;2.31 actin-binding protein; 2B

110891 N38863 Hs.234392 platelet-activating2.31 factoracetylhydrola 116767 H13689 Hs.92530 ESTs 2.31 100545 HG2147-HT2217 Mucin 3, 2.31 Intestinal (Gb:M55405) 125264 W88995 Hs.167641 ESTs; 2.31 Weakly similar to C15H9.5 [C.elega 118387 N64579 yz51d11.s1 Morton 2.31 Fetal Cochlea H sapien 104335 D83847 Hs.183864 elastase2.31 107464 W42944 Hs.171939 ESTs 2.31 112304 854798 Hs.26239 ESTs 2.31 134313 AA136100 Hs.6673 trinucleotide2.31 repeat containing 15 116322 AA490900 Hs.58643 ESTs; 2.31 Highly similar to JAK3B [H.sapiens 111275 N70970 Hs.35006 ESTs 2.31 100109 AJ000480 Hs.143513 phosphoprotein2.31 regulated by mitogenic pa 109338 AA211717 Hs.86507 ESTs 2.31 134432 AA053022 Hs.8312 ESTs 2.31 129649 AD000092 Hs.182628 Homo sapiens DNA from chr 19p13.2 cosmid EKLF; GCDH; CRTC; and RAD23A
genes; gen 2.31 122623 AA453990 Hs.99248 ESTs 2.31 112070 843976 Hs.236310 EST 2.31 127683 AA666123 Hs.134170 ESTs 2.31 104920 AA057620 Hs.30807 ESTs; 2.31 Highly similar to dJ18601.1 [H,sap 106064 AA417373 Hs.15898 ESTs 2.31 106782 AA478487 ESTs 2.31 126709 AA028159 Hs.47234 ESTs 2.3 105129 AA158386 Hs.186476 ESTs 2.3 105719 AA291644 Hs.36793 ESTs 2.3 121698 AA418399 Hs.10351 KIAA03082.3 protein 119069 827619 Hs.231046 EST 2.3 130386 U72515 Hs.189563 putative2.3 protein similarto nessy (Droso 103444 X98801 Hs.74617 dynactin 2.3 1 (p150; Glued (Drosophila) hom 114604 AA076128 zm18g4.s1 Stratagene pancreas (#93728) H

3' similar to SW:RS1A_HUMAN P39272.3 103878 AA227635 Hs.202588 ESTs 2.3 105628 AA398276 Hs.11962 ESTs 2.3 119778 W72920 Hs.58244 ESTs 2.3 120401 AA234309 Hs.193011 ESTs 2.3 116290 AA488691 Hs.57969 phenylalanine-tRNA2.3 synthetase 130479 844163 Hs.12457 Homo sapiens2.3 clone 23770 mRNA sequence 104253 AF002672 Hs.152944 loss 2.29 of heterozygosity;11; chromosomal 132615 H66367 Hs.53358 ESTs; 2.29 Weakly similar to !!!! ALU SUBFAMI

121954 AA429598 Hs.98587 ESTs 2.29 101336 L49169 Hs.75678 FBJ murine2.29 osteosarcoma viral oncogene h 127247 AA313802 Hs.6289 growth 2.29 factor receptor bound protein 117300 N22565 Hs.43212 ESTs 2.29 122229 AA436198 Hs.103902 ESTs 2.29 125106 T95766 Hs.189760 ESTs 2.29 128083 816100 Hs.166476 ESTs 2.29 131279 AA089853 Hs.25197 STIP1 2.29 homology and U-Box containing prot 133838 M97796 Hs.180919 inhibitor2.29 of DNA binding 2; dominant neg 111837 836447 Hs.24453 ESTs ~ 2.29 111435 801620 Hs.19198 ESTs 2.29 123613 AA609158 Hs.112656 EST 2.29 133560 AA256365 Hs.7486 protein 2.29 expressed in thyroid 122896 AA469952 Hs.97899 ESTs; 2.29 Weakly similar to dal2; len:343;
C

113378 T80627 Hs.14757 ESTs 2.29 127174 AA293204 Hs.139352 ESTs 2.29 120153 239582 Hs.65777 EST 2.29 112741 893080 Hs.35035 ESTs 2.28 132152 AA044784 Hs.4105 Homo Sapiens mRNA; cDNA DKFZp586A0618 (f 2.28 109790 F10665 Hs.25031 ESTs 2.28 113776 W04657 Hs.24248 ESTs 2.28 102934 X13451 Hu mRNA for lymphocyte2.28 lineage-rstrcted 126168 AA322034 EST2469,0 Cerebellum II Homo Sapiens cDNA2.28 126363 N94706 Human Chromosome 16 BAC clone CIT987SK-A 2.28 101427 M19508 Human myeloperoxidase2.28 gene, exons 1-4 132616 AA386264 Hs.5337 isocitrate2.28 dehydrogenase 2 (NADP+); mito 105537 AA258813 Hs.27160 ESTs 2.28 126527 AA548559 Hs.103853 ESTs 2.28 115359 AA281936 Hs.88914 ESTs 2.28 108474 AA079667 zm93d1.s1 Stratagene2.28 ovarian cncr (#9372 120685 AA291066 Hs.105099 ESTs 2.28 126171 AA704771 Hs.191942 ESTs 2.28 112858 T02963 Hs.4454 ESTs 2.28 121817 AA424826 Hs.98475 EST 2.28 107895 AA026150 Hs.61384 ESTs 2.28 131161 238223 Hs.23735 potassium2.28 voltage-gated channel; subfami 135173 M72885 Hs.95910 Human 2.27 GOS2 protein gene; complete cds 103182 X69819 Hs.99995 intercellular2.27 adhesion molecule 3 113889 W72720 Hs.194347 ESTs 2.27 128984 AA319615 Hs.238030 secretory2.27 tamer membrane protein 2 101531 M29877 Hs.576 fucosidase;2.27 alpha-L-1; tissue 115916 AA436889 Hs.91910 ESTs 2.27 129892 H96850 Hs.89674 dolichyi-diphosphooligosacchadde-protei2.27 103035 X54871 Hs.77690 RAB5B; 2.27 member RAS oncogene family 126479 T78141 ESTs 2.27 125778 871976 Hs.161791 ESTs; 2.27 Weakly similar to !!1! ALU SUBFAMI

108132 AA053586 Hs.63048 ESTs 2.27 111017 N53965 Hs.256327 ESTs 2.27 127165 AA359719 Hs.127121 ESTs 2.27 126446 AI421309 Hs.118926 DKFZP586K09192.26 protein 107864 AA025061 Hs.61246 ESTs 2.26 122277 AA437133 Hs.98936 ESTs 2.26 115604 AA400378 Hs.49391 ESTs 2.26 105061 AA134824 Hs.4865 ESTs 2.26 118549 N68163 Hs.49455 EST 2.26 110509 H56493 Hs.61960 ESTs;
Moderately similar to HYPOTHETICAL
2.26 114088 238280 Hs.26971 Human Chromosome 16 BAC clone CIT987SK-2 2.26 103225 X74837 Hs.2750 mannosidase;2.26 alpha; class 1A; member 1 125842 AA746654 Hs.5181 proliferation-associated2.26 2G4; 38kD

104538 825069 Hs.175681 ESTs 2.26 130304 U09368 Hs.154205 zinc 2.26 finger protein 140 (clone pHZ-39) 120680 AA290743 Hs.97242 ESTs 2.26 124062 H00440 Hs.144524 ESTs; 2.26 Weakly similar to signal transduce 103289 X80915 Hs.1573 growth 2.26 differentiation factor 5 (cartila 109286 AA197273 Hs.191324 ESTs 2.26 128555 U62739 Hs.101408 branched2.26 chain aminotransferase 2; mitoc 129439 AA171694 Hs.111461 ceruloplasmin2.26 (ferroxidase) 109221 AA192755 Hs.85840 ESTs; 2.26 Weakly similar to stac [H.sapiens]

109906 H05084 Hs.28077 ESTs; 2,26 Highly similar to GDP-mannose pyro 130540 U35234 Hs.159534 protein 2,26 tyrosine phosphatase; receptor t 122870 AA465158 Hs.192861 Spi-B 2.26 transcription factor (Spi-11PU.1 r 120219 241124 Hs.66045 EST 2.26 128021 A1001136 Hs.78223 N-acylaminoacyl-peptide2.26 hydrolase 121732 AA421047 Hs.98330 ESTs 2.26 107817 AA020781 Hs.60847 ESTs 2.25 101069 L02648 Hs.84232 transcobalamin2.25 II; macrocytic anemia 103065 X58399 Hs.81221 Human 2.25 L2-9 transcript of unrearranged im 118019 N52585 Hs.47517 ESTs 2.25 122220 AA436011 Hs.98187 ESTs 2.25 109161 AA179392 Hs.73601 EST 2.25 128699 K03207 Hs.103972 proline-rich2.25 protein BstNl subfamily 4 101914 S71824 Hs.167988 neural 2.25 cell adhesion molecule 1 102697 U74667 Hs.6364 Tat interactive2.25 protein (60kD) 119939 W86753 Hs.82407 ESTs 2.25 127793 A1298835 Hs.30445 ESTs; 2.25 Weakly similar to transcription re 104450 L77564 Hs.103978 serinelthreonine2.25 kinase 22B (spermiogene 133096 AA136042 Hs.131053 ESTs 2.25 115416 AA283893 Hs.203866 ESTs 2.25 117056 H90322 Hs.41387 EST 2.25 115598 AA400129 Hs.65735 ESTs 2.25 121267 AA401397 Hs.165296 ESTs; 2.25 Highly similar to kallikrein-like 104778 AA026397 Hs.11039 Homo sapiens clone 24804 mRNA sequence 2.25 110926 N48252 Hs.135287 ESTs 2.24 102795 088667 Hs.198396 ATP-binding cassette; sub-family A (ABC1 2.24 118643 N70324 Hs.49840 ESTs 2.24 103304 X82240 Hs.2484 T-cell 2.24 leukemiallymphoma 1A

134814 248475 Hs.89771 glucokinase2.24 (hexok!nase 4) regulatory pr 125912 AA171719 Hs.5233 eukaryotic2.24 translation initiation factor 134365 832377 Hs.82240 syntaxin2.24 117224 N20300 Hs.218707 ESTs 2.24 107169 AA621601 Hs.184446 ESTs;2.24 Weakly similar to small GTP-bindin 133948 M59916 Hs.77813 sphingomyelin2.24 phosphodiesterase 1; acid 101426 M19483 Hs.25 ATP synthase;2.24 H+transporting; mitochond 119922 W86196 Hs.177384 ESTs 2.24 123361 AA504810 Hs.139649 EST 2.24 123915 AA621298 Hs.112967 ESTs 2.24 123540 AA608792 Hs.112591 EST 2.24 124978 T40560 Hs.221759 ESTs 2.24 102354 038268 Human cytochrome 2.24 b pseudogene, partial c 124198 H53099 Hs.198271 NADH 2.24 dehydrogenase (ub!quinone) 1 alpha 102160 018235 Hs.121561 ATP-binding2.24 cassette; sub-family A (ABC1 107520 X76091 Hs.100007 regulatory2.24 factor X; 2 (influences HlA
c 131589 052100 Hs.29191 epithelial2.24 membrane protein 2 126633 AA206993 Hs.154145 guanine2.23 nucl b!nding protein (G protein) 130887 AA258379 Hs.155986 angiotensin2.23 receptor-like 2 119894 W84670 Hs.58518 EST 2.23 124544 N63837 Hs.40500 similar 2.23 to S. cerev!siae RER1 103104 X61587 Hs.75082 ras homolog2.23 gene family; member G (rho G

110119 H17306 Hs.177229 ESTs 2.23 131411 AA464043 Hs.26506 ESTs; 2.23 Weakly s!milar to NY-REN-45 antige 102346 037359 Hs.227297 meiotic2.23 recombination (S. cerevisiae) 106003 AA411167 Hs.8734 ESTs; 2.23 Moderately similar to !1!!
ALU CLA

122564 AA452251 Hs.98669 ESTs 2.23 133688 042031 Hs.7557 FK506-binding2.23 protein 5 132096 AA131410 Hs.3964 Homo 2.23 sapiens clone 24877 mRNA sequence 110038 H11746 Hs.31097 ESTs 2.23 123788 AA620293 Hs.112853 ESTs 2.23 135070 X99350 Hs.93974 forkhead2.23 box J 1 104908 AA055841 Hs.154396 ESTs 2.22 128674 AA025001 Hs.169452 ESTs 2.22 100810 HG3992-HT4262 Cpg-Enriched2.22 Dna, Clone E35 120065 W93579 Hs.59478 EST 2.22 122775 AA459692 Hs.112143 ESTs 2.22 125443 H71482 Hs.177592 ribosomal2.22 protein; large; P1 118617 N69666 Hs.183413 ESTs; 2.22 Moderately s!milar to Ill1 ALU SUB

128001 AI167814 Hs.166664 ESTs 2.22 128160 AI279080 Hs.149971 ESTs;2.22 Moderately similar to !!!1 ALU CLA

106608 AA458644 Hs.27115 ESTs 2.22 103485 Y08409 Hs.248415 thyroid2.22 hormone responsive SPOT14 (rat) 135008 AA173423 Hs.92918 ESTs; 2.22 Weakly similar to R07G3.8 (C.elega 110122 H17333 Hs.159837 EST 2.22 128397 AI393421 Hs.14032 ESTs 2.22 110231 H24359 Hs.28733 ESTs 2.22 123188 AA489092 Hs.177726 ESTs 2.22 131903 AA481723 Hs.3436 deleted2.22 in oral cancer (mouse; homology 122649 AA454616 Hs.90336 ATPase;2.22 H+Uansporting; lysosomal (vacu 133090 AA448228 Hs.6468 ESTs 2.22 108002 AA037664 Hs.55067 ESTs; 2.22 Weakly similar to T07F12.1 gene pr 133120 X64559 Hs.65424 tetranectin2.21 (plasm!nogen-binding protein 114263 240073 Hs.6045 ESTs 2.21 125518 820148 Hs.193851 ESTs 2.21 128613 078551 Hs.102482 Homo sapiens gallbladder mucin MUCSB
mRN 2.21 102773 083192 Hs.23731 discs; 2.21 large (Drosophila) homolog 119526 W38049 Aaession not listed2.21 in Genbank 126844 AA299325 EST11903 Uterus tumor 1 Homo Sapiens cDN 2.21 105860 AA399251 Hs.180933 ESTs;2.21 Weakly similar to methyl-CpG
bindi 126957 AA733145 Hs.194560 ESTs 2.21 108959 AA150107 Hs.81810 ESTs 2.2 131663 AA423926 Hs.30318 ESTs 2.2 127468 H02941 Hs.8888 ESTs 2.2 104483 N42776 Hs.146233 ESTs 2.2 123848 AA620773 Hs.221996 ESTs 2.2 101623 M55905 Hs.75342 malic 2.2 enryme 2; NAD(+)-dependent;
mitoch 120872 AA357993 Hs.96996 ESTs 2.2 135033 AA173241 Hs.93454 ESTs 2.2 122286 AA437259 Hs.104944 EST 2.2 114862 AA235174 Hs.50250 ESTs 2.2 100255 D38047 Hs.78466 proteasome2.2 (prosome; macropain) 26S subu 103063 X58234 Hs.123178 translocase2.2 of inner mitochondrial membr 132777 856898 Hs.56663 ESTs 2.2 133082 AA457129 Hs.6455 RuvB 2.2 (E coli homology-like 2 127529 AA558980 Hs.191750 ESTs 2.2 114602 AA075642 Hs.103594 deleted2.2 in malignant brain tumors 1 120722 AA293435 Hs.97277 ESTs 2.2 102675 U72512 Human B-cell receptor2.2 associated protein 128551 H09058 Hs.237323 N-acetylglucosamine-phosphate2.2 mutase; DK

112020 843001 Hs.22298 EST 2.2 123625 AA609216 Hs.112666 EST 2.2 120315 AA194266 Hs.178393 ESTs 2.2 122081 AA431992 Hs.104920 ESTs 2.19 101798 M85220 Accession not listed2.19 in Genbank 111501 807444 Hs.163118 ESTs 2.19 132832 D63482 Hs.57734 KIAA0148 2.19 gene product 100544 HG2147-HT2217 Mucin 3, 2.19 Intestinal (Gb:M55405) 106835 AA482077 Hs.33713 ESTs; 2.19 Weakly similarto hypothetical pro 132934 AA076145 Hs.61053 ESTs 2.19 108762 AA127515 Hs.71787 ESTs; 2.19 Highly similar to 30S ribosomal pr 120164 239733 Hs.158159 FAT tumor2.19 suppressor (Drosophila) homolo 135395 L08096 Hs.99899 tumor 2,19 necrosis factor (ligand) superfami 101717 M69013 Hs.1686 guanine 2.19 nucleotide binding protein (G
pr 121172 AA400013 Hs.97750 EST 2.18 114861 AA235123 Hs.40719 ESTs 2.18 120851 AA349662 Hs.174248 ESTs 2.18 121083 AA398736 Hs.97653 EST 2.18 107171 AA621624 Hs.28088 Homo sapiens clone 24515 mRNA sequence 2.18 128754 D31446 Hs.10488 Breakpoint2.18 cluster region protein; uteri 100149 D13897 Hs.169249 peptide ~
YY 2.18 132405 AA323787 Hs.4770 KIAA10682.18 protein 114666 AA112274 zm27g6.s1 Stratagene pancreas (#93728) H

element;contains element LTR8 2.18 repetitiv 127008 AA223879 zr10g05.r1 Stratagene2.18 NT2 neuronal precu 110373 H42896 Hs.29438 ESTs 2.18 119354 T66942 Hs.100651 golgi 2.18 SNAP receptor complex member 130115 M31627 Hs.149923 X-box 2.18 binding protein 1 130514 AA161085 Hs.15871 ESTs; 2.18 Weakly similar to acid phosphatase 128848 H08077 Hs.217179 ESTs; 2.18 Weakly similar to T27A1.5 [C.elega 110161 H19312 Hs.28096 ESTs 2.18 132367 X82224 Hs.46634 cysteine 2.18 conjugate-beta lyase; cytoplasm 125882 H45538 Hs.101448 metastasis2.17 associated 1 113837 W57698 Hs.8888 ESTs 2.17 106376 AA444004 Hs.6084 ESTs 2.17 113755 T99075 Hs.18570 ESTs 2.17 107525 X91817 Hs.102866 transketolase-like2.17 119207 893186 Hs.84298 CD74 antigen2.17 (invar polypept of maj hist 131862 AA236365 3-phosphoglycerate2.17 dehydrogenase 115514 AA297739 Hs.55609 ESTs; S2.17 Weakly similar to ISOLEUCYL
TRNA

112290 853940 Hs.26016 ESTs 2.17 126136 H83353 yv82f02.r1 Soares melanocyte 2NbHM Homo 2.17 121574 AA412712 Hs.119325 Hun6ngtin-interacting2.17 protein A

118530 N67900 Hs.118446 ESTs 2.16 132327 AA203285 Hs.44892 ESTs; 2.16 Weakly similar to dJ733D15.1 [H.sa 100564 HG2239-HT2324 Potassium 2.16 Channel Protein (Gb:Z11585) 129376 AA022622 Hs.13543 ESTs; 2,16 Weakly similar to hypothetical pro 135317 X86012 Hs.98602 Human DNA sequence from intron 22 of the 9.5kb repeated region; int22h-1;2.16 involv 114973 AA250845 Hs.87762 ESTs 2.16 107559 AA001504 Hs.59860 ESTs 2,16 111014 N53787 Hs.191117 ESTs 2,16 101250 L34060 Hs.79133 cadherin 2.16 S

110697 H93721 Hs.20798 ESTs 2.16 126843 AA450166 Hs.22641 ESTs; 2.16 Moderately similar to predicted pr 108272 AA063616 Hs.43773 ESTs 2.16 125012 T66935 Hs.104859 ESTs 2.16 111639 816101 Hs.140834 EST 2.15 123157 AA488443 Hs.100426 DKFZP564A0632.15 protein 102315 U34252 Hs.2533 aldehyde dehydrogenase 9 (gamma-aminobut2.15 131897 AA287623 Hs.3426 GTPase; 2.15 human homolog of E. coli essenti 121528 AA412253 Hs.238909 ESTs; S
Weakly similar to POLYPOSIS 2.15 LOCU

122806 AA460707 Hs.106397 ESTs 2.15 125727 H00958 Hs.181641 ESTs 2.15 133279 AA069571 Hs.6957 Homo sapiens clone 24616 mRNA sequence 2.15 103219 X74570 Hs.75268 sialyltransferase2.15 4C (beta-galactosidase 120881 AA362144 Hs.104601 EST 2.15 134060 D42039 Hs.78871 KIAA0081 2.15 protein 106598 AA457140 Hs.11411 DKFZP56600842.15 protein 125576 866208 yi30h03.r1 Soares placenta Nb2HP H sapie contains Alu repetitive element;contain2.15 126727 AA037230 Hs.135084 cystatin2.15 C (amyloid angiopathy and cereb 101490 M25629 Hs.123107 kallikrein2.15 1; renaVpancreaslsalivary 129708 AA417181 Hs.120858 ESTs 2.14 100627 HG2702-HT2798 SerinelThreonine2.14 Kinase (Gb:Z25424) 121703 AA418671 Hs.104807 ESTs 2.14 106809 AA479704 Hs.220324 Humn DNA seq frm clone 283E3 on chr 1p36 Female Reproductive tract MIFR1;2.14 -2; MM

129525 F03873 Hs.112306 Homo 2.14 Sapiens clone 24955 mRNA sequence;

100478 HG1067-HT1067 Mucin (Gb:M22406)2.14 118593 N69020 Hs.207689 EST 2.14 114047 W94427 Hs.3807 ESTs; WeaklyPR 2.14 similar to PHOSPHOLEMMAN

128823 AA478207 Hs.10632 ESTs; 2.14 Moderately similar to sex-determin 100534 HG1980-HT2023 Tubulin, 2.14 Beta 2 105757 AA321146 Hs.30596 ESTs 2.14 109617 F03192 Hs.26789 ESTs; 2.14 Weakly similar to dJ162H14.1 [H.sa 121547 AA412448 Hs.104777 ESTs 2.14 119420 T98291 Hs.102484 glutathione2.14 S-transferase A3 120274 AA177051 nc02a02.s1 NCI_CGAP_Pr3 Homo Sapiens cDN

repetitive element;contains element2.14 LTR

132933 AA598702 Hs.6101 bone 2.14 morphogenetic protein 6 133405 X07881 Hs.73031 proline-rich2.14 protein BstNl subfamily 3 119811 W73922 Hs.49047 ESTs 2.14 134536 AA457735 Hs.850 IMP (inosine2.14 monophosphate) dehydrogenas 105125 AA157799 Hs.6980 aldo-keto2.14 reductase family 7; memberA2 101398 M15881 Hs.1137 uromodulin2.14 (uromucoid; Tamm-Horsfall gly 132751 AA397901 Hs.55993 ESTs 2.13 115777 AA424142 Hs.39384 putative2.13 secreted ligand homologous to f 123193 AA489228 Hs.136956 ESTs 2.13 116875 H67749 Hs.161022 EST 2.13 107271 D60607 Hs.34931 EST 2.13 134551 844839 Hs.8526 i-beta-1;3-N-acetylglucosaminyltransfera2.13 113413 T83739 Hs.186512 ESTs 2.13 120522 AA258843 Hs.258748 ESTs 2.13 119965 W87738 Hs.59039 EST 2.13 131283 AA101601 Hs.183986 herpesvirus2.13 entry mediator B (poliovirus 107347 043628 Hs.102598 mucosal 2.13 vascular addressin cell adhesion 116490 C14265 Hs.66450 ESTs 2.13 100563 HG2239-HT2324 Potassium 2.13 Channel Protein (Gb:Z11585) 110441 H50302 Hs.19845 ESTs; 2.13 Highly similar to protein phosphat 101035 J05158 Hs.73858 carboxypeptidase2.13 N; polypeptide 2; 83kD

132500 AA047297 Hs.50107 ESTs; 2.13 Moderately similar to CDO [H.sapie 129807 L34820 Hs.5299 aldehyde 2.13 dehydrogenase 5 family; member 106250 AA430466 Hs.28890 ESTs 2.13 113569 T91086 Hs.162070 EST 2.13 122911 AA470087 Hs.239726 ESTs 2.13 107452 W28988 Hs.250746 ESTs 2.12 111824 835661 Hs.25006 EST 2.12 132831 053442 Hs.57732 mitogen-activated2.12 protein kinase 11 110244 H26742 Hs.25367 ESTs; 2.12 Weakly similar to ALR [H.sapiens]

128918 H85347 Hs.107164 spectrin;2.12 beta; non-erythrocytic 1 133728 M10901 Hs.75772 nuclear 2.12 receptor subfamily 3; group C; m 122476 AA448211 Hs.99164 ESTs 2.12 132004 L37360 Hs.37054 ephrin-A32.12 113971 W86760 Hs.220682 ESTs 2.12 103386 X92972 Hs.80324 protein 2.12 phosphatase 6; catalytic subunit 131120 AA443676 Hs.23133 ESTs; 2.12 Weakly similar to alcohol sulfotra 102186 020285 G protein pathway 2.12 suppressor 1 103694 AA018541 Hs.60580 zinc 2.12 finger protein 111995 842333 Hs.20893 ESTs 2.12 124436 N39596 Hs.182584 ESTs 2.12 100306 D50495 Hs.80598 transcription2.12 elongation factor A (SII);

103084 X59932 Hs.77793 o-src 2.11 tyrosine kinase 115092 AA255903 Hs.80975 CD39-like2.11 121579 AA416543 Hs.111981 ESTs 2.11 127101 AI349351 Hs.118944 ESTs 2.11 121195 AA400273 Hs.97791 ESTs 2.11 112721 891484 Hs.30853 ESTs 2.11 113253 T64207 Hs.55296 HLA-B 2.11 associated transcript-1 120838 AA348887 Hs.96907 ESTs 2.11 114122 238582 Hs.12751 ESTs 2.11 112635 882298 Hs.29497 ESTs 2.11 103785 AA095600 Hs.225647 ESTs 2.11 128260 AA331445 EST35277 Embryo, 8 week I Homo sapiens c 2.11 122987 AA479155 Hs.103364 ESTs 2.11 110374 H42983 Hs.227263 ESTs 2.11 116595 D60625 Hs.177656 calmodulin2.11 1 (phosphorylase k!nase; delt 126117 H78617 yu26a08.r1SoaresfetalliverspleenlNF2.11 116610 D80448 Hs.45177 ESTs 2.11 111430 801248 Hs.19165 ESTs 2.11 106700 AA463929 Hs.28701 ESTs 2.11 120181 240121 Hs.65870 ESTs; 2.1 Weakly similar to Pro-Pol-dUTPase 132545 AA147218 Hs.5105 ESTs 2.1 105005 AA115253 Hs.28805 ESTs 2.1 126702 U54602 Hs.2785 keratin 2.1 124096 H10060 Hs.101687 EST 2.1 132720 269881 Hs.5541 ATPase; 2.1 Ca++transporting; ubiquitous 121926 AA428559 Hs.104895 ESTs 2.1 125734 AA157445 Hs.227391 DKFZP547E10102.1 protein 122368 AA443963 Hs.104964 EST 2.1 116910 H72014 Hs.161031 ESTs; 2.1 Weakly similar to SYNAPTOTAGMIN
I

113171 T54613 Hs.9761 EST 2.1 134629 U00951 Hs.87150 Human clone A9A2BR11 (CAC)nl(GTG)n repea 2.1 105712 AA291293 Hs.25219 ESTs 2.1 106931 AA495918 Hs.26714 ESTs 2.1 114278 240424 Hs.27728 ESTs 2.1 116615 D80666 Hs.45203 ESTs 2.09 100189 D21089 Hs.320 xeroderma 2.09 pigmentosum; complementation g 119500 W37694 Hs.55561 ESTs 2.09 129605 S72493 Hs.115947 keratin 2.09 16 (focal non-epidermolytic palm 133912 X62744 Hs.77522 major 2.09 histocompatibiliiy complex;
class 129636 N34942 Hs.11782 ESTs 2.09 106372 AA443941 Hs.4992 tumor 2.09 suppressing subtransferable candid 101885 M98539 Hs.8272 prostaglandin2.09 D2 synthase (21kD; brain) 132749 AA235989 Hs.55967 short 2.09 stature homeobox 2 135042 X91348 Hs.93522 putative 2.09 non.coding transcript (D!George 109404 AA224594 Hs.86941 ESTs 2.09 101333 L47738 Hs.80313 p53 inducible2.09 protein 100114 D00596 Hs.82962 thymidylate2.09 synthetase 130536 T17045 Hs.159492 spastic 2.09 atax!a of Charlevoix-Saguenay (s 125772 883903 Hs.78040 KDEL (Lys-Asp-Glu-Leu)2.09 endoplasmic refit 132192 AA247569 Hs.4209 ESTs 2.09 124697 806273 Hs.186467 ESTs; 2.09 Moderately similar to !!!! ALU
SUB

127694 AI247780 Hs.117036 ESTs 2.08 127895 AA772600 Hs.187998 ESTs; 2.08 Weakly similarto ATP-binding cass 121315 AA402883 Hs.82269 progestagen-associated endometrial prote endometrial alpha-2-globulin; 2.08 alpha ute 912150 846576 Hs.23239 ESTs 2.08 105054 AA133584 Hs.26333 JM1 2.08 protein 113151 T51620 Hs.9326 EST 2.08 118783 N75285 Hs.50593 ESTs; 2.08 Moderately similar to cytoplasmic 126748 AA249580 Hs.239975 ESTs; 2.08 Moderately s!milarto CDO [H.sapie 135160 U77643 Hs.95655 secreted 2.08 and transmembrane 1 107518 X60152 zinc finger protein2.08 126055 N28990 yx39g04.r1 Soares 2.08 melanocyte 2NbHM Homo 116982 H81933 Hs.40317 ESTs 2.08 101756 M77235 Hs.169331 sodium 2.08 channel; voltage-gated; type V; a 116935 H75763 Hs.53468 ESTs 2.08 118556 N68408 Hs.194637 Homo (fr 2.08 sapiens mRNA; cDNA DKFZp564D113 129812 L07807 Hs.166161 dynamin 2.08 121946 AA429411 Hs.104888 ESTs 2.08 133843 AA489045 Hs.76691 Homo 2.08 Sapiens clone 25100 mRNA sequence;

122170 AA435744 Hs.163913 ESTs 2.08 122399 AA446449 Hs.231112 EST 2.08 105775 AA348274 Hs.6664 ESTs 2.08 123943 AA621553 Hs.112998 ESTs 2.08 105771 AA347967 Hs.256267 neuroblastoma2.08 RAS viral (v-ras) oncogene 114454 AA021091 Hs.226208 ESTs 2.08 125802 878852 Hs.151099 ESTs 2.08 131556 AA442853 Hs.2869 cyclin-dependent2.08 kinase 5; regulatory su 118837 N79836 Hs.216338 ESTs 2.08 107345 U26209 Hs.102307 solute 2.08 tamer family 13 (sodium-depende 131324 H58690 Hs.25625 ESTs 2.08 105233 AA216759 Hs.191132 ESTs 2.07 112886 T03864 Hs.7436 putative 2.07 acyltransferase 120252 AA169400 Hs.152701 DKFZP434F1242.07 protein 114867 AA235310 Hs.52899 ESTs; 2.07 Moderately s!milar to !!!! ALU
SUB

106715 AA464955 Hs.126062 ESTs;
Weakly similar to EPIDERMAL
GROWTH 2.07 125560 851281 Hs.13692 ESTs; 2.07 Highly s!milar to PROTEIN TSG24 [M

112270 853021 Hs.203358 ESTs 2.07 134626 S82198 Hs.8709 caldecrin 2.07 (serum calcium decreasing fact 115723 Hs.54846ESTs 2.07 123895 Hs.112949EST 2.07 119906 ESTs; Moderately 2.07 W85818 s!milar to 1!!!
ALU SUB

108559 zn12c5,s1 Stratagene AA085161 hNT neuron (#937233 IMAGE:547283'similartoTR:G1151228G2.07 101246 Hs.202097procollagen C-endopeptidase2.07 L33799 enhancer 100663 Major Histocompatib!lity 2.07 HG2915-HT3059 Complex, Class I, E (Gb:M20022) 114178 Hs.17930Humn DNA seq frm 239063 clone 1033810 on chr 6p for GaIT3 (beta3-Galactosyftransferase)2.07 125672 Hs.78601uroporphyrinogen 2.07 AA152281 decarboxylase 118052 Hs.165133ESTs 2.07 102387 Hs.229731solute carrier family2:07 041163 6 (neurotransm!tte 127305 Hs.255277ESTs 2.07 101182 Hs.76111dystroglycan 1 (dystrophin-associated2.07 L19711 gl 131111 Hs.23076ESTs; Weakly s!milar2.07 833245 to putative [C.eleg 112441 Hs.28412ESTs 2.06 117796 Hs.46689EST 2.06 116099 Hs.58831regulator of Fas-induced2.06 AA456309 apoptosis 125559 Hs.119571collagen; type III;2.06 AA307550 alpha 1 (Ehlers-Danl 135271 Hs.97562ESTs 2.06 106083 Hs.31659thyroid hormone 2.06 AA418545 receptor-associated prot 133419 Hs.73172growth factor independent2.06 127816 Hs.120604ESTs 2.06 127502 Hs.183502ESTs 2.06 129371 Hs.110802von W!Ilebrand factor2.06 108417 zm89e5.s1 Stratagene AA075716 ovarian cancer (#93 CLUSTERIN PRECURSOR 2.06 (HUMAN);, mRNA
sequ 102837 Hs.13495requiem; apoptos!s 2.06 094585 response zinc finger 124226 Hs.190266ESTs 2.06 102254 Human HMGI-C chimeric2.06 028131 transcript mRNA, p 128472 Hs.10029catheps!n C 2.06 107545 Hs.26433dolichyl-phosphate 2.06 282022 (UDP-N-acetylglucosam 135311 Hs.98493X-ray repa!r complementing2.06 M36089 defective rep 121727 Hs.104234ESTs 2.06 131846 Hs.331general transcription2.06 002619 factor IIIC; polyp 120415 Hs.182522ESTs 2.06 110529 Hs.37486ESTs 2.06 104996 Hs.105894Homo Sapiens mRNA; (fr 2.06 AA112307 cDNA DKFZp434G231 110351 Hs.196459ESTs 2.06 131261 Hs.171776inositol(myo)-1(or4)-monophosphatase12.06 110585 Hs.133526ESTs; Weakly similarto2.06 H62223 I!!! ALU SUBFAMI

129420 Hs.99816ESTs 2.06 103796 Hs.31146Human DNA sequence AA112595 from clone 1042K10 on lyase (EC 4.3.2.2;
Adenylosuccinase;
AS

3). Contains ESTs; 2.06 STSs; GS

119782 Hs.58262ESTs 2.06 108641 ATP synthase; H+transporting;2.06 AA112059 mitochond 134875 Hs.180513ATP-b!nding cassette;2.06 066672 sub-family A (ABC1 106832 Hs.30114ESTs; Highly similarto2.06 AA482015 C8 [H.sap!ens]

109403 Hs.86937ESTs 2.06 115485 Hs.188804ESTs 2.06 102923 Hs.1063small nuclear ribonucleoprotein2.06 X12517 polypept 123320 Hs.139572EST 2.05 111901 Hs.17638ESTs 2.05 106558 Hs.182447heterogeneous nuclear2.05 AA455111 ribonucleoprotein 126885 Hs.10101ESTs; Weakly similar2.05 AA293052 to coded for by C.

113429 Hs.179808ESTs 2.05 102270 Hs.75888phosphogluconate 2.05 030255 dehydrogenase 103204 Hs.192989H.sap!ens mRNA for 2.05 X72475 rearranged Ig kappa I

106666 Hs.37916ESTs 2.05 100947 Mg44 2.05 102578 Hs.57693testis specific 2.05 060666 leucine rich repeat prat 105827 Hs.31520ESTs 2.05 122324 Hs.98921EST 2.05 101025 Hs.81097cytochrome c oxidase2.05 J04823 subunit VIII

115861 Hs.90259ESTs; Weakly similar2.05 AA431768 to alpha 1 [H.sapie 108081 Hs.42996ESTs 2.05 133994 Hs.242463keratin 8 2.05 ~

119131 Hs.129692ESTs; Moderately 2.05 846700 similar to 1!!!
ALU SUB

129793 Hs.126857ESTs 2.05 101653 Hs.161305tachykinin receptor2.05 120300 Hs.131476ESTs 2.05 106519 Hs.8763Hu DNA sequence AA453415 from clone 889N15 on chr Thymocyte Marker 2.05 CTX; the possibly alte 114291 Hs.123666Homo Sapiens mRNA 2.05 240690 full length insert cDN

105747 Hs.30251ESTs; Weakly similarH 2.04 AA293719 to GLUCOSE-6-PHOSP

125325 AA332944 Hs.8402 adenylate cyclase 3 2.04 119978 W88623 Hs.59190 EST 2.04 102449 048231 Hs.46348 bradykininreceptorB1 2.04 101454 M21812 Hs.50889 myosin light chain 2 2.04 116086 AA455904 Hs.86023 ESTs 2,04 102297 032674 Hs.198252 G protein-coupled receptor 9 2.04 130889 D57622 Hs.20985 sin3-associated polypeptide; 30kD 2.04 100196 D21853 Hs.79768 KIAA0111 gene product 2,04 120967 AA398111 Hs.97503 ESTs 2,04 105735 AA293096 Hs.32417 ESTs 2.04 135031 841604 Hs.9344 ESTs; Weakly similar to 1!!1 ALU SUBFAMI 2.04 104882 AA052954 Hs.29546 ESTs 2.04 132619 AA404565 Hs.53447 ESTs; Moderately similar to kinesin ligh 2.04 127993 AA847856 Hs.124565 ESTs 2.04 116441 AA620299 Hs.91696 ESTs 2.04 102272 030610 Hs.41682 killer cell lectin-like receptor subfami 2.04 119566 W38209 Accession not listed in Genbank 2.04 116622 D81171 Hs.45208 ESTs; Weakly similar to collagen type VI 2.04 127182 AA248620 Hs.166011 catenin (cadherin-associated protein); d 2.04 116870 H67146 Hs.38564 ESTs 2.04 115448 AA284845 Hs.165051 ESTs ~ 2.04 127231 AA434584 zw52c03.r1 Soares_tota~,fetus Nb2HF8_9w 2.04 103457 X99728 H.sapiens NDUFV3 gene, exon 3 2.04 134737 000802 Hs.89434 drebrin 1 2.04 117046 H89505 yu81f4.s1 Soaresfetalliverspleen 1NFL
to contains Alu repetitive element;, mR 2.04 124579 N68345 Hs.127179 ESTs; Weakly similarto TERATOCARCINOMA- 2.04 112132 845970 Hs.236349 EST 2.04 132281 AA133300 Hs.43803 leukocyte-associated Ig-like receptor 2 2.03 103668 283741 Hs.248174 H2A histone family; member M 2.03 113501 T89107 Hs.13262 ESTs 2.03 125021 T70060 Hs.163918 ESTs 2.03 115754 AA420998 Hs.178095 ESTs 2.03 123405 AA521370 Hs.191708 ESTs 2.03 102054 007695 Hs.155227 EphB4 2.03 115627 AA401910 Hs.119175 ESTs; Weakly similar to ZINC FINGER PROT 2.03 129252 AA234663 Hs.109773 ESTs 2.03 103417 X96849 H.sapiens 5' mRNA of PECAM-1 molecule 2.03 133721 011863 Hs.75741 amiloride binding protein 1 (amine oxida 2.03 114176 239059 Hs.27267 ESTs; Weakly similar to tetraspan TM4SF 2.03 123966 014068 Hs.21806 ESTs; Moderately similar to similar to N 2.03 134236 D45371 Hs.80485 adipose most abundant gene transcript 1 2.03 116381 AA598614 Hs.65394 ESTs 2.03 103711 AA046737 Hs.102792 ESTs 2.03 109316 AA206914 Hs.86322 EST 2.03 123793 AA620343 Hs.112858 ESTs 2.03 128462 M69238 Hs.166172 aryl hydrocarbon receptor nuclear transl 2.03 117690 N40467 Hs.93834 ESTs 2.03 113301 T67452 Hs.13104 EST 2.03 134563 AA173430 Hs.85335 Homo sapiens mRNA; cDNA DKFZp564D1462 (f 2.03 108316 AA070160 zm69f4.s1 Stratagene neuroepithelium (#9 2.03 135239 AA454599 Hs.19399 Homo Sapiens chromosome 19; fosmid 395542.03 120342 AA207105 Hs.45068 Homo Sapiens mRNA; cDNA DKFZp4341143 (fr 2.02 103493 Y08976 Hs.234759 H.sapiens mRNA for FEV protein 2.02 114204 239259 Hs.26096 ESTs 2.02 125425 H62307 Hs.18575 ESTs; Weakly similar to KIAA0246 [H.sapi 2.02 133027 AA402624 Hs.63236 synuclein; gamma (breast cancer-specific 2.02 131323 H54036 Hs.25619 death-associated protein kinase 3 2.02 121515 AA412133 Hs.104696 ESTs 2.02 129780 AA291526 Hs.124699 ESTs 2.02 131292 AF005039 Hs,200600 secretory tamer membrane protein 3 2.02 132973 AA035446 Hs.214361 ESTs 2.02 103727 AA059415 Hs.6289 growth factor receptor-bound protein 2 2.02 113174 T54659 Hs.9779 ESTs 2.02 120964 AA398085 Hs.142390 ESTs 2.02 134303 AA457242 Hs.8141 etoposide-induced mRNA 2.02 128118 T81623 Hs.21765 hypothetical protein of unknown functio 2.02 121087 AA398751 Hs.97304 ESTs 2.02 102806 090306 Human Iroquois-class homeodomain protein 2.02 103195 X70940 Hs.2642 eukaryotic translation elongation factor 2.02 126767 017148 017148 Clontech human aorta polyA+mRNA 2.02 105179 AA189083 Hs.21974 ESTs; Moderately similar to mBOCT [M.mus 2.02 116797 H40486 yn87a08.s1 Soares adult brain N2b5HB55Y
3' similar to contains Alu repetitive a 2.02 133268 AA099404 Hs.69307 ESTs 2.02 123951 AA621721 Hs.231130 EST 2.02 115463 AA286819 Hs.69485 ESTs; Weakly similar to similar to other 2.02 110603 H65776 Hs.222403 ESTs 2,02 101234 L29277 Hs.142258 signal transducer and activator of trans 2.02 121208 AA400470 Hs.97805 ESTs 2.02 122598 AA453465 Hs.99329 ESTs 2,02 110668 H84882 Hs.33791 ESTs; Weakly similarto K:CI cotransport 2.02 117137 H96670 Hs.42221 ESTs 2.02 119389 T88826 Hs.90973 ESTs 2,01 102940 X13956 Hs.24998 Human 12S RNA induced by poly(rl); poly( 2.01 100748 HG3517-HT3711 Alpha-1-Antitrypsin, 5' End 2.01 103012 X52638 Hs.739 6-phosphofructo-2-kinaselfructose-2;6-bi 2.01 132755 AA609201 Hs.182635 ESTs 2.01 130842 H39589 Hs.20159 ESTs; Highly similar to CGI-92 protein [ 2.01 133599 M64788 Hs.75151 RAP1; GTPase activating protein 1 2.01 117250 N21081 Hs.15299 HMBA-inducible 2.01 115124 AA256666 Hs.39156 ESTs 2.01 128155 AA926843 Hs.143302 ESTs 2.01 130574 AA379087 Hs.16178 apoptosis antagonizing transcription fac 2.01 132601 878838 Hs.54943 fracture callus 1 (rat) homolog 2.01 117428 N27366 Hs.43933 EST 2.01 121108 AA399053 Hs.97529 EST 2.01 130518 X69550 Hs.159161 Rho GDP dissociation inhibitor (GDI) alp 2.01 110606 H66049 Hs.19085 ESTs; Weakly similar to putative p150 [H 2.01 120606 AA282956 zt15h4.s1 NCI_CGAP_GCB1 Homo Sapiens cDN
SW:CADR_MOUSE P3938 RETINAL-CADHERIN PR 2.01 130070 T47969 Hs.194660 ceroid-lipofuscinosis; neuronal 3; juven 2.01 130331 280783 Hs.239884 H2B histone family; member L 2.01 109599 F02602 Hs.6749 ESTs 2.01 131749 W78211 Hs.31547 ESTs; Highly similar to NADH:ubiquinone 2.01 129463 AA376905 Hs.111742 ESTs; Weakly similar to !!!! ALU SUBFAMI 2.01 114880 AA235698 Hs.65862 ESTs 2.01 114745 AA135523 Hs.139064 EST 2,01 115637 AA402727 Hs.76925 ESTs;HighlysimilartoR311672;partia 2.01 109043 AA159605 Hs.72580 ESTs 2.01 128901 241411 Hs.107040 ESTs 2.01 124427 N36812 Hs.178663 ESTs 2 100673 HG3033-HT3194 Spliceosomal Protein Sap 62 2 108436 AA078801 zm94a9.s1 SUatagene colon HT29 (#937221 2 123764 AA610019 Hs.112654 ESTs 2 129343 N70791 Hs.180060 ESTs 2 122794 AA460254 Hs.105043 EST 2 128688 AA161469 Hs.103755 receptor-interacting serine-threonine ki 2 115592 AA399543 Hs.48026 ESTs 2 111693 822007 Hs,23321 EST ~ 2 113353 T79186 Hs.14468 ESTs 2 Table 18: B survivor vs Mets - Up in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn Unit ID Complete Title Ratio BSIMet 106024 AA412059 Hs.111742 ESTs; Weakly similar to !!!! ALU SUBFAMI 0.17 110930 N48603 Hs.14947 ESTs 0.18 105772 AA347973 Hs.221132 ESTs 0.2 133271 248633 Hs.6940 H.sapiens mRNA for retrotransposon 0.2 107109 AA609943 Hs.32793 ESTs 0.24 109593 F02506 Hs.159591 thyroid hormone receptor interactor 8 0.24 123016 AA480103 Hs.111730 ESTs; Weakly similar to alfema6vely sp 0.25 100739 HG3484-HT3678 Protein Kinase (Gb:M59287) 0.25 130252 U92014 Hs.153527 Human clone 121711 defective marinertra 0.26 105149 AA169253 Hs.8958 ESTs 0.26 115412 AA283804 Hs.193552 ESTs 0.27 105952 AA405263 Hs.181400 ESTs 0.28 106596 AA456981 Hs.35349 ESTs 0.28 120249 AA167567 Hs.133325 ESTs 0.28 111676 819414 Hs.166459 ESTs 0.29 111161 N66767 Hs.124145 ESTs 0.29 109364 AA215379 Hs.50418 ESTs 0.29 132316 U28831 Human protein immuno-reactive with anti- 0.3 104030 AA363131 Hs.222992 ESTs; Weakly similar to TRANSFORMATION-S 0.3 109825 F13663 Hs.16798 ESTs 0.3 111110 N63165 Hs.23618 ESTs 0.31 135315 W90583 Hs.9853 ESTs 0.32 104792 AA029288 Hs.29147 ESTs; Highly similar to ZINC FINGER PROT 0.33 123562 AA608893 Hs.190065 ESTs 0.33 116079 AA455286 Hs.54982 ESTs; Weakly similar to !!!! ALU SUBFAMI 0.33 110671 H87770 Hs.153800 ESTs 0.33 108819 AA130986 Hs.193253 ESTs 0.34 115558 AA393806 Hs.1010 regulator of mitotic spindle assembly 1 0.34 104781 AA026617 Hs.21610 ESTs; Highly similar to BAl1-associated 0.34 111236 N69324 Hs.12526 Homo sapiens clone 23903 mRNA sequence 0.34 113341 T77866 Hs.189703 ESTs 0.35 125371 A1084676 Hs.133266 ESTs; Moderately similar to Sqv-7-like p 0.35 115890 AA435853 Hs.44114 ESTs; Weakly similar to CGI-73 protein [ 0.35 113571 T91116 Hs.15713 ESTs 0.35 121683 AA417911 Hs.175663 ESTs 0.35 105489 AA256157 Hs.24915 ESTs 0.35 116320 AA490866 Hs.39429 ESTs 0.36 111917 839882 Hs.21397 ESTs 0.36 127568 T53722 ya91c06.r3 Stratagene placenta (#937225) 0.36 123541 AA608794 Hs.112592 ESTs 0.36 123131 AA487207 Hs.193272 ESTs 0.36 125069 T86914 Hs.194485 ESTs 0.36 114757 AA136725 Hs.161990 ESTs 0.37 132778 AA446695 Hs.5671 Homo sapiens clone 23926 mRNA sequence 0.37 123132 AA487233 Hs.106711 eukaryofic Translation initiation factor 0.37 134029 AA378597 Hs.143601 ESTs; Moderately similar to 67A9.b [D.me 0.37 126956 AI434405 Hs.171957 triple functional domain (PTPRF interact 0.38 106869 AA487563 Hs.188813 ESTs 0,38 107818 AA020957 Hs.167948 ESTs 0.38 129974 K00629 Hs.199300 Human kpni repeat mma (cdna clone pcd-k 0.38 129477 D49728 Hs.1119 nuclear receptor subfamily 4; group A; m 0.38 119369 T79020 Hs.245915 ESTs; Weakly similar to kinase-related p 0.39 114021 W91995 Hs.16145 ESTs 0.39 122024 AA431296 Hs.139433 EST 0.39 130014 N50959 Hs.143102 amine oxidase; copper containing 2 (reti 0.39 110163 H19326 Hs.22073 ESTs; Highly similar to J KAPPA-RECOMBIN 0.39 104641 AA004652 Hs.18564 ESTs 0.39 124777 841933 Hs.140237 ESTs 0.39 125382 AA713494 Hs.194660 ceroid-lipofuscinosis; neuronal 3; )uven 0.4 120406 AA234999 Hs.111279 ESTs; Weakly similar to unnamed protein 0.4 132734 823653 Hs.164250 ESTs 0.4 117001 H84719 Hs.40721 EST 0.4 120905 AA371602 Hs.182930 ESTs; Highly similar to PHOSPHATIDYLINOS0.4 125488 AA355158 Hs.41181 Homo sapiens mRNA; cDNA DKFZp727C191 (fr 0.4 121989 AA430044 Hs.193784 Homo 0.4 sapiens mRNA; cDNA DKFZp586K1922 (f 127929 AA806616 Hs.209523 ESTs 0.4 119830 W74700 Hs.53478 ESTs 0.41 106292 AA435571 Hs.148560 ESTs 0.41 102762 U82303 Hs.123080 Homo 0.41 sap!ens unknown protein mRNA;
parti 113518 T89731 ye11f06.s1 Stratagene lung (#937210) H s to contains Alu repetitive element;cont0.41 100635 HG2724-HT2820 Oncogene 0.41 TIsIChop, Fusion Activated 113319 T70356 Hs.193141 ESTs; 0.41 Weakly similar to coding sequence 121319 AA402935 Hs.194242 ESTs; 0.42 Weakly similar to 1!!1 ALU CLASS
B

111818 834382 Hs.24779 ESTs 0.42 104883 AA052959 Hs.177409 ESTs; 0.42 Highly similar to dJ1119D9.2 [H.sa 129258 W95592 Hs.251946 ESTs;
Moderately sim!larto POLYADENYLAT0.42 130576 T86475 Hs.16193 Homo sapiens(fr 0.43 mRNA; cDNA DKFZp586B211 106354 AA443271 Hs.26764 KIAA05460.43 protein 108841 AA132524 Hs.70614 ESTs 0.43 113922 W80741 Hs.37890 ESTs 0.43 120997 AA398285 Hs.97598 EST 0.43 108158 AA054597 Hs.221935 ESTs 0.43 124516 N58185 Hs.131830 ESTs 0.43 114477 AA032013 Hs.144260 EST 0.43 104290 C16652 Hs.107205 Homo 1 0.43 sapiens mRNA; cDNA DKFZp434L222 (f 126700 AI318412 Hs.108258 actin 0.44 binding protein; macrophin (microf 110887 N38770 Hs.4283 ESTs 0.44 116141 AA460420 Hs.44949 ESTs 0.44 110689 H93046 Hs.15571 ESTs 0.44 115314 AA280583 Hs.256501 ESTs 0.44 110904 N39453 Hs.27371 Homo sapiens(fr 0.44 mRNA; cDNA DKFZp566J123 109482 AA233375 Hs.78085 ESTs 0.44 102284 U31449 Hs.11881 transmembrane0.44 4 superfamily member 4 118654 N70582 Hs.49892 ESTs 0.44 115334 AA281244 Hs.65300 ESTs 0.44 113149 T51588 ESTs; Moderately 0.44 similar to !!1! ALU SUB

113721 T97931 Hs.18190 EST 0.44 111299 N73808 Hs.24936 ESTs 0.44 103778 AA094107 Hs.7187 ESTs; 0.44 Weakly similar to similar to glyco 113204 T57865 Hs.10310 EST 0.44 100315 D50857 Hs.82295 dedicator0.44 of cyto-kines!s 1 115254 AA279024 Hs.194437 ESTs 0.44 125500 H46104 Hs.244624 ESTs 0.44 117387 N26011 Hs.53810 ESTs 0.45 135113 W42450 Hs.206833 ESTs 0.45 124517 N58204 Hs.199945 ESTs 0.45 120379 AA227849 Hs.238380 Human 0.45 endogenous retroviral protease mRN

119205 891954 Hs.153699 ESTs 0.45 128266 T70341 Hs.131897 ESTs 0.45 104106 AA422123 Hs.42457 ESTs 0.45 115864 AA432080 Hs.81200 ESTs 0.45 113771 W02695 Hs.18714 ESTs 0.45 126515 AI124649 Hs.252708 Homo 0.45 sap!ens mRNA; cDNA DKFZp5860031 (fr 127823 AA524806 Hs.78869 transcription0.45 elongation factor A (SII);

116665 F04405 Hs.223654 EST 0.45 106355 AA443272 Hs.27836 ESTs 0.45 132693 AA621429 Hs.55075 KIAA04100.45 gene product 107388 W01587 Hs.173319 ESTs 0.45 110688 H93021 Hs.182937 pep6dylprolyl0.46 isomerase A (cyclophilin 116893 H69569 Hs.191316 EST 0.46 105375 AA236542 Hs.9512 ESTs; 0.46 Moderately similar to !!!! ALU
SUB

115601 AA400277 Hs.48849 ESTs 0.46 106896 AA489707 Hs.29896 ESTs; 0.46 Weakly similar to proline-rich pro 111770 827975 Hs.187469 ESTs 0.46 115663 AA405838 Hs.40507 ESTs 0.46 131404 AA504744 Hs.26461 ESTs; 0.46 Weakly sim!lar to go-rich sequence 108622 AA101828 Hs.189956 ESTs 0.46 128286 A1025771 Hs.144090 ESTs 0.46 105760 AA338960 Hs.28170 ESTs 0.46 100020 AFFX control: BioB-3 0.46 105209 AA205072 Hs.227743 KIAA09800.47 protein 111975 841724 Hs.149566 ESTs 0.47 114688 AA121403 Hs.144331 ESTs 0.47 116994 H83918 Hs.40528 ESTs 0.47 118401 N64762 Hs.49053 EST 0.47 110997 N52540 Hs.74316 desmoplakin0.47 (DPI; DPII) 123791 AA620331 Hs.245351 EST 0.47 109858 H02266 Hs.167451 ESTs 0.47 115470 AA287122 Hs.48391 ESTs 0.47 130606 Hs.16593ESTs 0.47 116067 Hs.124823ESTs 0.47 125881 Hs.1507412';3'-cyclic nucleotide0.47 AA775807 3' phosphodieste 124028 Hs.177178ESTs 0.47 108995 Hs.172702ESTs 0.47 125102 Hs.173772ESTs 0.47 110421 Hs.36093ESTs; Weakly similar0.47 H48462 to reverse transcri 105658 Hs.10176ESTs 0.47 129046 Hs.108258actin binding protein;0.47 AA195678 macrophin (microf ~

113639 Hs.17529ESTs 0.48 132575 Hs.5188ESTs; Weakly similarPR0.48 AA045365 to 60S RIBOSOMAL

132592 Hs.5285ESTs 0.48 107619 Hs.60015ESTs 0.48 118664 Hs.230619EST 0.48 127612 Hs.116076ESTs 0.48 192319 Hs.26432ESTs; Weakly similar0.48 855615 to finger protein H

113635 Hs.15543ESTs 0.48 119344 Hs.193348ESTs 0.48 121080 Hs.177953ESTs 0.48 133686 Ns.211614chloride channel 0.48 130395 Hs.87889helicase-moi 0.49 127530 Hs.145728ESTs 0.49 132971 Hs.61700ESTs 0.49 127132 Hs.190440ESTs 0.49 129980 Hs.13969ESTs 0.49 105323 Hs.29075ESTs 0.49 114439 Hs.128629ESTs 0.49 107632 Hs.60179EST 0.49 130952 Hs.21560Human mRNA for AB002296 KIAA0298 gene;
complete c0.49 127595 Hs.130464ESTs 0.49 124276 Hs.221934ESTs 0.49 125935 Hs.30172ESTs 0.49 139275 Hs.25156Human phosphatidylinositol0.49 U45974 (4;5) bisphos 131196 Hs.24129ESTs 0.49 125505 Hs.155071ESTs 0.5 113327 Hs.12097ESTs 0.5 104709 Hs.34579ESTs; Moderately 0.5 AA017146 similar to !!il ALU SUB

115772 Hs.8154ESTs 0.5 118296 Hs.48723ESTs 0.5 131453 Hs.26985KIAA0457 protein 0.5 104734 Hs.32677ESTs 0.5 119358 Hs.193651ESTs; Weakly similar0.5 T70550 to alternatively sp Table 19: B survivor vs Mets - Up in B survivor Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn UniG_ID Complete Title Ratio BSIMet 333601 CH22 FGENES.213 5.5 325300 CH.11 hs 4.67 gi~5866908 333642 CH22_FGENES.231 4.64 333591 CH22 FGENES.208 4.46 332859 CH22_FGENES.27_2 4.39 304013 Hs.156110 4.23 AW518573Immunoglobulin kappa variable 333791 CH22_FGENES.274 4.18 327641 CH.04_hs 4.03 g!~5867890 321172 Hs.133472 3.9 H49160 ESTs 334125 CH22_FGENES.334_4 3.88 333646 CH22_FGENES.234-2 3.88 326554 CH.19_hs 3.84 gi~5867308 333650 CH22_FGENES.238 3.82 333647 CH22_FGENES.235-2 3.79 333626 CH22_FGENES.224_2 3.68 314671 Hs.131914 3.68 AW236550ESTs 310847 Hs.161282 3.67 AI420523ESTs 333657 CH22_FGENES.241 3.65 338522 CH22 EM:AC005500.GENSCAN.395-36 3.64 329464 CH.Y_hs 3.6 gi~6456788 328868 CH.07_hs 3.6 gi~6381930 333637 CH22_FGENES.229 3.59 329737 CH.14_p2 3.5 gi~6065779 317828 Hs.128896 3.44 AI791749ESTs 330520 Hs.6289 3.44 M96995 growth factor receptor-bound protein 339271 CH22_BA354112.GENSCAN.11-2 3.44 314927 Hs.159580 3.42 AI735482ESTs 334782 CH22_FGENES.432 3.42 313138 Hs.196669 3.4 AW138842ESTs 332650 Hs.5541 3.38 H51596 ATPase;
Ca++transporting;
ub!quitous 338648 CH22_EM:AC005500.GENSCAN.460-6 3.38 325677 CH.14_hs 3.34 gi~5867017 312639 Hs.213221 3.33 H50648 ESTs; Weakly similar to !!!!
ALU SUBFAMI

326545 CH.19 hs 3.32 gi~5867307 318364 Hs.138280 3.3 844616 ESTs; Moderately similar to !!!!
ALU SUB

308385 EST singleton 3.26 AI625428(not in UniGene) with exon 328569 CH.07_hs 3.26 g!~6004480 328582 CH.07_hs 3.24 gi~6006033 310975 Hs.170940 3.24 AI492857ESTs 336883 CH22_FGENES.322-2 3.21 324425 Hs.172154 3.2 AW236939ESTs 337870 CH22_EM:AC005500.GENSCAN.48-3 3.19 306624 EST singleton 3.17 A1001043(not in UniGene) with exon 319091 EST cluster 3.16 245264 (not in UniGene) 335247 CH22-FGENES.516 3.12 324945 EST cluster 3.1 AA088768(not in UniGene) 319468 EST cluster 3.09 806504 (not in Un!Gene) 301635 Hs.192662 AI590720ESTs; Weakly similar to ZINC
FINGER
PROT 3.08 321215 Hs.120243 3.04 AW378128ESTs; Weakly sim!larto protein [

328507 CH.07_hs 5868473 3.03 gi~

330266 CH.05_p2 6671885 3.02 gi~

326249 CH.17_hs 5867263 3.01 gi~

325649 CH.14_hs 6588011 2.99 gi~

304575 EST singleton 2.98 AA496437(not in UniGene) with exan 304559 EST singleton 2.97 AA488050(not in UniGene) with exon 338412 CH22_EM:AC005500.GENSCAN.341-25 2.96 308707 EST singleton 2.95 AI769997(not in UniGene) with exon 313027 Hs.184003 2.95 N34307 ESTs; Weakly similarto 1!1! ALU
SUBFAMI

306590 EST singleton 2.95 A1000246(not in UniGene) with exon 306183 EST singleton 2.94 AA922622(not in UniGene) with exon 308611 Hs.203820 AI735372EST; Moderately similar to TRANSLATIONAL
2.94 332454 Hs.11186 2.94 T63265 ESTs; Weakly similar to transformation-r 330061 CH.17_p2 2.94 gi~6721261 317671 Hs.244598 2.93 AW138139ESTs 338705 CH22_EM:AC005500.GENSCAN.480~ 2.93 333737 CH22_FGENES,261 2.9 337756 CH22_EM:AC000097.GENSCAN.109-3 2.9 333572 CH22_FGENES.189_1 2.89 335349 CH22_FGENES,539_2 2.89 328835 CH.07_hs 5868339 2.89 gi~

319886 EST clusternot in UniGene)2.88 AA984628( 311247 Hs.197692 2.87 AI655313ESTs 303887 Hs.193484 2.86 872672 ESTs; Weakly similarto Similarity with 337564 CH22_C65E1.GENSCAN.1-7 2.85 333225 CH22_FGENES.107 2.84 314938 EST cluster 2.83 AA515635(not in UniGene) 305803 EST singleton 2.83 AA846052(not in UniGene) with exon 305264 EST singleton 2.83 AA679505(not in UniGene) with exon 332646 Hs.5337 2.81 AA386264isocitrate dehydrogenase 2 (NADP+);
mito 338508 CH22_EM:AC005500.GENSCAN.391-1 2.81 308097 EST singleton 2.81 AI475411(not in UniGene) with exon 301130 Hs.149418 2.8 AW194167ESTs; Weakly similarto salivary proline 325571 CH.12_hs 2.8 gi~6552439 307054 Hs.176835 2.8 337456 CH22_FGENES,777-2 2.79 317870 Hs.201995 2.79 AI797066ESTs 303171 Hs.64179 2.78 AA065003hypothetical protein 333717 CH22-FGENES.253 2.76 303778 EST cluster 2.76 AW505368(not in UniGene) with exon h 304918 EST singleton 2.76 AA602697(not in UniGene) with exon 319373 EST cluster 2.75 800371 (not in UniGene) 336072 CH22_FGENES.685 2.74 306023 EST singleton 2.74 AA897764(not in UniGene) with exon 336127 CH22 FGENES.701 2.74 337355 CH22_FGENES.728-1 2.73 337885 CH22_EM:AC005500.GENSCAN.54-3 2.73 308506 Hs.119598 2.73 AI686791ribosomal protein 300629 Hs.155101 2.73 AA152119ATP synthase;
H+transporting;
mitochond 333043 CH22 FGENES.70 2.72 327736 CH.05 hs 2.72 gi~5867940 333007 CH22_FGENES.60_4 2.72 321966 EST cluster 2.72 AL122111(not in UniGene) 323179 Hs.156875 2.72 AW452576ESTs 332459 Hs.112933 2.71 AA609625Homo sapiens Tax interaction protein 326224 CH.17_hs 2.71 gi~5867230 329114 CH.X_hs 2.7 gi~5868650 333577 CH22_FGENES.196 2.69 300413 Hs.243443 2.67 AW090347ESTs 304055 EST singleton 2.67 807994 (not in UniGene) with exon 301013 Hs.125262.DKFZP586G1624protein 2.67 337848 CH22~EM:AC005500.GENSCAN.33-1 2.66 327946 CH.06 hs 2.66 gi~5868206 306300 EST singleton 2.66 AA937573(not in UniGene) with exon 331071 Hs.200538 2.65 801646 ESTs 304841 EST singleton 2.65 AA587541(not in UniGene) with exon 301321 Hs.189097 2.65 AI860987ESTs 311280 Hs.197737 2.65 AI767957ESTs; Weakly similar to Y38A8.1 gene pro 338843 CH22_DJ246D7.GENSCAN.B-1 2.64 335720 CH22_FGENES.599_23 2.64 333670 ~ CH22_FGENES.245 2.64 313588 Hs.209667 2.64 AI803591ESTs 335750 CH22_FGENES.602 2.63 333240 CH22 FGENES.111 2.63 332721 Hs.79630 2.62 870212 CD79A antigen (immunoglobulin-associated 338747 CH22_EM:AC005500.GENSCAN.511-1 2.62 303582 EST cluster 2.62 AA377444(not in UniGene) with exon h 336898 CH22_FGENES.330-1 2.62 325835 CH.16_hs ~6552452 2.62 gi 301660 EST cluster(not in UniGene)2.61 F13112 with exon h 335968 CH22 FGENES.652 2.61 336705 CH22-FGENES.63-2 2.6 309815 EST singleton 2.6 AW292760(not in UniGene) with exon 339220 CH22_FF113D11.GENSCAN.6-15 2.6 308582 EST singleton 2.6 AI709056(not in UniGene) with exon 334260 CH22_FGENES.367 2.6 309963 EST singleton 2.6 AW449073(not in UniGene) with exon 300178 Hs.166969 2.59 AI282665ESTs 335690 CH22_FGENES.596_5 2.59 308127 EST singleton 2.59 AI4921$7(not in UniGene) with exon 337835 CH22_EM:AC005500.GENSCAN,22-4 2.58 333251 CH22_FGENES.116 2.58 330319 CH.08_p2 2.58 gi~5932415 314490 Hs.197032 2,57 A1758114ESTs 305934 Hs.75442 2.57 AA878815albumin 329665 CH.14_p2 2.57 gi~6272129 328558 CH.07_hs 2.57 gi~5868489 336094 CH22_FGENES.691 2.57 307899 EST singleton 2,57 AI380270(not in UniGene) with exon 339312 CH22_BA354112.GENSCAN.22-10 2.57 336442 CH22 FGENES.827 2.57 317894 EST cluster 2.56 860848 (not in UniGene) 330435 2.56 Mucin 5b, Tracheobronchial (Gb:X74955) 327304 CH.01 hs 2.56 gi~5867494 308859 EST singleton 2.55 AI830787(not in UniGene) with exon 302224 Hs.161166 2.55 protein 304324 EST singleton 2.54 AA137045(not in UniGene) with exon 338090 CH22_EM:AC005500.GENSCAN.176-3 2.53 334797 CH22_FGENES.434 2.52 303535 EST cluster 2.52 AL043430(not in UniGene) with exon h 339037 CH22_DA59H18.GENSCAN,26-5 2.52 327846 CH.05 hs 2.52 gi~6531962 325271 CH.11 hs 2.52 gi~5866901 .

312385 Hs.215555 2.51 842885 ESTs 302816 Hs.204112 2.51 AI733918ESTs; Weakly similar to alternatively sp 316941 Hs.124591 2.5 AW449871ESTs 300184 Hs.254515 2.5 AI285912ESTs 333762 CH22 FGENES.270 2.5 317028 Hs.189144 AA962623ESTs; Weakly similar to RENAL
SODIUM-DEP
2.5 326266 CH.17_hs 5867264 ' 2.49 gi~

326005 CH.16_hs 5867112 2.49 gi~

301971 Hs.120330 2.48 AJ003125a disintegrin-like and metalloprotease ( 326539 CH.19_hs 2.48 gi~5867307 338896 CH22_DJ32110.GENSCAN.9-4 2.48 306773 EST singleton 2.47 A1040750(not in UniGene) with exon 336279 CH22_FGENES.763 2.47 321017 Hs.227637 2.47 AL050345hypothetical protein 306090 EST singleton 2.47 AA908609(not in UniGene) with exon 333216 CH22 FGENES.104_8 2.46 338593 CH22 EM:AC005500.GENSCAN.435-2 2.46 333587 CH22_FGENES.205 2.46 300396 Hs.232051 2.45 AW295466ESTs 304693 EST singleton 2.45 AA554263(not in UniGene) with exon 338934 CH22_DJ32110.GENSCAN.18-2 2.45 325751 CH.14-hs 2.45 gi~6682474 334137 CH22_FGENES.337_1 2.45 333581 CH22_FGENES.200_1 2.45 302083 Hs.134012 2.44 AI422807C1q-related factor 307318 EST singleton 2.44 AI208577(not in UniGene) with exon 302181 Hs.157732 AW374284Homo sapiens chromosome 19; cosmid 82689 2.44 337425 CH22_FGENES.761-1 2.44 336227 CH22_FGENES.730_2 2.44 314657 Hs.125265 2.44 A1015953ESTs 338529 CH22_EM:AC005500.GENSCAN.398-10 2.44 333680 CH22_FGENES.247 2.43 324834 Hs.250891 2.43 AJ003258ESTs 305093 EST singleton 2.43 AA642917(not in UniGene) with exon 335787 CH22_FGENES.611 2.43 311704 Hs.121512 2.43 AI655206ESTs; Moderately similar to kinesin like 329382 CH.X_hs 2.42 gi~5868868 334785 CH22_FGENES.432 2.42 330130 CH.21_p2 2.42 gi~6002196 327206 CH.01 hs 2.41 gi~5867447 319235 Hs.177633 2.41 F11330 ESTs 334691 CH22_FGENES.420 2.4 327610 CH.04 hs 2.4 gi~5867868 327646 CH.04 hs 2.4 gi~5867894 337093 CH22_FGENES.465-18 2.4 335081 CH22_FGENES.488_4 2.4 333576 CH22_FGENES.193 2.4 337604 CH22_C20H12.GENSCAN.16-5 2.4 329879 CH.15~2 2.4 gi~6466518 328444 CH.07_hs 2.39 gi~5868420 335700 CH22_FGENES.598 2.39 331255 Hs.21446 241009 ESTs; Weakly similar to HYPOTHETICAL
PRO 2.39 327927 CH.O6_hs gi~5868173 2.39 334354 CH22 FGENES.377_1 2.39 308517 EST singleton (not in 2.39 AI689279UniGene) with exon 303669 Hs.233750 copine V 2,39 333648 CH22_FGENES.237_2 2.38 318318 Hs.174463 ESTs; Weakly 2.38 AI653893similar to alpha3b subunit 338336 CH22_EM:AC005500.GENSCAN.310-82,38 304125 EST singleton (not in 2.38 H40976 UniGene) with exon 304983 EST singleton (not in 2.38 AA617786UniGene) with exon 334935 CH22_FGENES.464 3 2.38 314326 Hs,133179 ESTs 2.38 330406 Hs.76901 for protein 2.38 D49490 disulfide isomerase-related 307646 EST singleton (not in 2.38 AI302236UniGene) with exon 338911 CH22_DJ32110.GENSCAN.11-32.38 319952 Hs.225725 ESTs; Moderately2.37 T79532 similar to CGI-101 prot 336878 CH22_FGENES,318-5 2.37 338140 CH22_EM:AC005500.GENSCAN.203-62.37 300564 Hs,225588 ESTs 2.37 304635 EST singleton (not in 2.37 AA523976UniGene) with exon 334091 CH22_FGENES.327 47 2,37 336328 CH22_FGENES.812 7 2.37 325310 CH.11 hs gi~5866864 2.37 338043 CH22 EM:AC005500.GENSCAN.153-22.37 307090 EST singleton (not in 2.37 AI161024UniGene) with exon 335768 CH22_FGENES.607 2 2.37 334969 CH22_FGENES.466 2 2.37 333640 CH22 FGENES.230_2 2.36 330002 CH.16_p2 gi~6623963 2.36 338829 CH22_DJ246D7.GENSCAN.5-122.36 323808 EST cluster (not in 2.36 AW250114UniGene) 327755 CH.05_hs gi~5867955 2.35 306426 EST singleton (not in 2.35 AA975039UniGene) with exon 336481 CH22_FGENES.830 1 2.35 335163 CH2~FGENES.502 7 2.35 322012 EST cluster (not in 2.35 AL137357UniGene) 337345 CH22-FGENES.723-1 2.35 334625 CH22_FGENES.414 3 2.35 320957 EST cluster (not in 2.35 A1878933UniGene) 334915 CH22 FGENES.457 4 2.35 336295 CH22_FGENES.787_1 2.35 321556 Hs.14570 ESTs 2.35 338491 CH22_EM:AC005500.GENSCAN.385-22.35 335517 CH22_FGENES.571_34 2.34 330639 Hs.75854 SULT1Csulfotransferase2.34 310383 Hs.145596 ESTs 2.34 331526 Hs.46624 ESTs 2.34 334396 CH22 FGENES.381 2 2.34 332993 CH22_FGENES.57_2 2.34 327487 CH.02 hs gi~5867785 2.34 335920 CH22_FGENES.636 16 2.33 336463 CH22_FGENES.829 22 2.33 319000 EST cluster (not in 2.33 244318 UniGene) 332992 CH22 FGENES.57_1 2.33 332920 CH22_FGENES.37_6 2.33 337590 CH22-C20H12.GENSCAN.6-52.33 327059 CH.21 hs gi~6531965 2.33 334399 CH22_FGENES.382 5 2.33 300982 EST cluster (not in 2.32 AA837754UniGene) with exon h 327430 CH.02_hs gi~5867754 2.32 326808 CH.20 hs gi~6682504 2.32 309324 EST singleton (not in 2.32 AW015373UniGene) with exon 329779 CH.14_p2 gi~6002090 2.32 330492 Hs.64173 ATPase; H+transporting;2.31 M25809 lysosomal (vacu 330080 CH.19_p2 gi~6015314 2.31 334342 CH22 FGENES,375 20 2.31 336306 CH22 FGENES.793 5 2.31 336400 CH22_FGENES.823_15 2.31 323735 EST cluster (not in 2.31 AA323714UniGene) 334496 CH22_FGENES.397_12 2,31 336075 CH22 FGENES.687_1 2.31 335566 CH22_FGENES.580_1 2.31 337657 CH22_EM:AC000097.GENSCAN.32-92.31 327816 CH.05_hs gi~5867968 2.3 308465 EST singleton (not in 2.3 AI672480UniGene) with exon 330112 CH.19_p2 gi~6015238 2.3 304465 EST singleton (not in 2.3 AA421948UniGene) with exon 308449 EST singleton 2.3 AI660854(not in UniGene) with exon 328171 CH.06 hs 5868071 2,3 giJ

328271 CH.O6 hs 6552415 2.3 giJ

328803 CH.07_hs 6004475 2,3 giJ

330063 CH.19_p2 6165044 2,29 giJ

312281 EST clusternot in UniGene)2.29 H11643 ( 328974 CH.09 hs 2.29 giJ5868520 333859 CH22_FGENES.290_18 2.29 326253 CH.17_hs 2.29 giJ5867263 325703 CH.14_hs 2.29 giJ5867028 338925 CH22_DJ32110.GENSCAN.14-3 2.29 328552 CH.07_hs 2.29 giJ5868489 337244 CH22_FGENES.646-8 2.29 314770 Hs.187694 2.29 AI732722ESTs 324560 EST cluster 2.29 AW502208(not in UniGene) 310603 Hs.156398 2.29 AW376860ESTs 337363 CH22 FGENES.733-2 2.29 308015 Hs.228907 AI440174EST; Weakly similarto GUANINE
NUCLEOTID
2.28 309206 EST singleton 2.28 AI961962(not in UniGene) with exon 337455 CH22 FGENES.777-1 2.28 327605 CH.03-hs 2.28 giJ6004463 301611 Hs.59038 2.28 W22172 ESTs 317222 Hs.130051 2,28 AI206964ESTs 338278 CH22 EM:AC005500.GENSCAN.290-3 2.28 337291 CH22 FGENES.673-2 2.27 337913 CH22_EM:AC005500.GENSCAN.59-10 2.27 306406 EST singleton 2.27 AA971973(not in UniGene) with exon 332947 CH22 FGENES.47_10 2.27 321763 EST cluster 2.27 W01148 (not in UniGene) 304424 EST singleton 2.27 AA293494(not in UniGene) with exon 303782 EST cluster 2.27 T64737 (not in UniGene) with exon h 326943 CH.21 hs 2.27 giJ6004446 324977 Hs.209194 2.27 814439 ESTs 325480 CH.12 hs 2.27 giJ5866957 327743 CH.05 hs 2.27 giJ5867944 333221 CH22_FGENES.105_1 2.26 336498 CH22_FGENES.833_3 2.26 321583 EST cluster 2.26 H84421 (not in UniGene) 334191 CH22_FGENES.352 2.26 327089 CH.21 hs 2.26 giJ6531965 310001 Hs.153827 2.26 F18939 ESTs 304056 EST singleton 2.25 808577 (not in UniGene) with exon 324700 Hs.103913 2.25 AW504745ESTs; Moderately similar to !lll pLU SUB

330637 Hs.95659 2.25 X86371 lethal giant larvae (Drosophila) homolog 307642 EST singleton 2.25 AI302103(not in UniGene) with exon 336985 CH22_FGENES.402-6 2.25 334425 CH22_FGENES.384_13 2.25 321216 Hs.126691 2.25 A1078042ESTs 315785 Hs.150319 2.25 AW205946ESTs 305809 Hs.124580 2.25 331334 Hs.89134 2.25 AA284858ESTs 317131 Hs.189109 2.25 AI991125ESTs 334216 CH22_FGENES.358_1 2.24 330330 CH.08~2 2.24 giJ5670267 326923 CH.21 hs 2.24 giJ6456782 333774 CH22_FGENES.272_5 2.24 324311 Hs.202520 2.24 AA443061ESTs 338551 CH22_EM:AC005500.GENSCAN.413-2 2.24 306716 Hs.251354 2.24 A1024916ESTs 337689 CH22_EM:AC000097.GENSCAN.77-5 2.24 300079 Hs.147178 2.23 334617 CH22_FGENES.411 2.23 336890 CH22_FGENES,326-10 2.23 334495 CH22_FGENES.397 2.23 327301 CH.01 hs 2.23 giJ5867493 337856 CH22_EM:AC005500.GENSCAN.41-3 2.23 307072 Hs.146817 2.23 330515 H.sapiens 2.22 M85247 dopamine D1A receptor gene, co 325943 CH.16_hs 2.22 giJ5867138 338947 CH22_DJ32110.GENSCAN.21-4 2.22 317465 Hs.131360 2.22 AW197361ESTs 332458 Hs.184504 2.22 M33493 tryptase;
alpha 333195 CH22 FGENES.98_17 2.22 304837 EST singleton 2.22 AA587139(not in UniGene) with exon 307602 Hs.231239 2.22 337078 CH22_FGENES.457-1 2.22 335862 CH22_FGENES.629 7 2.22 301979 Hs.121495 potassium 2.22 L28168 voltage-gated channel;
Isk-rel 335668 CH22_FGENES.590_19 2,22 305068 EST singleton (not in 2.21 AA639618 UniGene) with exon 329034 CH.)Lhs gi~5868561 2.21 318403 Hs.143234 ESTs 2.21 328058 CH.06_hs gi~5902482 2.21 335513 CH22_FGENES.571 28 2.21 330803 Hs.150580 putative translation2.21 AA004699 initiation factor 331427 Hs.237339 EST 2.21 338973 CH22 DJ32110.GENSCAN.27-62.2 336723 CH22_FGENES.85-3 2.2 327290 CH.01 hs gi~5867483 2.2 337240 CH22_FGENES.644-1 2.2 306201 EST singleton (not in 2.2 AA926818 UniGene) with exon 303659 Hs.126263 ESTs; Highly 2.2 AA868464 similar to FIBRILLARIN
[H.s 334517 CH22_FGENES.399 7 2.2 334189 CH22_FGENES.352 4 2.2 335199 CH22_FGENES.508 8 2.2 333705 CH22_FGENES.250_19 2.2 305794 EST singleton (not in 2.2 AA845324 UniGene) with exon 303273 EST cluster (not in 2.2 AA316069 UniGene) with exon h 313384 Hs.118335 ESTs 2.2 329158 CH.~hs gi~5868687 2.2 337551 CH22 FGENES.847-8 2.2 328792 CH.07_hs gi~5868309 2.2 303737 EST cluster (not in 2.19 AW502711 UniGene) with exon h 324529 EST cluster (not in 2.19 AW502466 UniGene) 323103 Hs.92030 ESTs 2.19 333773 CH22_FGENES.272 4 2.19 337906 CH22_EM:AC005500.GENSCAN.56-192.19 327129 CH.21 hs gi~6531976 2.19 305710 EST singleton (not in 2.19 AA826544 UniGene) with exan 335595 CH22_FGENES.581 34 2.19 323646 Hs.154412 ESTs 2.19 328368 CH.07_hs gi~5868388 2.19 325802 CH.14 hsgi~6552451 2.19 337167 CH22_FGENES.562-27 2.19 305059 EST singleton (not in 2.18 AA635756 UniGene) with exon 321445 Hs.121590 ESTs; Weakly AW245524 similar to ZINC FINGER
PROT 2.18 332790 CH22 FGENES.2 4 2.18 336750 CH22_FGENES.128-4 2.18 310999 Hs.171012 ESTs 2.18 329798 CH.14_p2 gi~6523160 2.18 327012 CH.21 hs gi~5867664 2.18 304599 EST singleton (not in 2.18 AA506638 UniGene) with exon 335351 CH22_FGENES.539 4 2.18 310661 Hs.223908 ESTs 2.18 332791 CH22_FGENES.3 1 2.17 333022 CH22_FGENES.65_1 2.17 310502 Hs.170422 ESTs 2.17 324963 EST cluster (not in 2.17 AA853440 UniGene) 325275 CH.11 hs gi~5866902 2.17 328338 CH.07_hs gi~5868377 2.17 333063 CH22_.FGENES.75_6 2.17 308895 EST singleton (not in 2.17 AI858423 UniGene) with exon 338685 CH22_EM:AC005500.GENSCAN.472~t2.16 325655 CH.14_hs gi~5867007 2.16 332420 Hs.108074 ESTs; Weakly H49570 similarto CEREBELLIN
1 PRE 2.16 337216 CH22_FGENES.613-10 2.16 335660 CH22_,FGENES.590_11 2,16 337145 CH22_FGENES.542-2 2.16 335753 CH22 FGENES.604 2 2.16 301766 EST cluster (not in 2.16 802224 UniGene) with exon h 303442 Hs.152510 ESTs; Weakly AI953998 similar to L-SERINE
DEHYDRA 2.16 311009 Hs.210589 ESTs 2.16 307093 EST singleton (not in 2.16 AI167606 UniGene) with exon 300262 Hs.170810 ESTs 2.16 337989 CH22_EM:AC005500.GENSCAN.112-72.16 326263 CH.17_hs gi~5867264 2.16 319402 EST cluster (not in 2.16 W21298 UniGene) 321010 Hs.227150 Homo sapiens 2.16 Y17456 LSFR2 gene; last exon 301706 Hs.241496 ESTs 2.16 307412 Hs.241507 ribosomal 2.16 AI241753 protein S6 335662 CH22_FGENES.590_13 2.15 332480 Hs.12570 tubulin-specific2.15 AA092932 chaperone d 329273 CH.X_hs gi~5868762 2,15 339383 CH22_BA232E17.GENSCAN.3-20 2.15 332795 CH22_FGENES.S-1 2.15 335227 CH22_FGENES.513 13 2.15 326925 CH.21 hs gi~6456782 2.15 332403 AA424199 Hs.106529 ESTs; Highly similar to CGI-65 protein [ 2.15 317786 AI859605 Hs.155686 ESTs 2.15 326582 CH.19_hs gi~5867318 2.15 336494 CH22_FGENES.832_11 2.15 329656 CH.14_p2 gi~6448516 2,15 307581 AI284415 EST singleton (not in UniGene) with exon 2.15 335670 CH2~FGENES.591 2 2.14 332452 AA040369 Hs.11170 SYT interacting protein 2.14 309387 AW079943 Hs.156110 Immunoglobulin kappa variable 1D-8 2.14 308427 AI652677 Hs.195055 EST 2.14 322027 NM_004551 EST cluster (not in UniGene) 2.14 301693 245023 EST cluster (not in UniGene) with exon h 2.14 334308 CH22_FGENES.373_11 2.14 301131 AW134518 Hs.131807 ESTs 2.13 338495 CH22_EM:AC005500.GENSCAN.387-1 2.13 329600 CH.10_p2 gi~3962481 2.13 307980 AI431696 EST singleton (not in UniGene) with exon 2.13 337260 CH22 FGENES.652-15 2.13 304655 AA527887 EST singleton (not in UniGene) with exon 2.13 303141 AF195951 EST cluster (not in UniGene) with exon h 2.13 327957 CH.06 hs gi~5868210 2.13 334317 CH22_FGENES.374_1 2.13 302870 AF011407 EST cluster (not in UniGene) with exon h 2.13 333806 CH22_FGENES.278 2 2.13 329947 CH.16~2 gi~5540101 2.13 309602 AW182523 EST singleton (not in UniGene) with exon 2.13 322790 AI700273 Hs.122162 ESTs; Weakly similar to KIAA0557 protein 2.13 337706 CH22_EM:AC000097.GENSCAN.87-11 2.13 306894 A1092731 EST singleton (not in UniGene) with exon 2.13 325530 CH.12_hs gi~6525289 2.12 321087 AL110227 Hs.241533 Homo sapiens mRNA; cDNA DKFZp434J194 (fr 2.12 309853 AW298169 Hs.57553 tousled-like kinase 2 2.12 326822 CH.20_hs gi~6117831 2.12 328776 CH.07_hs gi~5868309 2.12 335112 CH22_FGENES.494 20 2.12 334564 CH22_FGENES.405 4 2.12 333455 CH22_FGENES.157 4 2.12 317395 855044 Hs.124130 ESTs 2.12 334221 CH22_FGENES.360_1 2.12 331374 AA442134 Hs.70573 ESTs; Weakly similar to HINT PROTEIN [H. 2.12 304473 AA428343 Hs.140 immunoglobulin gamma 3 (Gm marker) 2.12 328907 CH.08_hs gi~5868493 2.12 319448 805539 Hs.108738 ESTs 2.12 333676 CH22_FGENES.247 3 2.12 324767 AA630931 Hs.34348 Homo sapiens mRNA; cDNA DKFZp434P0235 (f 2.12 318585 243405 EST cluster (not in UniGene) 2.12 331732 AA251192 Hs.177708 ESTs 2.12 329553 CH.10_p2 gi~3962492 2.12 336910 CH22 FGENES.343-6 2.12 326959 CH.21 hs gi~6469836 2.12 305417 AA725228 EST singleton (not in UniGene) with exon 2.11 301573 AI150328 Hs.226402 ESTs; Weakly similar to mitochondrial ci 2,11 326935 CH.21_hs gi~6004446 2.11 335176 CH22_FGENES.504 6 2.11 337210 CH22_FGENES.603-5 2.11 311284 AW027025 Hs.239262 ESTs 2.11 330240 CH.05_p2 gi~6671858 2,11 327463 CH.02_hs gi~6004455 2.11 332938 CH22_FGENES.41 3 2,11 332785 CH22_FGENES.1 1 2.11 301035 AI358105 Hs.123164 ESTs 2.1 305712 AA826701 EST singleton (not in UniGene) with exon 2.1 318651 AW003150 Hs.240165 ESTs 2.1 302753 M74299 EST cluster (not in UniGene) with exon h 2.1 334635 CH22_FGENES.417 2 2.1 319447 AA456745 EST cluster (not in UniGene) 2.1 301204 AW008544 Hs.239994 ESTs 2.1 333950 CH22_FGENES.303_6 2.1 325947 CH.16_hs gi~5867138 2.1 337683 CH22_EM:AC000097.GENSCAN.76-1 2.1 328962 CH.OS_hs gi~6456775 2.1 336655 CH22_FGENES.34-3 2.1 336596 CH22 FGENES.163 2 2.1 330486 Hs.833 interferon-stimulated2.1 M13755 protein;15 kDa 314356 Hs.125143 ESTs 2.09 314976 Hs.162108 ESTs 2.09 336650 CH22_FGENES.29-6 2.09 339026 CH22_DA59H18.GENSCAN.22-62.09 302395 Hs.114606 ESTs 2.09 323280 EST cluster (not In 2.09 AI910263UniGene) 338857 CH22 DJ32110.GENSCAN.1-12.09 335374 CH22_,FGENES.543_12 2.09 308766 EST singleton (not in 2.09 AI808510UniGene) with exon 331027 Hs.6168 KIAA0703 gene 2.09 N48584 product 337853 CH22_EM:AC005500.GENSCAN.37-12.09 302498 EST cluster (not in 2.09 NM_002991UniGene) with exon h 312607 Hs.169375 ESTs 2.09 314309 Hs.184352 ESTs; Weakly 244049 similar to cDNA EST
EMBL:D3 2.09 311695 Hs.135562 ESTs 2.09 333280 CH22 FGENES.126 2 2.09 333518 CH22_FGENES.173_3 2.09 337199 CH22_FGENES.583-11 2.09 337819 CH22_EM:AC005500.GENSCAN.13-92,08 300546 Hs.250913 ESTs 2.08 322577 Hs.59075 ESTs; Weakly 2.08 AA354452similar to WD40 protein Cia 336028 CH22_FGENES.672_1 2.08 300238 Hs.254030 ESTs 2,08 307429 EST singleton (not in 2.08 AI243573UniGene) with exon 326444 CH.19_hs gi~5867385 2.08 310641 Hs.254727 ESTs 2.08 337633 CH22_C20H12.GENSCAN.32-12.08 336008 CH22-FGENES.668_6 2.08 339030 CH22_DA59H18.GENSCAN.24-12.08 333952 CH22 FGENES.303 8 2.08 329149 CH.X_hs gi~5868685 2.08 335192 CH22-FGENES.507 7 2.08 308225 Hs.177592 ribosomal 2.08 AI557713protein; large; P1 330519 Hs.69949 calcium channel;2.08 M94172 voltage-dependent;
L iy 331809 Hs.97312 ESTs 2.07 324837 Hs.246171 ESTs 2.07 332608 Hs.36972 CD7 antigen 2.07 D00749 (p41) 327291 CH.01 hs gi~5867483 2.07 315936 Hs.247094 ESTs; Moderately2.07 AW069807similarto 7777 ALU
SUB

317917 Hs.129419 ESTs 2.07 328674 CH.07_hs gi~5868254 2.07 338654 CH22_EM:AC005500.GENSCAN.460-552.07 320828 Hs.194728 hexose-6-phosphate AJ012590dehydrogenase (glucos 2.07 337896 CH22_EM:AC005500.GENSCAN.56-32.07 335310 CH22_FGENES.532_3 2.07 300076 Hs.145223 ESTs 2.07 303588 EST cluster (not in 2.07 AL046182UniGene) with exon h 328848 CH.07 hs gi~6381921 2.07 318723 EST cluster (not in 2.07 C18060 UniGene) 335352 CH22_FGENES.539 5 2.07 339316 CH22_BA354112.GENSCAN.22-152.06 335873 CH22_FGENES.631 1 2.06 335261 CH22_FGENES.520_2 2.06 322032 EST cluster (not in 2.06 AL079807UniGene) 308771 EST singleton (not in 2.06 AI809301UniGene) with exon 310024 Hs.145224 ESTs 2.06 320555 Hs.235534 ESTs 2.06 319314 EST cluster (not in 2.06 T74062 UniGene) 334642 CH22_FGENES.417 9 2.06 335767 CH22_FGENES.607_1 2.06 336159 CH22_FGENES.707 3 2.06 336358 CH22_FGENES.818_1 2.06 334687 CH22_FGENES.419_12 2.06 339389 CH22_BA232E17.GENSCAN.4-72.06 335898 CH22_FGENES.635 6 2.06 328847 CH.07 hs gi~6381920 2.06 313431 EST cluster (not in 2.06 W91884 UniGene) 313270 Hs.159611 ESTs 2.06 339211 CH22_FF113D11.GENSCAN.6-62.06 333860 CH22_FGENES.290_19 2.06 308952 Hs.224226 EST 2.06 305471 EST singleton (not in 2.06 AA743947UniGene) with exon 300619 Hs.233293 ESTs 2.06 302962 AI693349 Hs.228981 EST 2.06 332446 AA112799 Hs.238756 ESTs; Weakly similar to unknown [H.sapie 2.06 334972 CH22_FGENES.468 2.05 330196 CH.05_p2 2.05 gi~6165140 304754 EST s!ngleton 2.05 AA579795(not in UniGene) with exon 309726 Hs.195188 2.05 AW248521glyceraldehyde-3-phosphate dehydrogenase 333939 CH22_FGENES.301 2.05 304836 EST singleton 2.05 AA587008(not in UniGene) with exon 302087 EST cluster 2.05 AA324163(not in UniGene) with exon h 308424 EST singleton 2.05 AI650714(not in UniGene) with exon 304347 EST singleton 2.05 AA176914(not in UniGene) with exon 333141 CH22_FGENES.85_1 2.05 310573 Hs.156142 2.05 AW292180ESTs 337565 CH22_C65E1.GENSCAN.1-11 2.05 304295 EST singleton 2.05 AA084082(not in Un!Gene) with exon 326624 CH.20_hs 2.05 gi~5867553 326443 CH.19_hs 2.04 gi~5867385 339012 CH22_DA59H18.GENSCAN.19-2 2.04 337384 CH22_FGENES.745-1 2.04 332326 Hs.111787 2.04 T79623 ESTs 303706 EST cluster 2.04 AW501525(not!n UniGene) with exon h 336046 CH22_FGENES.679_8 2.04 301770 EST cluster 2.04 805887 (not in UniGene) with exon h 326726 CH.20_hs 2.04 gi~5867597 330485 Hs.113216 2.04 M11186 oxytocin;
prepro-(neurophysin I) 332956 CH22_FGENES.48_13 2.04 300021 AFFX control: 2.04 306872 EST singleton 2.03 A1086920(not in UniGene) with exon 302744 EST cluster 2.03 L03151 (not in UniGene) with exon h 338507 CH22 EM:AC005500.GENSCAN.390-11 2.03 334020 CH22_FGENES.317_1 2.03 333870 CH22_FGENES.291 2.03 330552 Hs.248157 2.03 040223 pyrimidinergic receptor P2Y; G-protein c 335486 CH22_FGENES.570_18 2.03 339374 CH22_BA232E17.GENSCAN.25 2.03 328384 CH.07_hs 2,03 gi~5868392 334690 CH22_FGENES.420_3 2.03 310318 Hs.145338 2.03 AI733942ESTs 325893 CH.16_hs 5867088 2,03 gi~

331373 Hs.178170 y sim!lar AA435513ESTs; Weaklto DUAL SPECIFICITY
2.03 329784 CH.14_p2 2.03 gi~5912597 335087 CH22_FGENES.488_11 2,03 310582 Hs.254585 2.03 AI336563ESTs 332611 Hs.1600 2.03 806751 chaperonin containing TCP1; subunit 5 (e 339258 CH22_BA354112.GENSCAN.B-3 2,03 336851 CH22_FGENES.274-1 2.03 305596 Hs.8734 2.03 AA780664ESTs; Moderately similar to 1!!!
ALU CLA

330364 CH.X~2 g!~3126882 2.03 302940 EST cluster 2.03 AL137619(not in Un!Gene) with exon h 317349 Hs.126359 2.03 AA923657ESTs; Weakly similar to !!!!
ALU SUBFAMI

309869 EST singleton 2.03 AW300314(not in UniGene) with exon 333422 CH22_FGENES.147_2 2.03 325233 CH.10_hs 2.03 gi~6381943 330586 Hs.79564 2.03 077968 neuronal PAS domain protein 336725 CH22_FGENES.88-1 2.02 334157 CH22_FGENES.340 2.02 303357 Hs.159643 2.02 AW006352ESTs; Weakly similar to MLD
[H.sapiens]

328533 CH.07_hs 2.02 gi~5868482 309210 EST s!ngleton 2.02 AI962817(not!n UniGene) w!th exon 327412 CH.02 hs 2.02 gi~5867750 333172 CH22_FGENES.94_7 2.02 334869 CH22_FGENES.447 2.02 301047 Hs.116136 2.02 AA971465ESTs 329394 CH.X_hs 2.02 gi~6478817 301736 EST cluster 2.02 F12128 (not in UniGene) with exon h 335591 CH22_.FGENES.581 2.02 338234 CH22_EM:AC005500.GENSCAN.260-7 2.02 334433 CH22_FGENES.385 2.02 334904 CH22_FGENES.452_18 2.02 ~

318443 Hs.157714 AI939323ESTs; Weakly similarto NEUR ACETYLCHOLI
2.02 300151 Hs.189654 2.01 AI243445ESTs 310348 Hs.145519 2.01 AI478563ESTs 310898 Hs.165742 2.01 AI439868ESTs 332860 CH22_FGENES.27_3 2.01 301699 EST cluster 2.01 AI879117(not in UniGene) with exon h 332554 Hs.23111 2.01 W96450 phenylalanine-tRNA
synthetase-like 327994 CH.06_hs gi~5868218 2.01 315613 Hs,192311 ESTs 2.01 335356 CH22_FGENES.541 3 2.01 334028 CH22_FGENES.318 7 2.01 335277 CH22_FGENES,523 3 2,01 308657 Hs.236497 EST; Weakly KR 2.01 AI749855similar to GLANDULAR
KALLI

305913 EST singleton (not in 2.01 AA876109UniGene) with exon 323681 Hs.102548 glucocorticoid2,01 AW247730receptor DNA binding fact 333533 CH22_FGENES.175_20 2.01 328753 CH.07_hs gi~5868298 2.01 302397 Hs.211523 guanine nucleotide2,01 L01694 binding protein (G
pr 304643 EST singleton (not in 2.01 AA526588UniGene) with exon 333065 CH22_FGENES,75_8 2.01 316192 Hs.221286 ESTs 2 302533 Hs.248116 chemokine 2 L36149 (C motif XC receptor 312988 Hs.123436 ESTs 2 333612 CH22_FGENES.217 7 2 333615 CH22_FGENES.217_10 2 316085 Hs.132300 ESTs 2 337936 CH22_EM:AC005500.GENSCAN.85-72 330972 Hs.118983 ESTs; Weakly 2 H18467 similar to diaphanous 1 [H.

Table 20: B survivor vs Mets - ZTp in Mets Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Pkey Ex Accn UniG_ID Complete Title Ratio BSIMet 316625 Hs.122156ESTs 0,28 316076 Hs.116424ESTs 0.3 315943 Hs.117335ESTs 0.38 317198 Hs.128025ESTs 0.38 320082 Hs.189738ESTs 0.39 313510 Hs.154006ESTs 0.39 323683 Hs.225033ESTs 0.39 318558 Hs.90372ESTs 0.4 310264 Hs.148867ESTs 0.4 314945 Hs.192715ESTs 0.41 313403 Hs.113157ESTs 0.42 321505 Hs.129885ESTs 0.43 312171 Hs.138211ESTs 0.43 324585 Hs.132678ESTs 0.44 316695 EST cluster (not 0.44 AA809844 in UniGenej 319818 Hs.136952ESTs 0.44 337522 CH22_FGENES.819-1 0.45 324714 Hs,245737ESTs 0.45 315060 Hs.189048ESTs 0.46 300548 Hs.114689ESTs 0.47 304483 EST singleton (not0.47 AA431441 in UniGene) with exon 313096 Hs.163533ESTs 0.47 306501 EST singleton (not0.47 AA987294 in UniGene) with exon 329086 CH.X_hs gi~58686040.47 320116 Ns.133325ESTs 0.47 320418 Hs.199638ESTs 0.47 302982 Hs.198222ESTs; Weakly similar0.48 W92391 to C2H2-type zinc f 315609 Hs,224012ESTs 0.48 317056 Hs,250643ESTs 0.48 314361 Hs.161304ESTs 0.49 315169 Hs.158667ESTs 0.49 323743 Hs.257168ESTs 0.49 313903 Hs.190651ESTs 0.49 315061 Hs,188952ESTs 0.49 300969 Hs.76230ribosomal protein 0.5 331950 Hs.99369ESTs 0.5 315076 Hs.168457ESTs 0.5 300975 Hs.149668ESTs 0.5 Table 1-20A, shows the accession numbers for those pkeys lacking unigeneID's for Tables 1-20. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubleTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column.
Pkey: Unique Eos probeset identifier number CAT number: Gene cluster number Accession: Genbank accession numbers Pkey CAT Number Accesssion D12765 Ai911646 D82208 D82187 AW074031 AI358527 AW338497 AA970893 AW072573 AW516989 AL038160 AA577334 Af865872 AA994043 AA922583 AA464778 AA209178 AI752979 AW627538 Ai127171 AA029542 AI567601 Ai362353 BE162140 AI381384 BE152851 D57038 D57043 AI418363 100670 22023-1 AA332178 BE259177 BE545625 T09105 S62076 M16424 NM_000520 AW082447 AA91685d AA916855 T05970 100673 21517_2 AW403342 AW248986 BE561709 AA357312 BE311834 BE389496 BE294887 100700 17137_1 AA932794 BE540417 AW409802 AW410765 BE296651 BE294197 BE164813 NM_005275 AA436745 AI122671849779 100734 35197_1 A1807481 A1500404 A1092260 BE348962 A1143675 AA772399 AA772398 NM_000141 M87770 X52832 M55614 271929 W05259 AA548551 AI498743 BE081295 AA687581 A1073906 AI263602 AI869111 AI805693 Ai423808 A1076491 AI374640 H82967 117040 46956_1 AW970600 AA503323 H89218 AF086031 H89112 100779 458_127 BE561958 BE561728 BE397612 BE514391 BE269037 BE514207 BE562381 100787 458_127 BE561958 BE561728 BE397612 BE514391 BE269037 BE514207 BE562381 130872 21268_1 061084 NM_004900 061083 AI761325 AI826909 H79385 T81886 108641 853= 13 AA112059 100818 19604_3 079251 AA843851 838201866461 844908 AA683289 H17477 837364 852832 AW298336 AA351391 NM_002545 L34774 130930 2773_1 NM 005658 019261 BE622108 AA313592 AW950162 H25107 871725 850630 AI378122 AI554908 AI927196 Ai913959 AW044513 850534 AI379950 AI311593 BE043305 124394 5590_5 AI950447 AW027427 AI640151 AI139433 AI400708 AW779975 A1739122 100882 458_127 BE561958 BE561728 BE397612 BE514391 BE269037 BE514207 BE562381 100885 12707_3 X07881 NM-006249 X07637 AA376715 AA376677 X07715 X07704 S80916 100898 8542_1 BE387614 851501 AA199714 AW674779 F08178 BE269071 AA376313 108706 13255_-3 AA121820 108710 133560_1 AA121959 AA121960 AI284079 AA936692 AA903953 AA947753 AI568924 AA902966 AA807082.AA489337 N58247 108785 4962_-6 AA128946 102156 33676_1 H08948 AA353935 814985 U17977 H15387 F05567 888476 AW968314 102186 33745_1 U20285 AW674959 W69617 NM 004127 AU076538 BE245805 AW250694 125077 1814028_1 T88822 T80794 124440 22853_1 AA532519 AA770627 BE326342 AW073299 AW205539 283851 AA725380 100941 3303_2 U15422 NM_005425 X63758 X63759 246940 L03378 A1220577 AA634325 117291 1047256_1 N81189 AW172914 N22182 N22289 132316 10556_2 U28831 AA088359 N56023 AA069486 AL038872 A1683185 AA632516 AA928183 N90591 AW794070 AI884470 AA219147 AI632560 AA553416 T1031 i 102337 553_1 AI814663 AA806761 AA765241 AA019317 AA092255 AA035405 T85079 131862 3673_14 AI541246 AW055046 8E312897 NM 006623 AF006043 AL038012 BE256739 117435 23179_1 AF151074 AF070529 AI969222 AW874125 AI198308 AW470316 A1079388 102459 3556 1 048936 L36592 X87160 NM_001039 AL036606 AL036420 035630 AW298574 125324 1692163_1 807785 T85948 T86972 101809 32963_1 M86849 AA315280 NM_004004 AA315269 BE142653 AA461400 AW802042 125315 16354_ 4 H72971 126008 190485_1 AA827860 AA253460 AW971543 103163 43223_1 AU077018 X67683 102515 10404_1 089337 AF019413 Y17868 AL044866 M25813 AL042665 N77388 800971 126055 14930_1 H65527 N28990 AA359399 N24306 H65329 AA056928 AW504127 AA486661 126065 34268_1 AA221032 AK001651 AW732625 BE140495 AI366484 BE297579 AL039675 132640 179_1 AW162087 AA224538 AA471218 AA088655 AA375275 BE440052 AF090891 102571 31561 1 060115 NIu~001449 029538 F01103 060118 AW612050 F33160 F37125 101923 30543_1 X99133 X83006 W38398 AA401137 AA298242 AA366738 AA308126 126117 1610460_1 W01520 H78617 126136 285360_1 H85525 H83353 AA418447 126196 21198_2 AA084092 AA084394 126256 10840_1 AK001774 802029 221327 802030 221124 126291 86990_1 AA017609 N42090 AA984485 BE177239 AI912269 104008 27385_1 AW134482 N93060 AI694673 AW241458 AI161320 AI582177 AI623166 ' A1091339 AA830587 A1051323 N67319 AA621436 AA449856 AA648966 AA954973 N51766 103417 15279_1 L34657 M28526 NM 000442 M37780 AW407571 AA488822 AF281299 103425 30014_1 AB016092 AB016089 AW161159 AW160794 AW163150 AA776677 AW168207 103436 42952_1 X98206 AA693431 AA244304 102806 8441 2 A1246240 AF124733 NM_016358 U90306 BE407995 BE281254 A1566193 103491 36109_1 ~ AF264750 AA904457 AW884708 BE183627 Y08478 AW962945 AA305849 126363 185896_1 N94706 AW302202 N54724 W01777 AI949662 AA917338 N50068 127027 41793_1 AL390088 BE207034 242964 BE242833 AW583731 BE616399 BE621126 127036 1150_2 A1468598 AA232868 AL043752 AW881016 AW881015 AW881214 AW880761 103513 42559_1 Y10209 AW341910 127041 1534405_1 243067 F12549 F06090 811929 T74454 812925 126406 95703_1 N76683 AA034096 AA034082 127064 1690305_1 T84214 243709 805654 133660 27207_1 H14843 C14857 F06523 AA322683 AW964649 H83334 AW894647 AW894608 125877 18687_2 AW969436 AK000755 AA176076 BE258269 103650 43833_1 H16443 T66760 H11411270220 F12208 T66258 AW950931 AA350846 127191 206872_1 AA625286 AA297581 AA303053 AA303052 103682 41323_1 AF275815 AA018302 AA000993 AA021290 H86017 869197 AA056286 126568 163056_1 AW749469 W68106 BE162986 AA190515 125925 1502610_1 BE550996 H28737 125953 1582862_1 H41682 H40829 104328 243947_1 811272 D81932, 127231 221630_1 AA317400 AA434584 127331 379388_1 F20186 AA622352 127347 133106_1 A1922293 A1123420 AA833906 A1417534 AA402715 AW275969 AA470879 127357 288073_1 AA424107 AA452788 127359 16354_-4 H72971 127378 299674_1 AA446387 AA452696 126730 297653_1 AA442429 T19477 126759 109907_1 AA063089 AA679118 AA063642 126762 110350_1 AA064613 AA064671 112309 1576900_1 855021 H26613 128099 501940_1 AA905327 A1148973 127452 327502_1 AA504447 AA491317 126844 133298_1 AW881997 AA121637 AA299325 103985 19574_1 AB032251 AW852071 AA279887 AW852124 AW129468 AI583544 AA704421 AW975302 AA541375 Ai479002 AW006220 N51384 AI142472 AA659902 AA534253 D58103 126872 142696_1 AW450979 AA136653 AA136656 AW419381 AA984358 AA492073 BE168945 127568 479942_1 AW892676 AA853877 D44747 126977 171173_1 AA210697 AW962138 AA309665 AA210819 126982 171753_1 AA211419 AA211566 113195 178688_1 H83265 T63524 AA304359 AW960551 AI672874 AI749427 AA227777 128260 38164_1 AF119848 Ai132994 AA505575 AI307657 AW205687 AW291922 AI347642 128279 1561282_1 H18818 H08885 113213 23798_1 NM_001395 Y08302 AI434619 AI470328 AI261807 AW024965 AI806537 120461 22556_18 AA810830 AA251301 AW962926 AW962922 AW962925 AA371510 AW817535 127787 458957_1 AA809310 AW975709 112746 93768_1 AA541537 AW009489 AW950203 F25552 AA834645 N56270 AA029543 128410 288073_1 AA424107 AA452788 127854 443883_1 AW976796 AA769520 120606 39874_1 AF169690 F08337 AA282956 AA282955 120734 208882_1 AA299948 AA299949 105897 8177_1 H03573 AA310766 AL133603 A1700910 H00505 882804 H60605 T10498 100097 17246_13 AF002224 AA017358 AL119785 AI379446 AI632616 106782 83684_1 AW054886 848313 A1200750 A1358095 H28124 AW613845 AA010033 114610 117244_1 AA525225 AA525299 AA081079 114636 109698_1 AA075488 AA129081 AA074851 AA082852 AA074732 AA084908 AA084751 107518 45315_1 X60152 AI871483 AI871473 AI871251 AI631860 130420 23038_2 NM 003105 U60975 Y08110 AW501858 AA984813 AL042811 C14671 100403 19804_1 AA302974 AW952936 AA297841 T17453 AL040862 AL042305 818514 AI969799 AI216685 AL117466 NM_016733 D85527 AW992053 244073 BE078508 870709 100476 24092-2 NM_001907 X71877 X71874 BE140276 AA748397 AA213801 AA830996 108360 112653_1 AA129037 AA071539 AA071460 AA129036 108390 112416_1 AA121999 AA121985 AA071108 AA071116 AA071434 AA148869 AA075070 108392 113549_1 AA075124 AA075208 100534 20653_36 T85231 AW161503 AW401856 BE397508 BE387085 BE514425 BE387606 100544 22955_11 M55405 AW752552 100545 22955_11 M55405 AW752552 124087 1561179_9 H08773 837687 100560 30266_1 299916 071216 NM 004076 X15144 X15145 X15146 AA652300 100571 7592_1 L14561 AW496834 AW059849 299413 T29666 814900 893603 851525 100572 13049_1 M60495 M60499 M60500 M24355 M62201 BE389102 M96943 L01090 100582 26433_2 D13897 AI183955 NN~004160 D13899 L25648 AW136574 AI654355 108409 113869_1 AA075631 AA075578 100627 Ggr_HT2798 225424 123526 genbanI~AA608657 AA608657 100663 tigr_HT3059 M20022 M32505 M32506 M32507 M32508 X64880 X87678 X87680 100684 tigr_HT3283 S66933 015688 100687 tigr_HT3291 L18862 100695 tigr_HT315 M31126 M38243 M74197 M94890 004323 008196 008197 116389 genbanILAA599011 AA599011 100702 tigr_HT3413 L27065 100756 tigr_HT3768 M88357 100809 tigr_HT4261 L33990 100810 tigr_HT4262 L33994 100854 tigr_HT4464 008607 102185 entrez_U20230U20230 125090 genbank_T91518 T91518 100961 entrez_J00148 J00148 102254 enUez_U28131U28131 125145 NOT_FOUND entre~W38001 W38001 125153 NOT_FOUND entrez_W38294 W38294 116797 genbanILH40486 H40486 102354 entrez_U38268U38268 102474 entrez_U49973U49973 116902 genbanILH70739 H70739 116905 genbaniLH71420 H71420 102643 entrez_U67849U67849 125576 205199_1 821635 866208 118579 genbank_N68905 N68905 120256 genbanILAA169801 AA169801 120274 genbanILAA177051 AA177051 113149 genbanILT51588 T51588 127759 808057_1 A1369384 AA719568 113608 genbank_T93113 T93113 101046 entrez_K01160K01160 122731 genbank-AA457549 AA457549 108316 genbank-AA070160 AA070160 108328 genbank_AA070204 AA070204 108394 482708_1 AA642953 AA075144 AA084113 AA070130 108395 482708_1 AA642953 AA075144 AA084113 AA070130 108436 genbank-AA078801 AA078801 108491 genbanhAA082973 AA082973 108499 genbank_AA083103 AA083103 122922 genbanILAA476268 AA476268 122938 genbank_AA477119 AA477119 122948 genbank_AA477483 AA477483 117046 genbanILH89505 H89505 101427 entre~M19508 M19508 101559 entrez_M32053 M32053 117437 genbank_N27645 N27645 101798 entrez_M85220 M85220 117590 genbank_N34904 N34904 110349 genbanhH40988 H40988 101909 entrez_S69265569265 103392 entrez_X94563X94563 119053 genbanl~R11501 811501 103457 entre~X99728X99728 119174 genbank_871234 871234 119229 genbank_T03229 T03229 103654 entrez-270759270759 103679 entrez_Z86000Z86000 119329 genbank_T51832 T51832 119343 genbank_T62873 T62873 119347 genbank_T64349 T64349 119523 NOT_FOUND entrez_W38041 W38041 119526 NOT_FOUND entrez_W38049 W38049 119529 NOT_FOUND entrez_W38053 W38053 119564 NOT_FOUND entrez_W38206 W38206 119566 NOT FOUND entrez_,W38209 W38209 126908 533102_1 AA180024 AA169866 119906 genbanlc_W85818 W85818 123022 genbank_AA480909 AA480909 114604 485245_1 AA075966 AA076128 AA128755 AA128339 114666 genbank_AA112274 AA112274 100221 entrez_D28383D28383 123143 genbanhAA487595 AA487595 114718 480609_1 AA080912 AA075318 AA083403 AA078992 AA076594 AA062835 AA084926 100478 Ggr_HT1067 M22406 100547 tigr_HT2219 M57417 100563 tigr_HT2324 211585 100564 tigr_HT2324 211585 123473 genbanItAA599143 AA599143 123490 genbank_AA599723 AA599723 322024 43541_1 AA334384 AL137436 AA352089 AW341247 BE327629 A1669284 A1274156 322033 33332_1 AL137507 AW879790 AA349971 AI624899 AW294742 AW271762 T06484 314251 194954_1 BE011657 AA713589 AI440513 AA278620 320825 29807_1 NM_004751 AF102542 AW360893 AF038650 BE304708 AW360892 AW360931 320882 41486_1 AK000655 AW024515 AI499162 AI673527 AA903900 AW084419 AI219549 D60890 AW243134 AI832098 AI8,11630 BE348831 322128 46785_2 895860 AF085903 895859 AI346033 321525 27440_1 AJ006077 AA377082 H78875 AA263148 AW958548 AA381830 AA381631 320913 24943_3 AA663733 D62598 D62472 321583 87512_1 AA018518 AA059305 320957 39063_1 AF151534 AI929478 W40378 H17557 AW163309 BE074271 AW854041 AW176505 AA318946 AA705230 AW136167 AA704931 AW157512 W93328 Ai694445 AW157539 322209 46967_1 H89360 AF086037 H89546 322224 47029_1 AF086064 AA013034 N50099 AW903279 322264 47231_1 AF086242 W67679 322265 47233_1 AF086244 W68829 A1539008 W68737 A1685168 A1351133 A1633948 314429 238740_1 BE146577 AA339680 AA972551 BE146576 306624 25108_1 AA329384 549006 AW405735 AW404287 AW405848 AW405979 BE538908 306644 34348_2 BE263222 BE312445 A1002913 306669 7570_1 A1340462 A1583268 AA079086 A1950777 A1301866 A1925108 AW876954 322309 47372_1 W76622 AF086372 W72660 322337 47496_1 AA249804 AF086490 W93549 322340 47509_1 AF088076 W95222 W92523 322362 36526_1 AF039697 A1860821 AW406650 AW515052 849969 AA834501 A1951401 321708 64670_1 AA126365 AA055269 AI768638 N46910 BE047017 AA488423 AW021548 321763 166644_1 AA195602 W01148 N40632 313913 653504_2 AW391342 A1813778 AW190911 A1963486 BE049275 A1922735 A1935914 306710 52443_1 BE564350 A1024221 313960 130872_1 AA113301 AA130859 A1805438 AA846950 AA130915 AW862833 323014 140817_1 AA305198 AW962351 AA134366 AA259244 315276 383168_1 AA860090 AI961138 AW592114 AW087700 AI798907 AW340674 321847 45225_1 T08401 283934 T16897 308069 33294_5 A1470895 BE386951 BE39168D BE277351 BE385202 BE300283 BE299619 314661 296144_1 AA578229 AA436432 AA481375 AA481363 307474 25106_2 AB037864 AI223793 AI916099 AI332699 AI264023 AW962587 AA412310 322505 38889_1 AF147315 AW173079 T53029 323170 980026_1 U83527 AL120938 U83522 322518 38914_1 A1133446 T50819 AF147343 T50665 323183 3032_1 X73874 NM_002637 F00757 BE172051 BE081451 AW891243 W20171 323185 18915_3 852177 AL121177 AW749837 AA354099 AA318422 AA318513 AA318429 321966 30334_1 AL122111 M79226 AI656413 BE502197 F32670 , 321986 22722_2 AL133656 AW269409 A1138865 AA954306 323243 140566_2 W47525 AA134047 BE391212 AA330333 AA376355 BE304871 BE167342 316041 417912_1 AA719183 AA736442 AA709125 322644 82848_1 AW841642 AW747992 AW748000 AA007413 AA568664 AA779192 AW188983 322649 24892_1 F01266 NM_016549 AF239742 BE219554 AA902371 AI298989 AA533735 AI671706 AI373650 NM_014556 AF216184 AI269271 AA780274 AA772950 AA932592 322682 37364_1 AF063553 AI110679 AF090893 307625 10562_13 AA768239 T98699 AW207784 AA343876 AW963055 AI299617 300470 59496_1 T87841 AA233726 AV648314 BE545191 AW969738 AA579641 AA516077 322738 26089_1 AF200496 AI343258 A1014548 301119 33384_1 BE621320 BE266806 BE276582 AW516729 AF142579 AW451687 AK000069 324048 267284_1 AA378739 AW964174 AA570564 A1076833 AW265063 AW006805 AA480656 324094 270098_1 BE395109 AW663898 AW237041 AI492154 BE046906 AI651285 AI983290 308447 10607_ 2 AI659985 300694 110146_1 AA063406 AA063407 317010 485212_1 AA863389 AA863395 AI969882 AI695443 300763 163257_1 BE000150 AA190753 AA760634 AI685862 323676 220254_1 AI702835 AI758919 AI685405 AI952108 AI299207 AI400767 AW105389 323699 222860_1 AW178750 AW178736 BE141842 AW178683 AW178714 AW178684 AW178679 308659 3723_5 Ai174911 AF116710 BE250634 BE513651 BE513483 AW973114 AW973111 AA664047 AA626811 Ai092022 AA300592 AI204107 AA936560 _ AI291330 AA452220 AA443354 298498_1 273867_1 33663_1 N40680 AA248594 AA332177 AA353889 AW136671 BE172420 AB029022 NM_014914 AW896987 AA765269 BE077785 1154206_1 6884_44 BE387695 BE394179 BE392472 BE394406 BE393601 229275_1 323770 230698_1 AA722425 AA329212 AI572177 302138 228984_1 N83965 AA326737 H14153 302162 24588_1 AF119046 NM_014481 AJ011311 AB021260 BE091822 BE091819 BE280661 302183 25243_1 NM_002248 069883 F11363 M62043 AA350009 AI937237 AI363154 324432 312487_1 AA464510 AA631257 AI740516 AI739132 AW972467 AI741376 AW068935 323808 247059_1 AW250114 243124 AA431421 AI879054 AA351616 AA351035 AL048999 316664 455916_1 A1042101 AA805541 AA812130 AW977868 323899 48373_1 AL042966 AW403294 BE294048 BE274337 BE261318 BE544865 308859 995_8 A1830787 BE563334 302263 227972_1 AA325517 H19549 853308 302270 1734192_1 856151 W91936 302292 27735_1 AF067797 AB013456 NM_001169 A1791955 AW843925 A1732659 AA577625 301654 103655_1 H81795 242291 820973 AA046920 301660 171572_1 F13112 242752 T77015 AA211163 324538 1156268_1 AW502082 AW502979 AW502807 AW501876 301685 326972_1 W67730 244630 AA490699 W67596 W76661 821207 324560 1156518_1 AW502208 AW502366 AW502148 324568 1135567_1 AW502311 AW502370 AW403858 324575 65704_1 AW502257 A1014241 AA100360 BE298534 308994 79433_1 BE261877 AI880051 BE242392 302334 29269_1 AF120491 AF187963 NM_004980 AF205857 AF048713 AL049557 301703 916575_1 AW301478 AW301560 A1889207 302399 1570217_1 N79624 H18620 301744 50221_6 BE277526 AW854299 AA356083 BE257389 F12667 T74316 BE251675 301752 259807_1 F13486 T75247 AA368304 301767 8416_1 AK001579 H15317 AW361892 838240 802257 841005 T84341 AW963098 301775 24697_1 AW250572 AW247670 BE067043 BE067049 AL080159 T48255 AI628030 316897 474090_1 AA838114 AW629478 AA883713 AI620552 303042 5058_1 AW505345 AF129532 AF126028 AA852108 BE169359 883701243904 837265. A1141362 T25856 820664 302459 31751 1 AF169255 NM_006028 AF080582 302488 32135_1 AC005551 AF161441 AA431001 AA336054 AW965560 AW376266 AA758808 301855 33235_2 W25940 AF053356 AF053356 301859 1799608_1 T61587 T61035 324783 389615_1 AA640770 A1683112 AA913009 316979 483302_1 AA861087 A1200951 A1026779 303100 44550_1 T09353 072943 064597 852598 861404 820022 818898 067037 303106 85273_1 AA012877 AA021074 303144 40757_1 AF202889 AF202890 302514 2628_10 X58801 X58802 X58803 X58804 A1312844 AA283290 X51791 X86140 303179 112488_1 AA071215 AA071444 302535 1589284_1 H48676 W04984 302569 17513_2 AC004472 BE312721 BE273942 F11928 T65358 BE612432 BE261576 318230 193526_1 AW407564 AA262049 W19405 AA504733 T12641 AW973724 AA558125 324829 7288_14 AI537407 AW131277 AA714311 AW816039 311004 344894_1 AW191647 AW973241 AA632846 AA533681 T51580 309825 331299_2 AW293701 BE348286 303265 155956_1 AA171403 AW160951 303294 72494_1 AA205300 BE612585 AI393918 324945 47710_1 AL360202 AA088768 861018 T36114 AW966404 M85891 AW296810 309912 14912_1 H19255 AA324634 BE398078 AW749970 AA309733 AA769449 BE501906 AA609256 Ai400622 AA778657 AI342773 BE501767 BE048879 AI187333 AW025304 309963 22431 1 AW449073 NM_016507 AF227198 BE062563 AW893244 AI695667 AW370607 319000 1534458_1 244318 F06149 820136 814907 319027 6267_1 AK002182 AW842140 BE391303 AW807017 AW604195 AW604194 AK000527 302722 44456_1 U53530 L23958 AA775976 BE003131 AI903793 303388 969232_1 AL039604 AL039497 319055 167464_1 244855 AA196906 AA196723 BE278458 AA412305 302776 23857_1 AJ133798 NM_014427 AJ133799 819516 AA071126 AI278055 AA071125 319098 922966_1 A1908374 245366 811479 H79927 317894 226420_1 AA323682 244357 F11306 849705 860252 T09440 T09172 H09876 303405 215022_1 AA308601 AW411014 318504 1703724_1 T26453 244226 820425 318563 7543_1 A8037724 BE260227 821318 BE538345 AW250501 AW403023 846363 304161 34056_ 2 H71886 311395 252948_1 823313 823323 225059 AA359123 AW965886 BE167187 A1808503 303521 244029_2 AA746272 AA504079 AA347316 BE084755 303535 972533_1 AL043430 N79419 319207 1071625_1 887679 H16883 F07785 AW245503 302919 34022_1 AL137382 AA305545 303592 29065_6 BE145971 BE146046 BE146316 BE146148 AA421129 AA382152 AW836960 303596 270128_1 AW303377 AW270092 AA382636 319264 247031_1 T65096 F12013 AA351004 F11787 T66093 302972 47307_1 AF086321 W73400 W73375 304211 21366_ 11 N62228 304241 84545_1 AA010976 AW611600 303642 284260_1 AW299459 AA417112 303650 290929_1 AA430709 AA427966 319359 1541128_1 F13458 817813 T74431 319373 226757_2 800371 809720 809711 AW873586 A1703426 AW016769 836969 800259 318728 323486_1 230201 AA486132 T72025 312129 338029_1 T87431 AW300867 T87330 AA515973 A1242970 312162 423491_1 AI660245 AI950027 AA971142 AI302981 AW771990 AA723809 AW195235 303745 54759_3 AI142379 AA905379 303778 174437_1 AW505368 AA218610 F11852 T65345 AA397806 303782 2213_1 AA325129 AV655735 AW408703 AW505411 T64737 318813 1540877_1 F13195 242617 T75318 320083 1764305_1 T87761 895026 W87407 312217 382018_1 AA627706 F28433 D63189 312281 1563872_1 H46445 H22490 H19702 H46328 305064 11422_-7 AA636012 303835 1305867_1 T05645 T32180 AW961890 T08680 303849 43707_1 AA249439 BE256642 AW163324 AF012357 AL359617 H95481 AI217156 320115 582314_ 1 T93574 318946 92484_1 AI122843 243800 819718 859259 N74752 W20097 N46928 AA215691 312339 151127_1 AA524394 AW015969 AA158731 AI831401 AI955800 AW272596 AW272595 304576 25108_1 AA329384 S49006 AW405735 AW404287 AW405848 AW405979 BE538908 303958 10830_7 AL042931 T70163 319668 17848_1 NM_002731 M34181 AA091596 AA090564 AW498491 AA383248 AA018979 320236 321288_1 AA528811 AA482942 320360 259694_1 H12405 H12404 AA368159 319886 22717_1 AK000906 AA603325 A1123244 A1742610 A1742621 AW451297 A1963292 306023 38159_2 BE463655 AA897764 305406 34836= 76 AA723860 BE087137 AW474616 Ai510739 AA614724 AW337476 AW951820 AA149181 AA149142 AW327857 AA405330 AI342315 H01239 AA878156 AA148279 H71525 N52399 Ai991878 AW516d42 AA554875 AA886066 AW518472 AA971169 AA908345 AI561318 AA482746 319900 1138215_1 AW408392 AW847299 AW847302 T86065 T85884 T77135 321132 117535_1 AA081495 887345 H43858 BE266428 BE263090 320503 25164-1 NM_005897 AF156857 AA346876 BE545147 A1003306 N45644 AW889728 320596 26170_1 NM_003658 AF031924 AJ243512 A1792204 AI675861 AI915798 AI733496 305557 41560_1 AA774834 AK001079 BE293936 AW372365 BE271898 F00113 AA424108 BE171120 BE093136 AW796864 AA663009 AW605266 AA247458 AW796905 BE~71125 AW363879 Ai701218 AW084288 304983 25108_1 AA329384 S49006 AW405735 AW404287 AW405848 AW405979 BE538908 321240 2628_30 X58799 AF071472 321286 236538_2 BE245833 BE539992 AI380940 AW952644 AA535470 884610 313476 83849_1 AA010267 AA720674 AA010209 312854 467476_1 AA837782 AA828713 H84206 AW979069 321304 115882_1 BE260893 AA078319 885057 AW803024 H85811 AA078293 321325 28266_1 AB033100 AA347036 BE260325 AW961669 AL047207 AA347037 AI766894 321354 116028_ 2 AA078493 321359 41877_1 AW972301 AW474412 AJ227863 AA516297 AA641949 AW995029 320727 36759_63 AW003360 AI971548 AA017585 X80306 X91133 AJ276100 X91132 320965 266751_1 H18166 886173 H19851 329464 c~ hs 336695 CH22 4181FG 48 4_ 329496 c10~2 336705 CH22_4209FG_63_2_ 336717 CH22_4234FG 81 1_ 329665 c14~2 336883 CH22 4625FG 322 2_ 336898 CH22_4647FG_330_1_ 338177 CH22 6725FG-LINI~EM:AC00 336908 CH22_4670FG_343_2_ 336917 CH22 4688FG_346 4_ 329824 c14~2 329839 c14~2 338648 CH22_7413FG-LINIf_EM:AC00 338668 CH22_7441FG-LINIC_EM:AC00 338679 CH22_7453FG LINK_EM:AC00 338686 CH22_7461FG LINI~EM:AC00 338703 CH22_7483FG_LINItEM:AC00 338705 CH22_7485FG-LINK_EM:AC00 338725 CH22_7521FG LINf~EM:AC00 338747 CH22_7561FG LINfLEM:AC00 338770 CH22_7593FG LINI~EM:AC00 333043 CH22_269FG 70 4 LINI~EM:A
333054 CH22_280FG 73_8_LINILEM:A

303582 647662_1 AA377444 AI458965 335131 CH2~2463FG_497_15_LINI~E
335157 CH22_2493FG_501 7 LINILEM

335163 CH22 2499FG_502_7_LINfLEM

335174 CH22_2510FG_504_4_LINI~EM

335200 CH2~2538FG_508_9_LINILEM
335201 CH22_2539FG_508_10 LINILE
335217 CH22_2556FG_512 3 LINI<_EM

328015 c_6 hs 328016 c_6_hs 335234 CH22 2573FG_515_3 LINfLEM
335236 CH22 2577FG_515 8 LINK_EM
328025 c_6_hs 335247 CH22_2589FG_516_8_LINILEM

328031 c_6_hs 335262 CH22 2604FG_520 3 LINK_EM
335265 CH22_2607FG_521 1 LINK_EM
335266 CH22_2608FG 521_2_LINK_EM
328053 c_6_hs 335281 CH22_2623FG_524 4 LINI<_EM
335284 CH22 2626FG_526 6_LINILEM
328098 c_6_hs 326806 c20_hs 326808 c20_hs 326857 c20 hs 326874 c20_hs 326876 c20 hs 326884 c20 hs 335311 CH22_2654FG_532_4_LINK_EM

335320 CH22_2664FG_534 7 LINI~EM
328109 c_6 hs 335331 CH22_2675FG 535_4_LINfLEM
335339 CH22 2686FG_535_16_LINI~E

335340 CH22_2687FG 535_17_LINILE
335344 CH22_2691FG 536_3_LINK_EM
335348 CH22_2695FG_537 4_LINK_EM
335349 CH22 2696FG_539 2 LINK_EM

328134 c_6_hs 335371 CH22_,2720FG_543 9 LINI<_EM
335377 CH22_2726FG 543_17_LINK_E
328171 c_6 hs 326942 c21 hs 326943 c21 hs 326957 c21 hs 326981 c21 hs 326997 c21 hs 335421 CH22_2772FG_551 1 LINK_EM
328221 c_6_hs 328224 c_6_hs 328228 c_6 hs 335448 CH22 2799FG 562_5_LINILEM

335451 CH22_2802FG_562_9_LINILEM
328236 c_6_hs 335455 CH22_2806FG 562_15_LINK_E
328243 c_6_hs 335468 CH22_2819FG_567 4 LINK_EM
335470 CH22_2821FG 568 3 LINK_EM

335482 CH22_2834FG_570_11 LINK_E
335485 CH22_2837FG_570_17 LINK_E
328271 c 6 hs 328276 c_7 hs 328277 c_7 hs 328282 c 7 hs 335517 CH22_2872FG 571 34_LINftE
328305 c_7_hs 335523 CH22 2878FG_572_3_LINI~EM
335527 CH22_2882FG_572 7 LINI~EM

328314 c 7 hs 335536 CH22 2891FG 574_2_LINI~EM

328328 c_7_hs 335565 CH22_2921FG 579_1 LINK_EM
335566 CH22_2922FG 580_1 LINI~EM

335585 CH22 2943FG 581 24 LINK_E
335587 CH22 2945FG_581 26_LINILE
335593 CH22_,2951FG_581 32-LINK_E
335606 CH22_2964FG_582_3_LINK_EM

335634 CH22_2994FG 584_14_LINK_E
328420 c_7 hs 328428 c_7_hs 335651 CH22_3011FG_590 2 LINI<_EM
335652 CH22_3012FG_590_3_LINILEM
328436 c 7 hs 328444 c_7_hs 335667 CH22_3027FG 590_18_LINK_E
328462 c_7_hs 328467 c_7_hs 335687 CH22_3048FG_596_2_LINK_EM
335690 CH22_3051FG_596_5_LINK_EM
328474 c_7 hs 335692 CH22_3053FG 596 7 LINfC...EM
335693 CH22_3054FG 596_8_LINK...EM
328484 c_7_hs 335700 CH22_3061FG_598_1 LINK_EM

335720 CH22_3081FG_599 23_LINK_E
335721 CH22 3082FG 599-24_LINK_E
328504 c_7 hs 328506 c 7 hs 328507 c_7 hs 335733 CH22_3095FG_601_3_LINI~EM
335739 CH22_3102FG_601 10_LINILE
335745 CH22_3108FG_601 16_LINILE
335747 CH22_3111FG_601 20_LINfC...E
335750 CH22_3115FG_602 4 LINK..EM
335755 CH22_3122FG 604 4_LINf<_EM
328544 c-7_hs 335768 CH22_3137FG_607_2_LINK_EM

328552 c_7 hs 335774 CH22_3143FG_607_10_LINf~E
328557 c_7_hs 328558 c_7_hs 335777 CH22 3146FG 607_13_LINI~E

335782 CH22_3151FG_609 4 LINI~EM
335783 CH22_3152FG 610_3 LINK_EM
328569 c_7_hs 335787 CH22_3156FG_611_3_LINK_EM
328570 c_7 hs 328581 c_7_hs 328582 c_7_hs 328592 c_7 hs 337011 CH22 4876FG_427 6_ 337023 CH22_4894FG 433_12_, 337032 CH22_4910FG 438_3_ 337069 CH22_4967FG 448_2_ 337092 CN22_5016FG_465_12_ 337093 CH22_5017FG 465_18_ 337094 CH22_5018FG 465_19 337097 CH22_5028FG_471 1_ 335806 CH22_3178FG 616_8 LINI~EM
335817 CH22 3189FG 618_5_LINIC_EM
328607 c_7_hs 335827 CH22_3200FG 620_1 LINItEM
335831 CH22 3204FG 620_5 LINILEM
335832 CH22_3205FG_620_6_LINK_EM
328620 c_7 hs 328624 c_7 hs 328636 c_7 hs 335863 CH22_3238FG_629_8_LINIt.EM

328662 c_7_hs 335895 CH22 3272FG 635_3 LINftEM
337100 CH22_5031FG 472_3_ 337114 CH22_5060FG 494_17_ 337121 CH22 5096FG 519_1 337132 CH22_5112FG 526_3_ 337168 CH22_5188FG_562_28_ 337170 CH22_5190FG_564_1_ 337172 CH22_5192FG_565-2_ 335902 CH22-3279FG 635_10_LINK_E
335920 CH22_3297FG_636_16_LINI~E

335956 CH22 3334FG_647 3 LINK_DJ

335968 CH22_3347FG 652_1 1.INK_DJ
335971 CH22_3350FG 652 4_LINI~DJ
335975 CH22 3354FG 652 9 LINI~DJ
335980 CH22_3360FG_653-_2_LINItDJ
328768 c_7 hs 328770 c_7_hs 335993 CH22_3373FG_656_6_LINVLDJ
335998 CH22_3379FG 656 16 LINf~D
335999 CH22_3380FG 657-1 LINK-DJ
328791 c_7 hs 337203 CH22_5256FG 591 3 337204 CH22_5261FG 595_1_ 328803 c 7 hs 330002 c16~2 328810 c_7_hs 328820 c 7 hs 330021 c16~2 328835 c_7_hs 328841 c_7_hs 328851 c_7_hs 328859 c_7 hs 330057 c17,_p2 330058 c17~2 337645 CH22_5960FG LINI~EM:AC00 337657 CH22 5976FG-LINItEM:AC00 337685 CH22_6020FG-LINK_EM;AC00 337695 CH22_6033FG LINI~EM:AC00 337697 CH22_6037FG LINK_EM:AC00 325271c11 hs 325285c11 hs 325289c11 hs 30268331326_1X85153 T63701 30272732493_1L10141 L10151 30274732813_1AF062275 L03830 30295239444_1AF103179 082961 30299641196_1AF054663 AF124197 320789 252516_1 878712 AA603646 878713 330435 41165_1 U63836 AW842139 X74956 U78550 AW840802 X74954 AW388241 AW842709 330436 10605_34 BE259039 W29128 AW410299 X72990 BE246492 NM 005243 X66899 330527 14658= 15 S77356 330855 111881_1 AA070316 AA079318 332099 genbanILAA608983 AA608983 332240 genbank_N54803 N54803 Table 1-20B, shows the genomic positioning for those pkeys lacking unigene ID's and accession numbers in Tables 1-20. For each predicted exon, we have listed the genomic sequence source used for prediction. Nucleotide locations of each predicted exon are also listed.
Pkey: Unique number corresponding to an Eos probeset Ref: Sequence source. The 7 digit numbers in this column are Genbank Identifier (GI) numbers. "Dunham I. et al " refers to the publication entitled "The DNA
sequence of human chromosome 22." Dunham I. et al., Nature (1999) 402:489-495.
Strand: Indicates DNA strand from which exons were predicted.
Nt_position: Indicates nucleotide positions of predicted exons.
Pkey Ref Strand Nt-position 332792Dunham, Plus73381-73768 I. et.al.

332843Dunham, Plus1142859-1143494 I. et.al.

332909Dunham, Plus1946582-1946735 1. et.al.

332920Dunham, Plus2007562-2007785 I. et.al.

332947Dunham, Plus2431726-2432006 I. et.al.

332949Dunham, Plus2436245-2436348 I. et.al.

332958Dunham, Plus2516164-2516310 I, et.al.

332992Dunham, Plus2699997-2701093 I. et.al.

332993Dunham, Plus2701550-2701685 I. et.al.

333004Dunham, Plus2759056-2759165 I. et.al.

333006Dunham, Plus2762853-2762953 I. et.al.

333007Dunham, Plus2763569-2763709 I. et.al.

333132Dunham, Plus3358040-3358153 I. et.al.

333133Dunham, Plus3360058-3360195 I. et.al.

333139Dunham, Plus3369495-3369571 I. et.al.

333152Dunham, Plus3612171-3612354 1. et.al.

333205Dunham, Ptus3942727-3943009 t. et.al.

333221Dunham, Plus3978070-3978187 I. et.al.

333225Dunham, Plus3992229-3992386 I. et.al.

333245Dunham, Plus~ 4157587-4157668 I. et.al.

333248Dunham, Plus4162041-4162139 1. et.al.

333261Dunham, Plus4336597-4337752 I. et.al.

333272Dunham, Plus4381561-4382212 I. et.al.

333281Dunham, Plus4506230-4506342 I. et.al.

333283Dunham, Plus4514226-4514360 I. et.al.

333288Dunham, Plus4516841-4516939 I, et.al.

333298Dunham, Plus4581537-4581947 I. et.al.

333306Dunham, Plus53962335396310 I. et.al.

333382Dunham, Plus49057964905913 I. et.al.

333403Dunham, Plus49251404925256 I. et.al.

333420Dunham, Plus4954302-4954465 I. et.al.

333428Dunham, Plus4973869-4974007 I. et.al.

333464~ Dunham,Plus5210762-5211300 I. et.al.

333465Dunham, Plus5211385-5211858 I. et.al.

333488Dunham, Plus5396233-5396310 (. et.al.

333515Dunham, Plus5564299564851 I. et.al.

333520Dunham, Plus5586133-5586296 I. et.al.

333566Dunham, Plus59542265954473 I. et.al.

333567Dunham, Plus5959139-5959515 I. et.al.

333571Dunham, Plus6007916-6008058 I. et.al.

333572Dunham, Plus6026896-6027189 I. et.al.

333576Dunham, Plus6090345-6090721 I. et.al.

333577Dunham, Plus6123950-6124281 I. et.al.

333580Dunham, Plus6142935-6143145 I. et.al.

333587Dunham, Plus6250599-6250966 I. et.al.

333588Dunham, Plus6255445-6255779 I. et.al.

333591Dunham, Plus6285884-6286251 t. et.al.

333592Dunham, Plus6297731-6297976 I. et.al.

333593Dunham, Plus6304132-6304428 I. et.al.

333594Dunham, Plus6308990-6309450 I. et.al.

333599Dunham, Plus6337885-6338255 I. et.al.

333600Dunham, Plus6355629-6355925 I. et.al.

333601Dunham, Plus6360075-6360442 I. et.al.

333607Dunham, Plus6504431-6504690 I, et.al.

333608Dunham, Plus6510834-6511130 I. et.al.

333619Dunham, Plus6562799-6562926 I. ef.al.

333623Dunham, Plus6584559.6584956 I. et.al.

333625Dunham, Plus6603020.6603310 I. et.al.

333626Dunham, Plus6614174-6614467 I. et.al.

333627Dunham, Plus6620584-6620903 I. et.al.

333628Dunham, Plus6629004-6629233 I. et.al.

333629Dunham, Plus6636915-6637205 I. et.al.

333631Dunham, Plus6650904-6651011 I. et.al.

333632Dunham, Plus6651520-6651658 I. et.al.

333635Dunham, Plus6663683-6663973 I. et.al.

333637Dunham, Plus6674968-6675134 I. et.al.

333640Dunham, Plus6688350-6688624 I. et.al.

333642Dunham, Plus6708760-6709139 I. et.al.

333643Dunham, Plus6728053-6728343 I. et.al.

333646Dunham, Plus6739110-6739379 I. et.al.

333647Dunham, Plus6772502-6772779 I. et.al.

333648Dunham, Plus6787465-6787782 I. et.al.

333650Dunham, Plus6796852-6797128 I. et.al.

333652Dunham, Plus6809455-6809573 I. et,al.

333653Dunham, Plus6811130-6811392 I. et.al.

333654Dunham, Plus6816731-6816993 I. et.al.

333656Dunham, Plus6822087-6822406 I. et,al.

333657Dunham, Plus6831369-6831445 I. et.al.

333658Dunham, Plus6835282-6835474 I. et.al.

333668Dunham, Plus7011009-7011223 I. et.al.

333670Dunham, Plus7027945-7028181 I. et.al.

333680Dunham, Plus7071730-7071794 I. et.al.

333682Dunham, Plus7076641-7076760 I. et.al.

333698Dunham, Plus7205279-7205383 I. et.al.

333710Dunham, Plus7230314-7230476 I. et.ai.

333717Dunham, Plus7308714-7308815 I. et.al.

333727Dunham, Plus7373219-7373311 I. et.al.

333785Dunham, Plus7775317-7775415 I. et.al.

333791Dunham, Plus7795972-7796082 I. et.al.

333859Dunham, Plus8041203-8041359 I. et.al.

333875Dunham, Plus8135505-8136179 I. et.al.

333879Dunham, Plus8146919-8147062 I. et.al.

333891Dunham, Plus8156437-8156709 I. et.al.

333918Dunham, Plus8307124-8307215 I. et.al.

333929Dunham, Plus8479486-8479580 I. et.al.

333932Dunham, Plus8489124-8489205 I. et.al.

333983Dunham, Plus8813593-8813668 I. et.al.

333987Dunham, Plus8824245-8824376 I. et.al.

333997Dunham, Plus8866668-8867255 I. et.al.

334010Dunham, Plus8996696998236 I. eLal.

334015Dunham, Plus9055452-9055595 I. et.al.

334017Dunham, Plus9139516-9139634 I. et.al.

334026Dunham, Plus9196549-9196681 I. et.al.

334030Dunham, Plus9288463-9288782 I. et.al.

334044Dunham, Plus9373898-9374065 I. et.al.

334047Dunham, Plus9428152-9428211 I. etal.

334055Dunham, Plus9662077-9662270 I. et.al:

334063Dunham, Plus9731991-9732085 I. et.al.

334066Dunham, Plus9739568-9739680 I. et.al.

334068Dunham, Plus9746279-9746477 I. etal.

334076Dunham, Plus9801613-9801693 I. et.al.

334091Dunham, Plus9872327-9872527 I. et.al.

334106~ Dunham,Plus10261155-10261841 I. et.al.

334109Dunham,1.Plus10267679-10267864 et.al.

334111Dunham, Plus10279365-10279531 I. et.al.

334115Dunham, Plus10316414-10316608 I. et.al.

334118Dunham, Plus10344273-10344384 I. et.al.

334120Dunham, Plus10402389-10403196 I. et.al.

334135Dunham, Plus10457085-10457183 I. et.al.

334235Dunham, Plus12983601-12983703 I. etal.

334239Dunham, Plus13056569-13056693 I, etal.

334244Dunham, Plus13159198-13159302 I. et.al.

334257Dunham, Plus13213243-13213429 I. et.al.

334260Dunham, Plus13223819-13223968 I. et.al.

334298Dunham, Plus13424763-13425914 I. et.al.

334342Dunham, Plus13646844-13646980 I. etal.

334354Dunham, Plus13702598-13702747 I. et.al.

334430Dunham, Plus14269664-14270102 I. et.al.

334435Dunham, Plus14275597-14275689 I. etal.

334451Dunham, Plus14315572-14315741 I. et.al.

334504Dunham, Plus14510206-14510398 I. et.al.

334510Dunham, Plus14522303-14522418 I. et.al.

334518Dunham, Plus14630584-14630669 I. et.al.

334525Dunham, Plus14781066-14781137 I, et.al.

334528Dunham, Plus14787558-14787675 I. et.al.

334529Dunham, Plus14788825-14788971 I. et.al.

334565Dunham, Plus14989033-14989353 I. et.al.

334568Dunham, Plus14992698-14993210 I. et.al.

334590Dunham, Plus15033247-15033753 I. et.al.

334612Dunham, Plus15170470-15170535 I. et.al.

334626Dunham, Plus15299954-15300077 I, et.al.

334661Dunham, Plus15477716-15477786 I. et.al.

334664Dunham, Plus15501941-15502119 I. et.al.

334666Dunham, Pius15504203-15504279 I. et.al.

334676Dunham, Plus15516334-15516412 I. et.al.

334677Dunham, Plus15517449-15517560 I. et.al.

334719Dunham, Plus15778859-15779026 I. et.al.

334730Dunham, Plus15967830-15967934 I. et.al.

334797Dunham, Plus16383231-16383458 I. et.al.

334819Dunham, Plus16758514-16758711 I. et.al.

334855Dunham, Plus18402556-18402735 I. et.al.

334900Dunham, Plus19315678-19315743 I. et.al.

334906Dunham, Plus19323493-19323590 I. et.al.

334907Dunham, Plus19336829-19336938 I. et.al.

334914Dunham, Plus19495158-19495275 I. etal.

334915Dunham, Plus19505267-19506101 I. et.al.

334935Dunham, ,Plus20108247-20108373 I. et.al.

335019Dunham, Plus20689525-20689582 I. etal.

335036Dunham, Plus20755250-20756375 I. et.al.

335049Dunham, Plus20877184-20877309 I. et.al.

335081Dunham, Plus21113871-21113937 I. et.al.

335131Dunham, Plus21449834-21450003 I. et.al.

335157Dunham, Plus21543302-21544341 I. et.al.

335163Dunham, Plus21583508-21583655 I, etal.

335174Dunham, Plus21631301-21631447 I. etal.

335180Dunham, Plus21641226-21641603 I. et.al.

335188Dunham, Plus21669118-21669328 I. et.al.

335189Dunham, Plus21673403-21673472 I. et.al.

335193Dunham, Plus21692208-21692362 I. et.al.

335200Dunham, Plus21743499-21743881 I. et.al.

335201Dunham, Plus21745249-21745664 I. et.al.

335284Dunham, Plus22272583-22272712 I. et.al, 335311Dunham, Plus22501602-22501676 I. etal.

335320Dunham, Plus22542132-22542246 I. et.al.

335371Dunham, Plus22849529-22849808 I. et.al.

335377Dunham, Plus22869909-22870188 I. et.al.

335421Dunham, Plus23250433-23250498 I. et.al.

335448Dunham, Plus23477532-23417831 I. et.al.

335451Dunham, Plus23480611-23480711 I. et.al.

335455Dunham, Plus23486127-23486216 I. et.al.

335468Dunham, Plus23787245-23787367 I. et.al.

335470Dunham, Plus23812877-23813365 I, et.al.

335482Dunham, Plus24087956-24088114 I. et.al.

335485Dunham, Plus24098953-24099123 I. et.al.

335517Dunham, Plus24226461-24226531 I. et.al.

335536Dunham, Pius24498783-24499762 I. et.al.

335565Dunham, Plus24881886-24882470 I. et.ai.

335585Dunham, Plus24988240-24988405 I. etal.

335587Dunham, Plus24991457-24991618 I. et.al.

335593Dunham, Plus25037253-25037370 I. et.al.

335634Dunham, Plus25163837-25164042 I. et.al.

335651Dunham, Plus25317560-25317696 I. et.al.

335652Dunham, Plus25325625-25325883 I. et.al.

335667Dunham, Plus25345735-25345856 I. et.al.

335687Dunham, Plus25445952-25446064 I. et.al.

335690Dunham, Plus25455442-25455625 I. et.al.

335692Dunham, Plus25468557-25468725 I. etal.

335693Dunham, Plus25471363-25471524 I. et.al.

335700Dunham, Plus25512222-25512890 I. et.al.

335720Dunham, Plus25596542-25596646 I. etal.

335721Dunham, Plus25599118-25599228 I. et.al.

335733Dunham, Plus25686486-25686626 I. et.al.

335739Dunham, Plus25698550-25698826 I. et.al.

335745Dunham, Plus25718164-25718332 I. et.al.

335747Dunham, Plus25723304-25723494 I. et.al.

335783Dunham, Plus25941882-25942040 I. etal.

335968Dunham, Plus27743843-27744029 I. et.al.

335971Dunham, Plus27752808-27753017 I. et.al.

335975Dunham, Plus27801321-27801391 I. et.al.

335993Dunham, Plus28006396-28006571 I. etal.

335998Dunham, Plus28026247-28026356 I, et.al.

336011Dunham, Plus28570760-28570900 I. et.al.

336035Dunham, Plus29016748-29017410 I, et.al.

336049Dunham, Plus29124451-29124606 I. ekal.

336055Dunham, Plus29166352-29166573 I. et.al.

336072Dunham, Plus29269409-29269575 I. et.al.

336075Dunham, Plus29343938-29344050 I, et.al.

336081Dunham, Plus29372270-29372407 I. et.al.

336083Dunham, Plus29379738-29379881 I. et.al.

336084Dunham, Plus29380664-29380792 I. et.al.

336086Dunham, Plus29385594-29385713 I. et.al.

336087Dunham, Plus29387122-29387253 I. et.al.

336088Dunham, Plus29389001-29389124 I. et.al.

336089Dunham, Plus29401421-29401625 I. et.al.

336090Dunham, Plus29413020-29413162 I. et.al.

336091Dunham, Plus29415486-29415617 I. et.al.

336092Dunham, Plus29438816-29438948 I. et.al.

336094Dunham, Plus29567934-29568099 I. et.al.

336102Dunham, Plus29681500-29681687 I. et.al.

336124Dunham, Plus30053441-30053500 I. et.al.

336125Dunham, Plus30056541-30056622 I. et.al.

336127Dunham, Plus30058870-30059029 I, et.al.

336128Dunham, Plus30059294-30059367 I. et.al.

336171Dunham, Plus30223877-30224048 I. et.al.

336214Dunham, Plus30561988-30562044 I. et.al.

336306Dunham, Plus33172949-33173281 I, et.al.

3363.16Dunham, Plus33338776-33338919 I. et.al.

336333Dunham, Plus33673947-33677345 I. et.al.

336387Dunham, Plus34013939-34014124 I, et.al.

336442Dunham, Plus34187937-34188061 I. et.al.

336481Dunham, Plus34231611-34231720 I. et.al.

336489Dunham, Plus34239511-34239619 I. et.al.

336498Dunham, Plus34267340-34267424 I. et.al.

336502Dunham, Plus34268953-34269083 I. et.al.

336516Dunham, Plus34296068-34296249 I. et.al.

336548Dunham, Plus34353881-34354826 I, et.al.

336590Dunham, Plus2569428-2570275 f. et.al.

336593Dunham, Plus4617967~t618783 I. et.al.

336606Dunham, Plus16170215-16170415 I. et.al.

336623Dunham, Plus167287-167616 I. et.al.

336632Dunham, Plus983890-985529 I. et.al.

336633Dunham, Plus985591-986221 I. et.al.

336634Dunham, Plus986296-986670 I. et.al.

336635Dunham, Plus987908-988364 I. et.al.

336637Dunham, Plus989276-990813 I. etal.

336638Dunham, Plus991906-993240 I. et.al.

336654Dunham, Plus1588782-1588858 I. et.al.

336665Dunham, Plus2007241-2007363 I. et.al.

336695Dunham, Plus2464609-2464739 I. etal.

336705Dunham, Plus2817668-2817723 I. et.al.

336751Dunham, Plus4499629-4499739 I. et.al.

336753Dunham, Plus4509509-4509601 I. et.al.

336757Dunham, Plus4541167-4541466 I, et.al.

336759Dunham, Plus4560526-4560699 I. et.al.

336808Dunham, Plus6251639-6251761 I. et.al.

336813Dunham, Plus6436416-6436719 I. et.al.

336827Dunham, Plus6773762-6774057 I. et.al.

336833Dunham, Plus6856506-6856634 I. et,al.

336836Dunham, Plus7077262-7077326 I. et.al.

336878Dunham, Plus9200300-9200399 I. et.al.

336898Dunham, Plus10138365-10138458 I. et.al.

336917Dunham, Plus11228329-11228403 I. et.al.

336924Dunham, Plus11525273-11525527 I. et.al.

336934Dunham, Plus11854506-11854792 I. et.al.

336958Dunham, Plus13203550-13203973 I. etal.

336968Dunham, Plus13660250-13660530 I. et.al.

336985Dunham, Plus14785058-14785225 I. et.al.

337032Dunham, Plus16949229-16949306 I. et.al.

337121Dunham, Plus22050289-22050370 I. etal.

337132Dunham, Plus22255234-22255437 I. et.al.

337168Dunham, Plus23503596-23504240 I. et.al.

337170Dunham, Plus23533763-23534008 I, et.al.

337172Dunham, Plus23608358-23608526 I. et.al.

337218Dunham, Plus26126466-26126565 I. et.al.

337219Dunham, Plus26129629-26130053 I. et.al.

337236Dunham, Plus27114318-27114571 1. et.al.

337238Dunham, Plus27141465-27141776 I. etal.

337259Dunham, Plus27674026-27674142 I. et.al.

337291Dunham, Plus28823308-28823412 I. et.al.

337298Dunham, Plus29002509-29002806 I. et.al.

337304Dunham, Pius29131691-29131823 I. et.al.

337333Dunham, Plus30281383-30281673 I. et.al.

337338Dunham, Plus30427592-30427775 I. et.al.

337345Dunham, Plus30649387-30649467 I. et.al.

337355Dunham, Plus30832838-30833042 I. etal.

337363Dunham, Plus30942712-30942840 I. et.al.

337396Dunham, Plus31585902-31586067 I. et.al.

337402Dunham, Plus31691134-31691482 1. et.al.

337403Dunham, Plus31692319-31692611 I. et.al.

337425Dunham, Plus32072241-32072334 I. et.al.

337426Dunham, Plus32076190-32076349 I. etal.

337427Dunham, Plus32078958-32079076 1. et.al.

337435Dunham, Plus32255716-32255844 I. et.al.

337484Dunham, Plus33238033-33238176 I. et.al.

337489Dunham, Plus33295724-33295872 I. et.al.

337503Dunham, Plus33385583-33385857 I. et.al.

337504Dunham, Plus33386053-33386236 !. ef.al.

337522Dunham, Plus33963188-33963979 I. et.al.

337544Dunham, Plus34268412-34268495 I. et.al.

337548Dunham, Plus34472882-34472957 I. et.al.

337562Dunham, Plus278105-278281 I. et.al.

337564Dunham, Plus285643-285788 I. et.al.

337586Dunham, Plus952102-952250 I. et.al.

337628Dunham, Plus2013838-2014032 I. et.al.

337657Dunham, Plus2844851-2845055 I. et.al.

337685Dunham, Plus3547161-3547245 I. et.al.

337695Dunham, Plus3609670-3609808 I. et.al.

337697Dunham, Plus3644971-3645195 I. etal.

337756Dunham, Plus3975015-3975172 I, et.al.

337781Dunham, Plus4116049-4116265 I. et.al.

337797Dunham, Plus43257121325811 I. et.al.

337835Dunham, Plus4792299-0792423 I. et.al.

337843Dunham, Plus49849664985082 I. etal.

337865Dunham, Plus5377705-5377861 I. et.al.

337870Dunham, Plus5442516-5442636 l, et.al.

337904Dunham, Plus56858195686012 I. et.al.

337918Dunham, Plus6031241-6031358 I. etal.

337930Dunham, Plus6393566-6393692 I. et.al.

337947Dunham, Plus6675643-6675781 I. et.al.

337951Dunham, Plus6766321-6766382 I. et.al.

337954Dunham, Plus6831483-6831620 I. et.al.

337964Dunham, Plus7032720-7032802 I. etal.

338043Dunham, Plus8222138-8222430 I. et.al.

338054Dunham, Plus8429258-8429382 I. et.al.

338062Dunham, Plus8578852-8579012 I. et.al.

338080Dunham, Plus9212114-9212220 I. etal.

338090Dunham, Plus9488619-9488858 I. et.al.

338096Dunham, Plus9698397-9698469 I. et.al.

338120Dunham, Plus10765673-10765820 I. et.al.

338123Dunham, Plus10815824-10815886 1. et.al.

338124Dunham, Plus10860311-10860471 I. et.al.

338177Dunham, Plus12781530-12781724 I. etal.

338239Dunham, Plus14669918-14670016 I. et.al.

338278Dunham, Plus16168714-16168840 I. et.al.

336280Dunham, Plus16171884-16172039 I. et.al.

338326Dunham, Plus17358806-17358964 I. et.al.

338336Dunham, Plus17453324-17453448 I. et.al.

338344Dunham, Plus17780512-17780623 I, et.al.

338411Dunham, Plus19299273-19299522 I. etal.

336412Dunham, Plus19340661-19340737 I. et.al.

338491Dunham, Plus21168430-21168556 I. et.al.

338514Dunham, Plus21379420-21379655 I. et.al.

338516Dunham, Plus21382180-21382383 I. etal.

338521Dunham, Plus21471358-21471476 i. et.al.

338522Dunham, Plus21471617-21471711 I. et.al.

338526Dunham, Plus21551136-21551250 I. etal.

338527Dunham, Plus21552237-21553280 I. et.al.

338529Dunham, Plus21635616-21635867 I. et.al.

338579Dunham, Plus22774968-22775132 I. et.al.

338596Dunham, Plus23078273-23078348 I. et.al.

338648Dunham, Plus24091259-24091434 ~ I, et.al.

338679Dunham, Plus24684836-24684940 I. et.al.

338703Dunham, Plus25219881-25220046 I. et.al.

338705Dunham, Plus25231397-25231551 I. et.al.

338747Dunham, Plus26336372-26336460 I. et.al.

338770Dunham, Plus26784513-26784714 I. et.al.

338809Dunham, Plus27271920-27272000 I. et.al.

338830Dunham, Plus27759923-27760055 I. et.al.

338880Dunham, Plus28420713-28420826 I. et.al.

338895'Dunham, Plus28598893-28599135 I. et.al.

338896Dunham, Plus28618487-28618552 I. et.al.

338911Dunham, Plus28804184-28804445 I. et.al.

338925Dunham, Plus28883892-28884036 I. et.al.

338952Dunham, Plus29418831-29418968 I. et.al.

338959Dunham, Plus29478431-29478589 I. et.al.

338970Dunham, Plus29645468-29645613 I. et.al.

339081Dunham, Plus30927871-30928080 I. et.al.

339116Dunham, Plus31462304-31462382 I. et.al.

339164Dunham, Plus32207441-32207802 I. et.al.

339246Dunham, Plus32844518-32844586 I. et.al.

339271Dunham, Plus32999935-33000078 I. et.al.

339304Dunham, Plus33323712-33323821 I. et.ai.

339309Dunham, Plus33366900-33367198 I. et.al.

339312Dunham, Plus33378992-33379172 I, et.al.

339356Dunham, Plus33573387-33573517 I. et.al.

339357Dunham, Plus33575210-33575416 I. et.al.

339360Dunham, Plus33579433-33579593 I. et.al.

339384Dunham, Plus33950591-33950697 I. et.al.

339413Dunham, Plus34268734-34268875 I. etal.

339419Dunham, Plus34359680-34359777 I. et.al.

332854Dunham, Minus1283611-1283053 I. et.al.

332859Dunham, Minus1358943-1358861 I. et.al.

332896Dunham, Minus1631641-1631422 I. etal.

332995Dunham, Minus2708847-2708685 !. et.al.

333014Dunham, Minus2772479-2772387 I. et.al.

333043Dunham, Minus2920906-2920781 I. et.al.

333054Dunham, Minus2995314-2995219 I. et.al.

333069Dunham, Minus3040771-3040661 I. et.al.

333074Dunham, Minus3054171-3054008 I. et.al.

333101Dunham, Minus3208966-3208908 I. et.al.

333140Dunham, Minus3377220-3376309 I. et.at 333142Dunham, Minus3474264-3474145 I. et.al.

333175Dunham, Minus3768113-3768051 I. et.al.

333216Dunham, Minus3967627-3967512 I. et.al.

333219Dunham, Minus3968531-3968423 I. et.al.

333220Dunham, Minus3969363-3968789 I. et.al.

333240Dunham, Minus4100495-4100281 I. et.al.

333242Dunham, Minus4104544-4104259 I. et.al.

333251Dunham, Minus4168970~t168870 I. et.al.

333252Dunham, Minus4172550-4172390 I. et.al.

333257Dunham, Minus4300724300578 I. et.al.

333258Dunham, Minus4301348301269 I. et.al.

333271Dunham, Minus4377786-4377589 I. etal.

333294Dunham, Minus4538728-4538642 I. et.al.

333296Dunham, Minus4550766550644 I. et.al.

333312Dunham, Minus46387944638635 1. et.al.

333313Dunham, Minus4639397-4639277 I. etal.

333323Dunham, Minus4655333~t655166 I. et.al.

333329Dunham, Minus4661779661672 I. et.al.

333339Dunham, Minus4679691-4679610 i. etal.

333346Dunham, Minus4704564-4704466 I. et.al.

333355Dunham, Minus4727555-4727460 I. et.al.

333408Dunham, Minus4936879-4936661 I. et.al.

333423Dunham, Minus4958233-4957593 I, et.al.

333424Dunham, Minus4959694-4958713 I. etal.

333441Dunham, Minus2708847-2708685 I. et.al.

333466Dunham, Minus2708847-2708685 t. et.al.

333495Dunham, Minus5404039-5403881 I, et.al.

333496Dunham, Minus5404643-5404523 I. et.al.

333541Dunham, Minus5859241-5859098 I. et.al.

333545Dunham, Minus58855395885064 I. et.al.

333561Dunham, Minus5903659-5903590 I. et.al.

333568Dunham, Minus5965072-5964999 1. et.al:

333581Dunham, Minus6151638-6151159 I. et.al.

333582Dunham, Minus6158522-&158322 I. et.al.

333665Dunham, Minus6975471-6975215 I. et.al.

333713Dunham, Minus7289490-7289337 I. et.al.

333730Dunham, Minus7489326-7489007 I. et.al.

333737Dunham, Minus7551981-7551842 I. et.al.

333762Dunham, Minus7679466-7679343 I, et.al.

333815Dunham, Minus7871914-7871764 I. et.al.

333895Dunham, Minus8193845-8193735 I. et.al.

333903Dunham, Minus8216956-8216810 I. et.al.

333910Dunham, Minus8230221-8230116 I. et.al.

333944Dunham, Minus8557051-8556936 I. et.al.

333965Dunham, Minus8627484-8626258 I. et.al.

334035Dunham, Minus9323508-9323292 I. et.al.

334125Dunham, Minus10433521-10432612 I. et.al.

334137Dunham, Minus10461063-10460708 I. et.al.

334172Dunham, Minus11644142-11644008 I. et.al.

334175Dunham, Minus11668659-11668597 I. et.al.

334191Dunham, Minus11932215-11932091 I. et.al.

334196Dunham, Minus11966322-11966182 I. et.al.

334198Dunham, Minus12032364-12032146 I. et.al.

334215Dunham, Minus12670395-12670077 I. et.al.

334237Dunham, Minus12994394-12993954 I. et.al.

334254Dunham, Minus13199268-13198999 I. et.al.

334304Dunham, Minus13455315-13455219 1. et.al.

334358Dunham, Minus13724372-13724201 I. et.al.

334396Dunham, Minus14164482-14164340 I. et.al.

334399Dunham, Minus14186289-14186163 (. et.al.

334418Dunham, Minus14237235-14237028 I. et.al.

334470Dunham, Minus14389581-14389442 (. et.al.

334474Dunham, Minus14391920-14391809 I. et.al.

334476Dunham, Minus14394777-14394589 I. et.al.

334496Dunham, Minus14480743-14480669 I. et.al.

334540Dunham, Minus14832365-14832224 I. et.al.

334548Dunham, Minus14837304-14837150 I. et.al.

334560Dunham, Minus14980648-14980485 I. et.al.

334591Dunham, Minus15035270-15035057 I. et.al.

334593Dunham, Minus15036374-15036242 I. et.al.

334625Dunham, Minus15244936-15243666 I. et.al.

334650Dunham, Minus15371251-15371178 I. et.al.

334682Dunham, Minus15520806-15520668 I. et.al.

334690Dunham, Minus15603055-15602918 I. et.al.

334691Dunham, Minus15615920-15611418 I. et.al.

334745Dunham, Minus16049960-16049653 I. et.al.

334752Dunham, Minus16118059-16117848 I. et.al.

334759Dunham, Minus16134427-16134207 I. et.al.

334760Dunham, Minus16136658-16136578 I. et.al.

334764Dunham, Minus16151208-16151104 I. et.al.

334766Dunham, Minus16154663-16154529 I. et.al.

334779Dunham, Minus16276881-16276815 I. et.al.

334782Dunham, Minus16291693-16291574 I. et.al.

334783Dunham, Minus16293336-16293226 I. et.al.

334784Dunham, Minus16294548-16294360 I. et.al.

334785Dunham, Minus16295583-16295408 I. et.al.

334788Dunham, Minus16301237-16301081 I. et.al.

334793Dunham, Minus16330748-16330681 I. et.al.

334804Dunham, Minus16428342-16428208 I. et.al.

334823Dunham, Minus16851360-16851189 I. et.al.

334827Dunham, Minus16905877-16905684 I. et.al.

334836Dunham, Minus17215581-17215418 I. et.al.

334842Dunham, Minus17464352-17464181 I. et.al.

334946Dunham, Minus20140514-20140410 I. et.al.

334948Dunham, Minus20141727-20141583 I. et.al.

334955Dunham, Minus20151753-20151684 1. et.al.

334958Dunham, Minus20156046-20155932 I. et.al.

334966Dunham, Minus20169171-20169079 L et.al.

334969Dunham, Minus20188176-20188020 I. et.al.

334970Dunham, Minus20195886-20195554 I. et.al.

335000Dunham, Minus20455403-20455348 I. et.al.

335002Dunham, Minus20479143-20479008 I. et.al.

335009Dunham, Minus20602011-20601951 I. et.al.

335068Dunham, Minus20955606-20955458 I. et.al.

335090Dunham, Minus21192979-21190943 t. ef.at.

335092Dunham, Minus21298638-21298571 I. et.al.

335108Dunham, Minus21324221-21324030 I. et.al.

335115Dunham, Minus21388250-21388146 I. et.al.

335116Dunham, Minus21388573-21388414 I. et.al.

335217Dunham, Minus21801622-21801195 I, et.al.

335234Dunham, Minus21904287-21904080 I. et.al.

335236Dunham, Minus21915016-21914870 I. et.al.

335247Dunham, Minus21944287-21944209 I. et.al.

335262Dunham, Minus22065821-22065630 I, et.al.

335265Dunham, Minus22102127-22102000 I. etal.

335266Dunham, Minus22108492-22108411 I. et.al.

335281Dunham, Minus22237614-22237503 I, et.al.

335331Dunham, Minus22556823-22556708 I. et.al.

335339Dunham, Minus22569208-22569045 L ef.al.

335340Dunham, Minus22570500-22570342 I, et.al.

335344Dunham, Minus22600566-22600498 I. et.al.

335348Dunham, Minus22646377-22646122 I. et.al.

335349Dunham, Minus22661861-22661271 L et.al.

335523Dunham, Minus24235282-24235175 I. et.al.

335527Dunham, Minus24241519-24241370 I. et.al.

335566Dunham, Minus24892522-24891998 I. et.al.

335606Dunham, Minus25056719-25055010 I. etal.

335750Dunham, Minus25732501-25731972 I. et.al.

335755Dunham, Minus25763806-25763747 I. et.al.

335768Dunham, Minus25819821-25819690 I. et.al.

335774Dunham, Minus25883733-25883572 I. et.al.

335777Dunham, Minus25885770-25885599 I. et.al.

335782Dunham, Minus25908578-25908440 I. et.al.

335787Dunham, Minus25947022-25946835 I. et.al.

335806Dunham, Minus26217475-26217146 I. et.al.

335817Dunham, Minus26321875-26321750 I. et.al.

335827Dunham, Minus26380557-26380472 I. et.al.

335831Dunham, Minus26321526-26321349 I. et.al.

335832Dunham, Minus26383701-26383583 I. et.al.

335863Dunham, Minus26693017-26692763 I. et.al.

335895Dunham, Minus26975307-26975239 I. et.al.

335902Dunham, Minus26985491-26985358 I. et.al.

335920Dunham, Minus27034927-27034811 I. et.al.

335956Dunham, Minus27653729-27653635 I. et.al.

335980Dunham, Minus27846751-27846614 I. et.al.

335999Dunham, Minus28033986-28033848 I. et.al.

336000Dunham, Minus28105547-28105354 I. et.al.

336029Dunham, Minus28732042-28731966 I. et.al.

336142Dunham, Minus30135157-30135054 I. etal.

336149Dunham, Minus30148185-30148059 I. et.al.

336161Dunham, Minus30169370-30169185 I. et.al.

336177Dunham, Minus30306638-30303284 I. et.al.

336198Dunham, Minus30459668-30459460 I. etal.

336199Dunham, Minus30461245-30461040 I. et.al.

336200Dunham, Minus30462971-30462895 I. et.al.

336202Dunham, Minus30468933-30468781 I. etal.

336203Dunham, Minus30470796-30470653 I. et.al.

336227Dunham, Minus30902014-30901946 I. et.al.

336231Dunham, Minus30967656-30967471 I. et.al.

336232Dunham, Minus30977707-30977645 I. et.al.

336238Dunham, Minus31160083-31159959 I. et.al.

336243Dunham, Minus31402237-31402104 I. et.al.

336246Dunham, Minus31425669-31425253 I. et.al.

336279Dunham, Minus32103203-32102860 I. et.al.

336280Dunham, Minus32103588-32103497 I. et.al.

336294Dunham, Minus32946997-32946890 I. et.al.

336295Dunham, Minus32950291-32950162 I. et.al.

336328Dunham, Minus33584461-33584201 I. et.al.

336347Dunham, Minus33843218-33843104 I. et.al.

336351Dunham, Minus33865890-33865681 1. et.al.

336397Dunham, Minus34021504-34021389 I. et.al.

336400Dunham, Minus34023437-34023298 I. et.al.

336402Dunham, Minus34024090-34023981 I. et.al.

336406Dunham, Minus34030774-34030564 1. et.al.

336417Dunham, Minus34047771-34047675 I. et.al.

336455Dunham, Minus34209155-34209018 I. et.al.

336463Dunham, Minus34212236-34211968 I. et.al.

336479Dunham, Minus34218224-34218139 I. et.al.

336510Dunham, Minus34277046-34276928 I. et.al.

336538Dunham, Minus34329270-34329189 I. et.al.

336584Dunham, Minus34516566-34516468 1. et.al.

336599Dunham, Minus11736500-11734418 I. et.al.

336615Dunham, Minus26020622-26016546 I. et.al.

336616Dunham, Minus26021027-26020848 I. et.al.

336618Dunham, Minus25799-25612 I. et.al.

336645Dunham, Minus1351268-1351168 I. et.al.

336653Durham, Minus1568327-1568216 I. et.al.

336657. Durham,Minus1705497-1705415 I. et.al.

336717Durham, Minus3297417-3297352 I. et.al.

336772Durham, Minus51299395129785 I. et.al.

336795Durham, Minus56815805681460 (. etal.

336796Durham, Minus5683253-5683016 I. et.al.

336854Durham, Minus7884839-7884767 I. et.al.

336858Durham, Minus8200946-8200789 I. et.al.

336862Durham, Minus8394593-8394369 I. et.al.

336863Durham, Minus8396673-8396425 I. et.al.

336883Durham, Minus9322767-9322554 I. et.al.

336908Durham, Minus10791347-10791256 I. et.al.

336927Durham, Minus11548111-11547937 I. et.al.

336929Durham, Minus11603040-11602908 I. et.al.

336978Durham, Minus14241223-14241030 I. et.al.

336981Durham, Minus14478638-14478472 I. etal.

336984Durham, Minus14725450-14725309 I. et.al.

336994Durham, Minus15104752-15104656 I. et.al.

336999Durham, Minus15389579-15388897 I. et.al.

337011Durham, Minus16106423-16106080 I. et.al.

337023Durham, Minus16346174-16346065 I. et.al.

337069Durham, Minus19014379-19014222 I. et.al.

337092Durham, Minus20140132-20139980 I. et.al.

337093Durham, Minus20145693-20145570 I. etal.

337094Durham, Minus20146915-20146778 I. et.al.

337097Durham, Minus20498648-20497686 I. et.al:

337100Durham, Minus20543830-20543751 I. etal.

337114Durham, Minus21328259-21328050 I. et.al.

337203Durham, Minus25349286-25349156 I. et.al.

337204Durham, Minus25419024-25418931 I. et.al.

337225Durham, Minus26607638-26607468 I. et.al.

337244Durham, Minus27362048-27361952 I. et.al.

337279Durham, Minus28430185-28430033 I. et.al.

337289Durham, Minus28756246-28756163 I. et.al.

337316Durham, Minus29657129-29656997 I. etal.

337431Durham, Minus32110529-32110475 I. et.al.

337432Durham, Minus32199134-32198922 I. et.al.

337445Durham, Minus32292380-32292228 I. etal.

337451Durham, Minus32408680-32408576 1. et.al.

337452Durham, Minus32415187-32415117 I. et.al.

337455Durham, Minus32434517-32434425 I. et.al, 337456Durham, Minus32438887-32438828 I. et.al.

337513Durham, Minus33478692-33478562 I. et.al.

337514Durham, Minus33484408-33484339 I. et.al.

337517Durham, Minus33795568-33795385 I. et.al.

337590Durham, Minus982397-982246 I. etal.

337592Durham, Minus1007791-1007634 I, et.al.

337604Durham, Minus1329838-1329759 I. et.al.

337606Durham, Minus1346786-1346617 I. et.al.

337612Durham, Minus1570235-1570142 I. etal.

337645Durham, Minus51414625141329 1. etal.

337704Durham, Minus3658670658545 I. et.al.

337706Durham, Minus3672056-3671922 I. et.al.

337760Durham, Minus4008389-4008037 I. etal.

337768Durham, Minus40501341049973 I. et.al.

337771Durham, Minus4060797060707 I. et.al.

337778Durham, Minus40873011087157 I. et.al.

337787Durham, Minus4135097135025 L et.aL

337816Durham, Minus4523203-0523090 I, et.al.

337821Durham, Minus4538189538075 I. etal.

337848Durham, Minus50539645053829 I. et.al.

337911Durham, Minus5866504-5866154 I. et.al.

337913Durham, Minus6149843-6149786 I. et.al.

337974Durham, Minus7153401-7153085 I. et.al.

337984Durham, Minus7282160-7282020 I. etal.

338069Durham, Minus8728655-8728580 I. et.al.

338087Durham, Minus9362067-9361878 I. et.al.

338113Durham, Minus10481242-10481089 I. et.al.

338132Durham, Minus10989617-10989530 I. et.al.

338140Durham, Minus11237977-11237876 I. et.al.

338151Durham, Minus11519629-11519501 I. et.al.

338221Durham, Minus14183649-14183568 I. etal.

338223Durham, Minus14287001-14286830 I. et.al.

338235Durham, Minus14484254-14484179 I. et.al.

338271Durham, Minus16048151-16047985 I. et.al.

338285Durham, Minus16275030-16274895 I. et.al.

338306Dunham, Minus16966519-16966247 I. et.al.

338325Dunham, Minus17241596-17241507 I. etal.

338368Dunham, Minus18272087-18272025 I. et.al.

338381Dunham, Minus18534404-18534234 1. et.al.

338431Dunham, Minus19747608-19747496 I. et.al.

338450Dunham, Minus20172384-20172200 I. etal.

338451Dunham, Minus20174286-20174193 I. et.al.

338486Dunham, Minus21063152-21063049 I. et.al.

338508Dunham, Minus21308161-21307923 I. et.al.

338576Dunham, Minus22676619-22676368 I. et.al.

338591Dunham, Minus22959271-22959182 I. et.al.

338593Dunham, Minus22992718-22992531 I. etal.

338594Dunham, Minus23026144-23026029 I. et.al.

338668Dunham, Minus24500606-24500442 I. et.al.

338686Dunham, Minus24836463-24836246 I. et.al.

338725Dunham, Minus25904148-25904017 I. et.al.

338819Dunham, Minus27539222-27539058 I. et.al.

338829Dunham, Minus27739328-27739163 I. et.al.

338843Dunham, Minus27899321-27899045 I. et.al.

338934Dunham, Minus29036147-29036048 I. et.al.

338976Dunham, Minus29867484-29867259 I. et.al.

338990Dunham,l.etal.Minus30019967-30019837 339019Dunham, Minus30498278-30498118 I. etal.

339032Dunham, Minus30613407-30613275 I. et.al.

339033Dunham, Minus30621102-30620830 I. et.al.

339037Dunham, Minus30634104-30633988 I. et.al.

339044Dunham, Minus30721853-30721740 I. et.al.

339071Dunham, Minus30885702-30885511 I, et.al.

339127Dunham, Minus31688232-31688072 I. et.al.

339130Dunham, Minus31743961-31743767 I. etal.

339181Dunham, Minus32321697-32321571 I. et.al.

339188Dunham, Minus32347554-32347250 I. et.al.

339193Dunham, Minus3241506032414928 I. et.al.

339196Dunham, Minus32431422-32431097 I. et.al.

339208Dunham, Minus32491714-32491657 I. et.al.

339213Dunham, Minus32496590-32496440 I. et.al.

339215Dunham, Minus32502559-32502383 I. et.al.

339220Dunham, Minus32519184-32519081 I. et.al.

339230Dunham, Minus32729004-32728929 I. et.al.

339251Dunham, Minus32894314-32894216 I. et.al.

339256Dunham, Minus32926055-32925967 I. et.al.

339266Dunham, Minus32976148-32976041 I. et.al.

339268Dunham, Minus32984700-32984500 I. etal.

339280Dunham, Minus33114230-33114010 I. et.al.

339340Dunham, Minus33485220-33485144 I. et.al.

339342Dunham, Minus33494677-33494541 I. et.al.

339344Dunham, Minus33503675-33503520 I. et.al.

339363Dunham, Minus33589964-33589665 1. et.al.

339365Dunham, Minus33641615-33641446 I. et.al.

339401Dunham, Minus34045393-34045138 I. et.al.

339424Dunham, Minus34392464-34392311 I. etal.

339435Dunham, Minus34538987-34538876 I. et.al.

3296113962478 Minus11780-11875 3294963983518 Plus13570-13686 3253105866864 Minus17256-17357 3253205866870 Minus33200-33646 3253385866883 Minus62747-62928 3252715866901 Plus87318-87378 3252855866903 Plus107772-107864 3252895866903 Minus129715-129877 3253005866908 Minus7940-8059 3253045866910 Minus37468-37884 3296306729060 Minus167326-167511 3253695866920 Minus1018736-1018830 3253595866920 Plus392668-392781 3254085866921 Plus599118-599289 3254095866921 Plus599438-599655 3254105866921 Plus615477-615580 3253935866921 Minus350513-350691 3253965866921 Plus476868-477200 3254335866936 Minus480706-080826 3254485866941 Minus392834-392982 3254645866947Plus 323995-324279 3254805866957Plus 20558-21112 3254825866957Plus 47957-48078 3255105866974Plus 219958-220917 3255245866981Minus 117837-117997 3255136017035Minus 34295-34490 3255196017036Minus 186804-186915 3255716552439Minus 184952-185135 3296383779004Minus 46365127 3256235867000Plus 84366-84472 3256365867002Minus 149928-150033 3256775867017Minus 5841458518 3256915867021Plus 65467-65629 3256905867021Plus 7391-7530 3257025867028Plus 139925-140061 3257035867028Plus 155806-156098 3257906381957Minus 105385-105524 3257836456780Plus 102815-102957 3256956552446Minus 199599-199778 3257266552447Plus 154262-154623 3257426552448Minus 38225-38306 3257606552449Plus 343394-343549 3258016552451Plus 49269-09542 3258036552451Plus 53355-53558 3256496588011Minus 215659-215815 3257106682473Plus 204538-204822 3257126682473Plus 208541-208926 3257556682474Plus 406603-007037 3257516682474Plus 130437-130520 3257636682475Minus 327530-327910 3257916682476Plus 344059-344841 3297825912597Plus 123410-123499 3297796002090Minus 195353-195669 3297606048280Minus 5141951528 3297526065777Plus 132916-133335 3297376065779Plus 70136-70236 3297356065780' Plus63923-64213 3297196065785Plus 46970-47762 3297256065785Plus 133747-133842 3297056065790Minus 63183-63724 3296656272129Plus 91791-91891 3297936522661Minus 96556-96698 3298246630758Minus 126072-126254 3298396672062Plus 34377-34537 3298536682295Plus 68945-69009 3298706706435Minus 5729-5870 3298796466518Minus 12266-12356 3299026634760Plus 106906-106984 3258515867067Minus 51751-51981 3258865867087Plus 194694-194915 3258875867087Plus 195052-195485 3260055867112Minus 7827-8117 3259455867138Minus 123079-124086 3259535867140Minus 4721901 3259655867147Plus 216364-216516 3259665867147Plus 217235-217356 3259776249602Plus 60638-60759 3258356552452Minus 81182-81414 3299954567166Minus 150014-150315 3299485540101Minus 134056-134261 3299406165199Minus 33718-33882 3299216165205Minus 33759-33891 ' 3300026623963Plus 46097-46158 3300216671889Plus 120938-121032 3261625867168Minus 5870-6291 3260705867175Plus 132181-132731 3260295867176Minus 112558-112669 3260335867178Plus 37261-37333 3260395867179Minus 15157-15227 3261225867194Plus 144397-144683 3261365867202Minus 155973-156065 3261945867213Plus 75271-75522 3262065867219Plus 113881-115080 3262185867226Minus 259784-259920 3262245867230Plus 21528-21667 3262405867260Plus 94843-96127 3262535867263 Minus222216-222341 3262495867263 Minus80253-80323 3262665867264 Plus 337993-338192 3263045867277 Minus367450-367559 3263095867277 Plus 614150-614294 3263105867277 Plus 621555-621698 3263386056311 Minus161972-162333 3263436525295 Minus2699-2777 3263446525295 Minus3207365 3260736682495 Minus248865-249009 3300576478962 Plus 75145-75287 3300586634847 Plus 100602-100963 3300616721261 Plus 4254-4388 3265395867307 Plus 198357-198504 3265455867307 Plus 600850-601425 3265495867307 Plus 698004-698069 3265525867308 Minus6988-7107 3265545867308 Plus 16259-18271 3265595867310 Plus 159233-159439 3265775867317 Plus 215987-216127 3263805867327 Plus 32474-32668 3264125867362 Minus9263-9436 3264175867362 Plus 89132-89383 3264185867365 Plus 23609-23745 3264235867369 Minus142311-142500 3264585867400 Plus 128045-128147 3264595867400 Plus 137590-138212 3265065867435 Minus9368-9509 3265096682496 Plus 92406-92680 3301126015238 Plus 32059-32163 3300866015293 Plus 29518-29662 3300806015314 Minus48904972 3300826015314 Plus 27158-27296 3300646165044 Minus56195696 3300636165044 Minus948-1025 3300656165044 Minus9876-9948 3266465867562 Plus 100426-100608 3266885867582 Plus 104875-105531 3267085867593 Minus39203-39310 3267105867593 Minus80204-80468 3267465867611 Plus 129366-129565 3267935867631 Plus 136295-136518 3266036056312 Minus5032350575 3268066469835 Plus 101628-102149 3267836525298 Plus 196378-196863 3266686552455 Plus 146726-146838 3267256552456 Minus223005-223125 3268576552460 Minus120142-120345 3267636598307 Plus 239690-239902 3268086682504 Minus65107-65214 3268746682507 Minus46431888 3268766682507 Minus46203-46499 3268846682511 Plus 33403-33479 3269975867660 Minus71389-72147 3270095867664 Plus 933145-933266 3270155867664 Plus 1030457-1030534 3269426004446 Minus88675-88785 3269436004446 Minus89242-89427 3269576469836 Plus 37529-37694 3270496531965 Minus1924026-1924110 3270516531965 Plus 2222592-2222717 3270566531965 Plus 2374323-2374751 3270596531965 Plus 2421032-2421799 3270676531965 Minus3726023-3726668 3270896531965 Plus 5238983-5239187 3270376531965 Minus387854-388045 3271236531971 Minus23980-24340 3271256531971 Plus 48884-48975 3269816588016 Plus 105091-106038 3301394210430 Plus 112089-112450 3301534325335 Plus 146951-147475 3301306002196 Minus241903-241967 3272035867447 Plus 36485-36577 3272065867447 Plus 177855-178031 3272595867454 Plus 87268-87438 3272645867461 Plus 47014-47367 3272735867466 Plus 73451-73549 3272745867470 Minus84027-84128 3272775867473 Minus165616-165715 3272785867473 Minus166350-166439 3272895867481 Plus 49296-49536 3273045867494 Plus 20664-20850 3273155867508 Minus78409-79245 3272465867547 Plus 136212-136325 3271555867549 Plus 90343-90876 3271595867550 Minus8219-8331 3273345902477 Minus142655-142745 3273416017016 Minus122906-123014 3271856117805 Minus3287-3451 3273096456757 Minus10219-10457 3272636525274 Minus153814-154920 3273626552412 Minus62459-62805 3274135867750 Plus 101410-101508 3274185867750 Minus153453-153547 3274305867754 Plus 1320-1403 3274315867754 Plus 1853-1958 3274725867775 Plus 74628-74937 3274875867785 Minus146220-146326 3273795867795 Plus 1368-1820 3274616004455 Plus 209031-209210 3275326469818 Plus 71994-72137 3301706648220 Plus 103280-103849 3301666648220 Plus 86542-86867 3275445867797 Minus18105-18332 3275645867811 Plus 13850-14018 3275665867811 Plus 33383-33901 3275815867825 Plus 53185434 3275855867825 Plus 85660-85764 3276056004463 Plus 199214-199579 3277105867860 Minus131012-131790 3276105867868 Minus174109-174278 3276245867871 Minus37699-37788 3276415867890 Plus 13583-13702 3276465867894 Minus3043-3258 3276146525283 Plus 3634-4001 3277365867940 Minus37781-37887 3277395867942 Minus182187-182548 3277405867943 Plus 25716-26077 3277435867944 Minus155930-156098 3277555867955 Minus61969-62145 3277725867964 Minus26185-26285 3277745867964 Minus127659-127899 3278235867968 Minus170359-170433 3278275867968 Minus201918-202048 3278335867968 Minus303618-303732 3278055867968 Plus 19952-20019 3278095867968 Plus 54610-54761 3278165867968 Minus79202-79552 3277905867977 Plus 19822-19985 3277915867977 Plus 22491-22610 327793' 5867979Plus 18874-19254 3278456531962 Plus 193402-193549 3278466531962 Plus 195216-195373 3302046013606 Plus 86663-86811 3301896165182 Minus26732-26991 3302396671857 Plus 117484-118092 3302666671885 Minus129505-129832 3302756671904 Plus 103585-103716 3302806671910 Plus 2109-2377 3302866671913 Minus3105031171 3279995867994 Plus 94710-94841 3281095868020 Minus353895-354525 3280985868020 Minus261745-261920 3281345868039 Plus 72354-72487 3281715868071 Plus 101102-101224 3282215868099 Minus37489-37829 3282245868101 Plus 105563-105832 3282285868105 Minus21488-21596 3282365868117 Plus 13864-14371 3278645868130 Plus 59139-59358 3278885868149 Minus51964-52120 3278995868156 Minus102288-102697 3279255868172 Minus118396-118490 3279275868173 Plus 5098951246 3279375868192 Minus33127-33485 3279465868206 Plus 44102-44319 3279825868216 Plus 30307-30527 3279905868218 Minus36225-36503 3280155902482 Minus477679-478113 3280165902482 Minus507572-508519 3280255902482 Minus931937-932171 3280315902482 Plus 1176372-1177283 3280535902482 Minus2709850-2710010 3282436056292 Plus 1-243 3282716552415 Plus 39015-39098 3285925868227 Minus252407-252565 3285705868231 Plus 89210-89816 3286075868233 Minus246798-246944 3286205868241 Minus15651-15788 3286245868246 Minus120666-120836 3287915868309 Plus 171592-171929 3288105868327 Plus 101730-101914 3288205868330 Plus 90446-90602 3288355868339 Plus 88053-88461 3282825868353 Plus 72692-72819 3283145868371 Minus288397-288505 3283285868375 Plus 169210-169407 3284205868411 Plus 536123886 3284285868417 Plus 13599-13780 3284365868417 Plus 203760-203904 3284445868420 Plus 65393-66103 3284625868433 Plus 49649-49768 3284675868434 Minus15954-16073 3284745868446 Minus128777-128970 3284845868454 Minus21974-22140 3285045868471 Plus 47064-47217 3285065868471 Plus 60716-60830 3285075868473 Minus199637-199990 3285445868486 Plus 145659-145829 3285525868489 Plus 47328-07607 3285575868489 Plus 138094-138161 3285585868489 Plus 143648-144108 3282766004471 Plus 13282-13450 3282776004471 Minus279901-280181 3286626004473 Plus 1184773-1184855 3286366004473 Plus 192484-192543 3288036004475 Minus291716-291948 3283056004478 Minus34730-34851 3285696004480 Plus 232896-233243 3285816006033 Minus121249-121400 3285826006033 Minus134177-134282 3287686017031 Minus223741-224238 3287706017031 Minus363933-364166 3288416381920 Minus5214-5479 3288516381923 Plus 2502-2606 3288596381928 Plus 69045-69138 3288606381928 Plus 83265-83366 3288636381929 Minus29313-29506 3288686381930 Plus 112825-112993 3288766525286 Plus 94053-94185 3288866588003 Plus 31068-31429 3288886588003 Minus111901-111999 3289365868500 Minus1352202-1352259 3289385868500 Plus 1522923-1522986 3289716478806 Minus23976-24105 3303385457162 Plus 48406-48518 3303275919194 Plus 121561-121683 3303195932415 Plus 49095-50132 3289745868520 Plus 31557-31668 3289815868527 Minus105677-105764 3289895868535 Plus 182088-182198 3303633126882 Minus61838-61901 3303706580495 Plus 10826-11669 3290415868564 Plus 141592-141785 3290785868597 Plus 326798-326860 3290975868624 Plus 12002-12170 3291075868626 Plus 101063-101190 3291145868650 Minus23792-23910 3291165868650 Minus43389-43493 3291645868691 Plus 62305-62517 3291875868713 Plus 29909-30175 3292015868718 Plus 79266-79539 3292215868727 Minus105837-105894 3292465868732 Minus250541-250792 3292545868733 Plus 4133-0214 3293265868806 Plus 155884-155992 3293305868806 Minus340278-340403 3293825868868 Plus 41401-41655 3293845868869 Minus116524-116662 3293866004484 Plus 160502-161110 3291406017060 Plus 290842-290905 3291826056331 Minus662206-663423 3290186249620 Plus 103950-104034 329319. 6381976Plus 721390-721470 3293926478815 Plus 109786-109854 3290296525302 Plus 281445-282490 3294016682544 Plus 21342-24014 3294066682547 Plus 47249-47395 3294116682549 Minus84558-84835 3294295868882 Minus97008-97091 3294365868883 Plus 230265-230528 3294646456788 Minus4437~t538 TABLE 21:

METASTASES COMPARED TO NORMAL COLON TISSUE
Table 21 shows 310 genes up-regulated in colon cancer derived liver metastases compared to normal colon tissue. These were selected from 59680 probesets on the Affymetrix/Eos Hu03 GeneChip array such that the ratio of "average" colon cancer derived liver metastases to "average" normal colon tissues was greater than or equal to 3Ø The "average"
colon cancer derived liver metastases level was set to the 50th percentile. The "average"
normal colon tissue level was set to the 50th percentile.
Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigeneID: Unigene number Unigene Title: Unigene gene title Rl: Genes up mets vs normal Pkey ExAccn UnigenelD UnigeneTitle R1 446619 AU076643 Hs.313 secreted 26.72 phosphoprotein 1 (osteopontin, 431958 X63629 Hs.2877 cadherin 16.36 3, type 1, P-cadherin (placenta 409041 AB033025 Hs.50081 KIAA119913.94 protein 444381 BE387335 Hs.283713 ESTs, 13.90 Weakly similar to S64054 hypotheti 432314 AA533447 Hs.312989 ESTs 12.24 428330 L22524 Hs.2256 matrix 11.60 metalloproteinase 7 (matrilysin, 443162 T49951 Hs.9029 DKFZP434G0329.52 protein ' 436385 BE551618 Hs.144097 ESTs 9.20 418662 AI801098 Hs.151500 ESTs 9.00 433312 AI241331 Hs.131765 ESTs, 8.90 Moderately similar to 138937 DNAIR

412093 BE242691 Hs.14947 ESTs 8.74 442369 AI565071 Hs.159983 ESTs 8.40 426101 AL049987 Hs.166361 Homo Sapiens mRNA; cDNA DKFZp564F112 (fr 8.39 435937 AA830893 Hs.119769 ESTs 8.22 452281 T93500 Hs.28792 Homo sapiens8.22 cDNA FLJ11041 fis, clone PL

432572 A1660840 Hs.191202 ESTs, 7.96 Weakly similar to ALUE_HUMAN
!!1!

440524 871264 Hs.16798 ESTs 7.94 424878 H57111 Hs.221132 ESTs 7.88 430433 AA478883 Hs.273766 ESTs 7.82 410245 C17908 Hs.194125 ESTs 7.78 417315 A1080042 Hs.336901 ribosomal7.76 protein S24 430665 BE350122 Hs.157367 ESTs, 7.76 Weakly similar to 178885 serinelth 432435 BE218886 Hs.282070 ESTs 7.74 426818 AA554827 Hs.289115 DKFZp434A01317.58 protein 419145 N99638 gb:za39g11.r1 Soaresfetalliverspleen7.56 444838 AV651680 Hs.208558 ESTs 7.54 428046 AW812795 Hs.155381 ESTs, 7.48 Moderately similar to 138022 hypot 446682 AW205632 Hs.211198 ESTs 7.26 421221 AW276914 Hs.326714 Homo Sapiens clone IMAGE:713177, mRNA se 7.19 440116 AI798851 Hs.283108 hemoglobin,7.12 gamma G

450230 AW016607 Hs.201582 ESTs 7.08 456332 AA228357 gb:nc39d05.r1 NCI_CGAP_P~2 Homo sapiens 7.04 421814 L12350 Hs.108623 thrombospondin6.89 440774 AI420611 Hs.127832 ESTs 6.86 428065 AI634046 Hs.157313 ESTs 6.78 422330 D30783 Hs.115263 epiregulin6.72 413950 AA249096 Hs.32793 ESTs 6.67 438011 BE466173 Hs.145696 splicing6.62 factor(CC1.3) 421057 T58283 Hs.10450 Homo Sapiens6.58 cDNA: FLJ22063 fis, clone H

428698 AA852773 Hs.334838 KIAA18666.40 protein 408806 AW847814 Hs.289005 Homo 6.38 Sapiens cDNA: FLJ21532 fis, clone C

425787 AA363867 Hs.155029 ESTs 6.38 435812 AA700439 Hs.188490 ESTs 6.32 448974 AL049390 Hs.22689 Homo sapiens mRNA; cDNA DKFZp58601318 (f 6.28 418875 W19971 Hs.233459 ESTs 6.22 407284 AI539227 Hs.214039 hypothetical6.17 protein FLJ23556 408243 Y00787 Hs.624 interieukin6.12 434936 AI285970 Hs.183817 ESTs 6.12 412088 AI689496 Hs.108932 ESTs 6.04 450377 AB033091 Hs.74313 KIAA12658.00 protein 407618 AW054922 Hs.53478 Homo 5.98 sapiens cDNA FLJ12366 fis, clone MA

408296 AL117452 Hs.44155 DKFZP586G15175.94 protein 456999 AA319798 Hs.298581 eukaryotic5.90 translation elongation factor 432559 AW452948 Hs.257631 ESTs 5.86 423349 AF010258 Hs.127428 homeo 5.84 box A9 436100 AA704806 Hs.143842 ESTs, 5.84 Weakly similar to 2004399A chromos 453204 810799 Hs.191990 ESTs 5.84 429183 AB014604 Hs.197955 KIAA07045.78 protein 427882 AA640987 Hs.193767 ESTs 5.72 447033 A1357412 Hs.157601 ESTs 5.70 428054 AI948688 Hs.266619 ESTs 5.66 414504 AW069181 Hs.115175 sterile-alpha5.64 motif and leucine zipper c 442806 AW294522 Hs.149991 ESTs 5.64 418259 AA215404 Hs.137289 ESTs 5.60 434963 AW974957 Hs.288719 Homo 5.60 sapiens cDNA FLJ12142 fis, clone MA

419999 AI760942 Hs.191754 ESTs 5.58 431749 AL049263 Hs.306292 Homo 5.58 sapiens mRNA; cDNA DKFZp564F133 (fr 422790 AA809875 Hs.25933 ESTs 5.56 440980 AL042005 Hs.1117 tripeptidyl5.48 peptidase II

432451 AW972771 Hs.292471 ESTs, S 5.46 Weakly similar to ALU1 HUMAN
ALU

438578 AA811244 Hs.164168 ESTs 5.44 410467 AF102546 Hs.63931 dachshund5.42 (Drosophila) homolog 426317 AA312350 Hs.169294 transcription5.42 factor 7 (T-cell specific, 450164 AI239923 Hs.30098 ESTs 5.40 438899 AF085833 Hs.135624 ESTs 5.38 432945 AL043683 Hs.8173 hypothetical5.36 protein FLJ10803 437176 AW176909 Hs.42346 calcineurin-binding5.34 protein calsarcin-1 419829 AI924228 h1s.115185 ESTs,5.33 Moderately similar to PC4259 fem 407966 AA295052 Hs.38516 Homo 5.30 Sapiens, clone MGC:15887, mRNA, com 447342 AI199268 Hs.19322 Homo 5.26 sapiens, Similar to RIKEN cDNA

419682 H13139 Hs.92282 paired-like5.26 homeodomain transcription fa 421097 AI280112 Hs.125232 Homo 5.22 Sapiens cDNA FLJ13266 fis, clone OV

443373 AI792868 Hs.135365 ESTs 5.22 412059 AA317962 Hs.249721 ESTs, 5.21 Moderately similar to PC4259 fem 443651 W22152 Hs.282929 ESTs 5.21 411274 NM 002776Hs.69423 kallikrein5.17 421999 U50535 Hs.110630 Human 5.17 BRCA2 region, mRNA sequence 426981 AL044675 Hs.173081 KIAA05305.14 protein 431319 AA873350 Hs.302232 ESTs 5.10 434966 AA657494 gb:nt66f04.s1 NCI_CGAP-Pr3 Homo Sapiens 5.10 418830 BE513731 Hs.88959 hypothetical5.08 protein MGC4816 428290 AI932995 Hs.183475 Homo 5.07 Sapiens clone 25061 mRNA sequence 408784 AW971350 Hs.63386 ESTs 5.04 411975 AI916058 Hs.144583 ESTs 5.02 409760 AA302840 gb:EST10534 Adipose4.97 tissue, white I Homo 420717 AA284447 Hs.271887 ESTs 4.96 417035 AA192455 Hs.22968 Homo se4.95 sapiens clone IMAGE:451939, mRNA

434442 AA737415 Hs.152826 ESTs 4.94 441328 AI982794 Hs.159473 ESTs 4.92 438962 BE046594 gb:hn41c11.x1NCl_CGAP_RDF2Homosapiens 4.92 451277 AK001123 Hs.26176 hypothetical4.92 protein FLJ10261 438406 BE273296 Hs.254467 Homo 4.90 sapiens cDNA FLJ13255 fis, clone OV

424950 AA602917 Hs.156974 ESTs 4.88 436823 AW749865 Hs.293645 ESTs, 4.87 Weakly similar to 138022 hypothe6 444783 AK001468 Hs.62180 anillin4.82 (Drosophila Scraps homology, act 444301 AK000136 Hs.10760 asporin4.80 (LRR class 1 ) 445390 AI222165 Hs.144923 ESTs 4.80 439608 AW864696 Hs.301732 hypothetical4.78 protein MGC5306 450506 NM 004460Hs.418 fibroblast4.78 activation protein, alpha 432682 AI376400 Hs.159588 ESTs 4.76 426086 T94907 Hs.188572 ESTs 4.76 435981 H74319 Hs.188620 ESTs 4.74 432340 AA534222 gb:nj21d02.s1 4.72 NCI_CGAP~A1 Homosapiens 435756 AI418466 Hs.33665 ESTs 4.72 447982 H22953 Hs.137551 ESTs 4.72 449509 AA001615 Hs.84561 ESTs 4.72 407946 AA226495 Hs.154292 ESTs 4.70 426215 AW963419 Hs.155223 stanniocalcin4.70 414783 AW069569 Hs.278270 unactive4.68 progesterone receptor, 23 kD

417601 Ntv~014735Hs.82292 KIAA02154.68 gene product 438461 AW075485 Hs.286049 phosphoserine4.68 aminotransferase 449032 AA045573 Hs.22900 nuclear4.68 factor (erythroid-derived 2)-lik 426501 AW043782 Hs.293616 ESTs 4.67 409024 AW883529 Hs.173830 ESTs, S 4.67 Weakly similar to ALU7_HUMAN
ALU

439848 AW979249 gb:EST391359 MAGE resequences, MAGP Homo 4.66 424762 AL119442 Hs.183684 eukaryotic translation initiation factor 4.66 442007 AA301116 Hs.142838 nucleolarphosphoprotein4.62 Nopp34 409632 W74001 Hs.55279 serine 4.62 (or cysteine) proteinase inhibito 432409 AA806538 Hs.130732 KIAA15754.60 protein 452220 BE158006 Hs.212296 ESTs 4.60 442577 AA292998 Hs.163900 ESTs 4.58 434001 AW950905 Hs.3697 serine 4.58 (or cysteine) proteinase inhibito 414271 AK000275 Hs.75871 protein 4.58 kinase C binding protein 1 433854 AA610649 Hs.333239 ESTs 4.56 431315 AW972227 Hs.163986 Homo 4.53 Sapiens cDNA: FLJ22765 fis, clone K

434220 AI174777 Hs.283039 Homo 4.50 Sapiens PR02492 mRNA, complete cds 457752 AI821270 Hs.285643 Homo 4.50 Sapiens cDNA FLJ14364 fis, clone HE

449941 AW450536 Hs.209260 ESTs 4.48 415116 AA160363 Hs.269956 ESTs 4.47 414386 X00442 Hs.75990 haptoglobin4.47 422956 BE545072 Hs.122579 hypothetical4.44 protein FLJ10461 423974 AL118754 gb:DKFZp761P1910_r1761 4.44 (synonym: hamy2) 449618 A1076459 Hs.15978 KIAA12724.44 protein 428279 AA425310 Hs.155766 ESTs, 4.42 Weakly similar to A47582 B-cell gr 430573 AA744550 Hs.136345 ESTs 4.42 430929 AA489166 Hs.156933 ESTs 4.40 433530 BE349534 Hs.281789 ESTs 4.40 446099 T93096 Hs.17126 hypothetical4.40 protein MGC15912 447082 T85314 Hs.42644 thioredoxin-like4.39 407168 845175 Hs.117183 ESTs 4.38 417067 AJ001417 Hs,81086 solute 4.38 tamer family 22 (extraneuronal 408380 AF123050 Hs.44532 diubiquitin4.36 431379 AA504264 Hs.182937 peptidylprolyl4.36 isomerase A (cyclophilin 406671 AA129547 Hs.285754 met 4.34 proto-oncogene (hepatocyte growth fa 419317 AA236282 Hs.172318 ESTs 4.32 450295 AI766732 Hs.210628 ESTs 4.32 423578 AW960454 Hs.222830 ESTs 4.31 419553 N34145 Hs.250614 ESTs, 4.31 Moderately similar to ZN91 HUMAN
Z

429512 AA453987 Hs.144802 ESTs 4.30 426848 H72531 Hs.36190 ESTs 4.30 429831 AA564489 Hs.137526 ESTs 4.30 433735 AA608955 Hs.109653 ESTs 4.30 450546 AA010200 Hs.175551 ESTs 4.27 421059 AI654133 Hs.30212 thyroid 4.27 receptor interacting protein 413243 AA769266 Hs.193657 ESTs 4.26 433230 AW136134 Hs.220277 ESTs 4.22 439717 W94472 Hs.59529 ESTs, Moderately similar to ALU1 HUMAN A 4.20 439362 AI954880 Hs.134604 ESTs 4.19 450157 AW961576 Hs.60178 ESTs 4.17 451690 AW451469 Hs.209990 ESTs 4.17 418661 NM_001949Hs.1189 E2F transcription4.16 factor 3 443135 AI376331 Hs.156103 ESTs 4.16 443148 A1034357 Hs.211194 ESTs, S 4.16 Weakly similar to ALUB_HUMAN
ALU

407765 AW076027 Hs.257711 ESTs, 4.14 Moderately similar to ALUB_HUMAN
A

428825 A1084336 Hs.128783 ESTs, 4.14 Weakly similar to 138022 hypotheti 447519 046258 Hs.339665 ESTs 4.14 439451 AF086270 Hs.278554 heterochromatin-like4.12 protein 1 450219 AI826999 Hs.224624 ESTs 4.12 431451 AA761378 Hs.192013 ESTs 4.11 432917 NM_014125Hs.279812 PR003274.10 protein 431328 AA502999 Hs.291591 ESTs 4.09 425992 AA367069 Hs.100636 ESTs 4.08 404571 4.06 420911 077413 Hs.100293 0-linked 4.06 N-aceiylglucosamine (GIcNAc) tr 421114 AW975051 Hs.293156 ESTs, 4.06 Weakly similar to 178885 serinelth 432731 831178 Hs.287820 fibronectin4.06 433588 A1056872 Hs.133386 ESTs 4.06 434658 AI624436 Hs.310286 ESTs 4.06 444040 AF204231 Hs.182982 golgin-674.06 444984 H15474 Hs.132898 fatty 4.06 acid desaturase 1 438543 AA810141 Hs.192182 ESTs 4.05 413497 BE177661 gb:RC1-HT0598-020300-011-h02 4.04 HT0598 Homo 434575 AI133446 Hs.299964 Homo 4.04 sapiens clone FLB7723 PR02055 mRNA, 430256 AA470152 Hs.192195 ESTs 4.04 424839 AA740632 Hs.120850 ESTs, S 4.02 Weakly similar to ALU1_HUMAN
ALU

429048 AI372949 Hs.44241 Homo 4.02 Sapiens cDNA: FLJ21447 fis, clone C

449429 AA054224 Hs.59847 ESTs 4.02 410762 AF226053 Hs.66170 HSKM-B 4.00 protein 418876 AA740616 gb:ny97f11.s1 4.00 NCI_CGAP_GCB1 Homo Sapiens 425905 AB032959 Hs.318584 novel 4.00 C3HC4 type Zinc finger (dng finge 429500 X78565 Hs.289114 hexabrachion (tenascin C, cytotactin) 4.00 431393 AW971493 Hs.134269 ESTs, Highly similar to cytokine recepto 4.00 435008 AF150262 Hs.162898 ESTs 4.00 431361 AW971375 Hs.292921 ESTs 3.97 444816 248633 Hs.283742 H.sapiens3.96 mRNA for retrotransposon 434701 AA460479 Hs.321707 KIAA07423.96 protein 413886 AW958264 Hs.103832 similar3.95 to yeast Upf3, variant B

424905 NM_002497Hs.153704 NIMA 3.92 (never in mitosis gene a)-related k 428479 Y00272 Hs.184572 cell 3.91 division cycle 2, G1 to S and G2 to 435714 AA699325 Hs.269880 ESTs 3.86 447514 AI809314 Hs.208501 ESTs, 3.86 Weakly similar to 834087 hypotheG

453818 BE256832 Hs.10711 hypothetical3.85 protein FLJ13449 433586 T85301 gb:yd78dO6.s1 Soares3.85 fetal liver spleen 440638 AI376551 gbae64e10.x1 Soares_NFLLT_GBC S1 Homo s 3.85 417819 AI253112 Hs.133540 ESTs 3.84 409596 BE244200 Hs.55075 KIAA04103.83 gene product 423129 L44396 Hs.124106 Homo 3.83 Sapiens cDNA FLJ11941 fis, clone HE

453884 AA355925 Hs.36232 KIAA01863.83 gene product 431193 AW749505 Hs.296770 KIAA17193.81 protein 409262 AK000631 Hs.52256 hypothetical3.80 protein FLJ20624 425568 AW963118 Hs.161784 ESTs 3.78 441085 AW136551 Hs.181245 Homo 3.77 sapiens cDNA FLJ12532 fis, clone NT

428079 AA421020 Hs.208919 ESTs 3.77 412490 AW803564 Hs.288850 Homo 3.76 Sapiens cDNA: FLJ22528 fis, clone H

435354 AA678267 Hs.117115 ESTs 3.75 436535 AW295687 Hs.254420 ESTs 3.74 420439 AW270041 Hs.193053 eukaryotic3.72 translation initiation factor 436090 AI640635 Hs.116468 EST 3.71 416265 AA177088 Hs.190065 ESTs 3.70 417715 AW969587 Hs.86366 ESTs 3.67 435677 AA694142 Hs.293726 ESTs, 3.67 Weakly similar to TSGA RAT TEST1S

438607 AW080237 Hs.252884 ESTs 3.66 408194 AA601038 Hs.191797 ESTs, 3.65 Weakly similar to S65657 alpha-1 C-417211 T97617 Hs.269092 ESTs 3.60 435538 AB011540 Hs.4930 low density3.59 lipoprotein receptor-related 410390 AA876905 Hs.125286 ESTs 3.58 438818 AW979008 Hs.222487 ESTs 3.57 431416 AA532718 Hs.178604 ESTs 3.57 433517 AW022133 Hs.189838 ESTs 3.56 428355 BE256452 Hs.2257 vitronectin3.56 (serum spreading factor, som 432954 A1076345 Hs.214199 ESTs 3.53 434466 AB037829 Hs.3862 regulator3.53 of nonsense transcripts 2; DKF

421933 898881 Hs.109655 sex comb3.52 on midleg (Drosophila)-like 422082 AA016188 Hs.111244 hypothetical3.52 protein 437135 AL038624 Hs.208752 ESTs,WeaklysimilartoALU8S
HUMANALU 3.49 424723 BE409813 Hs.152337 protein3.49 arginine N-methyltransferase 3(h 434280 BE005398 gb:CM1-BN0116-150400-189-h02 BN0116 Homo 3.49 407289 AA135159 Hs.203349 Homo 3.48 sapiens cDNA FLJ12149 fis, clone MA

417670 807785 gb:yf15c06.r1 Soaresfetal3.48 liver spleen 431615 AW295859 Hs.235860 ESTs 3.48 429355 AW973253 Hs.292689 ESTs 3.45 430068 AA464964 gb:ac80f10.s1 3.45 Soares ovary tumor NbHOT H

432929 AW207166 Hs.191265 ESTs 3.44 437763 AA469369 Hs.5831 tissue 3.44 inhibitor of metalloproteinase 445674 BE410347 Hs.13063 transcription3.42 factor CA150 408113 T82427 Hs.194101 Homo 3.42 Sapiens cDNA: FLJ20869 fis, clone A

408908 BE296227 Hs.250822 serinelthreonine3.41 kinase 15 432235 AA531129 Hs.190297 ESTs 3.41 453985 N44545 Hs.251865 ESTs 3.41 415736 AA827082 Hs.291872 ESTs 3.38 430220 BE378277 Hs.152230 ESTs 3.37 426510 AW861225 Hs.194637 BANP 3.37 homolog, SMAR1 homolog 412104 AW205197 Hs.240951 Homo 3.36 Sapiens, Similar to RIKEN cDNA

411573 AB029000 Hs.70823 KIAA10773.33 protein 413816 AW958181 Hs.189998 ESTs 3.32 428057 AI343641 Hs.185798 ESTs 3.32 436280 AI690734 Hs.131740 Homo 3.31 Sapiens cDNA: FLJ22562 fis, clone H

449365 AW968261 Hs.118913 ESTs, 3.31 Moderately similar to T46371 hypot 440659 AF134160 Hs.7327 claudin 3.30 436110 AA704899 Hs.291651 ESTs, 3.29 Weakly similar to 138022 hypotheti 433862 D86960 Hs.3610 KIAA0205 3.29 gene product 424624 AB032947 Hs.151301 Ca2+dependent3.29 activator protein for secr 439955 AW203959 Hs.149532 ESTs 3.28 417333 AL157545 Hs.42179 bromodomain3.28 and PHD finger containing, 3 436150 AW510927 Hs.125243 ESTs 3.27 414900 AW452420 Hs.248678 ESTs 3.26 439349 AI660898 Hs.195602 ESTs 3.25 428255 AI627478 Hs,187670 ESTs 3.24 436217 T53925 Hs.107 fibrinogen-like3.24 429083 Y09397 Hs.227817 BCL2-related3.24 protein A1 422244 Y08890 Hs.113503 karyopherin3.22 (impodin) beta 3 430178 AW449612 Hs.152475 ESTs 3.21 413810 AW197644 Hs.19107 ESTs 3.20 428728 NM_016625Hs.191381 hypothetical3.20 protein 437151 AA745618 Hs.194637 BANP 3.19 homolog, SMAR1 homolog 427051 BE178110 Hs.173374 Homo 3.19 sapiens cDNA FLJ10500 fis, clone NT

438378 AW970529 Hs.86434 hypothetical3.19 protein FLJ21816 439943 AW083789 Hs.124620 ESTs 3.18 439280 AI125436 Hs.48752 ESTs 3.18 452336 AA960961 Hs.305953 zinc 3.17 finger protein 83 (HPF1) 433713 AW976511 Hs.112592 ESTs 3.16 414998 NM-002543Hs.77729 oxidised3.14 low density lipoprotein (lectin 407328 AA508857 Hs.187748 ESTs, S
Weakly similar to ALU1 HUMAN 3.14 ALU

432722 AA830532 Hs.326150 ESTs 3.14 419457 AA243146 Hs,209334 ESTs, Moderately similar to S23A_HUMAN
P 3.11 449987 AW079749 Hs.184719 ESTs, S
Weakly similar to ALU1 HUMAN 3.11 ALU

418522 AA605038 Hs.7149 Homo 3.09 Sapiens cDNA: FLJ21950 fis, clone H

409969 AW514668 Hs.194258 ESTs, Moderately similar to ALU5_HUMAN
A 3.08 436299 AK000767 Hs.5111 hypothetical3.08 protein FLJ20729 406687 M31126 Hs.272620 pregnancy3.07 specific beta-1-glycoprotein 408242 AA251594 Hs.43913 PIBF1 3.07 gene product 444614 844284 Hs.2730 heterogeneous3.06 nuclear ribonucleoprotein 459407 N92114 gb:za22h11.r1 Soaresfetal3.05 liver spleen 433972 AI878910 Hs.3688 cisplatin3.04 resistance-associated overexpr 427704 AW971063 Hs.292882 ESTs 3.03 440255 AI932285 Hs.160569 ESTs 3.03 424542 AI860558 Hs.272009 ESTs, S
Weakly similar to ALU2_HUMAN 3.03 ALU

413822 808950 Hs.272044 ESTs, S
Weakly similarto ALU1_HUMAN 3.02 ALU

433944 AL117518 Hs.3686 KIAA09783.01 protein 440428 BE560954 gb:601347719F1 NIH_MGC_8 Homo sapiens cD 3.00 Table 21A shows the accession numbers for those pkeys lacking unigeneTD's for Table 21A.
For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubleTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession" column.
Pkey: Unique Eos probeset identifier number CAT number. Gene cluster number Accession: Genbank accession numbers Pkey CAT Number Accession 409760 115373_1 AA302840 T93016 T92950 AA077551 413497 1373771_1 BE177661 H06215 BE144709 BE144829 418876 179960_1 AA740616 AA654854 AA229923 419145 182217_1 N99638 AW973750 AA328271 H90994 AA558020 AA234435 N59599 423974 233842_1 AL118754 AA333202 H38001 432340 345248_1 AA534222 AA632632 T81234 433586 370470_1 T85301 AW517087 AA601054 BE073959 434280 382816_1 8E005398 AA628622 AA994155 434966 396504_1 AA657494 AI582663 AI581639 438962 467390_1 BE046594 BE046667 AA828585 A1207343 439848 477806_1 AW979249 D63277 AA846968 440428 49370_-1 BE560954 440638 499025_1 AI376551 T87714 AA897445 456332 179104_1 AA228357 AW841786 AW841716 Pkey: Unique number corresponding to an Eos probeset Ref: Sequence source. The 7 dgit numbers in this column are Genbank Identifier (Glj numbers. "Dunham I. et al." refers to the publication entitled "The DNA sequence of human chromosome 22." Dunham I. et al., Nature (1999) 402:489-495.
Strand: Indicates DNA strand from which exons were predicted.
Nt_,position: Indicates nucleotide positions of predicted exons.
Pkey Ref Strand Nt-position 404571 7249169 Minus 112450-112648 TABLE 22: 177 GENES DOWN-REGULATED IN COLON CANCER
DERIVED LIVER METASTASES COMPARED TO NORMAL COLON
TISSUE
Table 22 shows 177 genes down-regulated in colon cancer derived liver metastases compared to normal colon tissue. These were selected from 5960 probesets on the Affymetrix/Eos Hu03 GeneChip array such that the ratio of "average" colon cancer derived liver metastases to "average" normal colon tissues was less than or equal to 0.25. The "average" colon cancer derived liver metastases level was set to the 50th percentile. The "average" normal adult tissue level was set to the 50th percentile.
Pkey: Unique Eos probeset identifier number ExAccn: ExempIarAccession number, Genbank accession number UnigenelD: Unigene numt~er Unigene Title: Unigene gene title R1: Genes down mets vs. normal Pkey ExAccn UnigenelD UnigeneTitle R1 425196 AL037915 Hs.155097 carbonicanhydrase0.03 II

414522 AW518944 Hs.76325 step 0.03 II splicing factor SLU7 409153 W03754 Hs.50813 hypothetical0.03 protein FLJ20022 452594 AU076405 Hs.29981 solute 0.03 tamer family 26 (sulfate transp 424326 NM_014479Hs.145296 disintegrin0.04 protease 414798 AI286323 Hs.97411 hypothetical0.04 protein MGC12335 432150 AK000224 Hs.272789 hypothetical0.04 protein FLJ20217 425206 NM_002153Hs.155109 hydroxysteroid0.05 (17-beta) dehydrogenase 2 437145 AF007216 Hs.5462 solute 0.05 carver family 4, sodium bicarbon 447513 AW955776 Hs.313500 ESTs, Moderately similar to ALU7 HUMAN
A 0.05 414807 AI738616 Hs.77348 hydroxyprostaglandin0.06 dehydrogenase 15-(N

428934 AF039401 Hs.194659 chloride0.06 channel, calcium activated, fam 432251 AW972983 Hs.232165 polycythemia0.07 rubra very 1; cell surface 431727 AW293464 Hs.162031 ESTs 0.07 421515 Y11339 Hs.105352 GaINAc 0.07 alpha-2, 6-sialyltransferase I, I

414555 N98569 Hs.76422 phospholipase0.08 A2, group IIA (platelets, 412047 AA934589 Hs.49696 ESTs 0.08 412056 T28160 Hs.778 guanylate 0.08 cyclase activator 1B (retina).

422440 NM_004812Hs.116724 aldo-keto0.08 reducfase family 1, member B10 450684 AA872605 Hs.25333 interleukin0.09 1 receptor, type II

418935 T28499 Hs.89485 carbonic 0.09 anhydrase IV

433658 L03678 Hs.156110 immunoglobulin0.09 kappa constant 422260 AA315993 Hs.105484 regenerating0.09 gene type IV

433336 AF017986 Hs.31386 secreted0.09 frizzled-related protein 2 426784 U03749 Hs.172216 chromogranin0.09 A (parathyroid secretory pr 441888 AI733306 Hs.128071 hypothetical0.10 protein FLJ21302 440624 AF017987 Hs.7306 secreted0.10 frizzled-related protein 1 420929 AI694143 Hs,296251 programmed0.10 cell death 4 429970 AK000072 Hs.227059 chloride0.10 channel, calcium activated, fam 417233 W25005 Hs.24395 small 0.10 inducible cytokine subfamily B (Cy 414802 AI793107 Hs.27018 Ris 0.10 424566 M16801 Hs.1790 nuclear 0.11 receptor subfamily 3, group C, m 421996 AW583807 Hs.1460 glucagon0.11 423371 AU076819 Hs.1650 solute 0.11 camerfamily 26, member3 406741 AA058357 Hs.74466 carcinoembryonic0.11 antigen-related cell ad 414176 BE140638 Hs.75794 endothelial0.11 differentiation, lysophospha 408741 M73720 Hs.646 carboxypeptidase0.11 A3 (masf cell) 424527 AW138558 Hs.267158 ESTs, 0.12 Weakly similarto 154374 gene 426682 AV660038 Hs.2056 UDP glycosylUansferase0.12 1 family, polype 453967 AW009077 Hs.232947 ESTs 0.12 425920 AL049977 Hs.162209 claudin0.13 408134 AK000184 Hs.42945 acid 0.13 sphingomyelinase-like phosphodieste 457407 AA505035 Hs.195651 ESTs 0.13 446500 U78093 Hs.15154 sushi-repeat-containing0.14 protein, X chrom 422487 AJ010901 Hs.198267 mucin 0.14 4, tracheobronchial 409196 NM_001874Hs.334873 carboxypepUdase0.14 M

416426 AA180256 Hs.210473 Homo 0.14 sapiens cDNA FLJ14872 fis, clone PL

406636 L12064 gb:Homo Sapiens 0.14 (clone WR4.12VL) anti-th 457982 AW856093 Hs.183617 ESTs 0.14 407744 AB020629 Hs.38095 ATP-binding cassette, sub-family A (ABC1 0.14 430378 229572 Hs.2556 tumor necrosis factor receptor superfami 0.14 424885 AI333771 Hs.82204 ESTs 0.14 423555 AW958201 Hs.178589 hepatocellular caroinoma antigen gene 52 0.14 444237 AA336878 Hs.9842 Human DNA sequence from clone RP4-788L20 0.14 445848 AA774824 Hs.13377 Homo sapiens clone 23649 and 23755 unkno 0.14 451062 AL110125 Hs.25910 Homo Sapiens mRNA; cDNA DKFZp564C1416 (f 0.14 436485 X59135 Hs.156110 immunoglobulin kappa constant 0.14 423655 AA722425 Hs.182785 ESTs, Moderately similar to 1207289A rev 0.15 417332 AW972717 Hs.288462 hypothetical protein FLJ21511 0.15 427506 AK000134 Hs.179100 hypothetical protein FLJ20127 0.15 430712 AW044647 Hs.196284 ESTs 0.15 421666 AL035250 Hs.1408 endothelin 3 0.16 425692 090041 Hs.155956 N-acetyltransferase 1 (arylamine N-acety 0.16 429412 NM_006235Hs.2407 POU domain, class 2, associating factor 0.16 433745 AF075320 Hs.28980 hypothetical protein FLJ14540 0.16 450085 AW293791 Hs.60162 Homo sapiens cDNA: FLJ21528 tis, clone C 0.16 417820 087449 Hs.82635 UDP-glucuronic acidIUDP-N-acetylgalactos 0.16 406722 H27498 Hs.293441 Homo sapiens SNC73 protein (SNC73) mRNA, 0.16 426488 X03350 Hs.4 alcohol dehydrogenase 1B (class I), beta 0.16 436327 AA813075 Hs.120181 ESTs 0.16 408873 AL046017 Hs.182278 calmodulin 2 (phosphorylase kinase, delt 0.16 429524 AB033037 Hs.205293 KIAA1211 protein 0.16 447023 AA356764 Hs.17109 integral membrane protein 2A 0.17 424264 080400 Hs.239388 Human DNA sequence from clone RP1-304814 0.17 410310 J02931 Hs.62192 coagulation factor III (thromboplastin, 0.17 432563 NM_013261 Hs.198468 peroxisome proliferative activated recep 0.17 406897 M57417 gb:Homo sapiens mucin (mucin) mRNA, part 0.17 451096 BE383234 Hs.25925 Homo Sapiens, clone MGC:15393, mRNA, com 0.17 447726 AL137638 Hs.19368 matrflin 2 0.17 409549 A8029015 Hs.54886 phospholipase C, epsilon 2 0.17 433334 AI927208 Hs.231958 matrix metalloproteinase 28 0.17 425849 AJ000512 Hs.296323 serumlglucocorticoid regulated kinase 0.17 407360 X13075 gb:Human 2a12 mRNA for kappa-immunoglobu 0.17 430627 061148 Hs.247685 atonal homolog 1 (Drosophila) 0.17 418807 NM_004944Hs.88646 deoxyribonuclease I-like 3 0.18 453399 270295 Hs.32966 guanylate cyclase activator 2B (uroguany 0.18 422994 AW891802 Hs.296276 ESTs 0.18 432134 AI816782 Hs.122583 hypothetical protein FLJ21934 0.18 400417 X72475 0.18 443506 H10661 Hs.192124 ESTs, Weakly similar to 138022 hypotheti 0.18 428470 AC002301 Hs.184507 Homo Sapiens Chromosome 16 BAC clone CIT 0.18 451928 AI823801 Hs.30315 CTCL tumor antgen se57-1 0.18 429576 BE242628 Hs.209061 sudD (suppressor of bimD6, Aspergillus n 0.18 422106 084239 Hs.111732 Fc fragment of IgG binding protein 0.19 430304 AL122071 Hs.238927 Homo sapiens mRNA; cDNA DKFZp434H1235 (f 0.19 452852 AK001972 Hs.30822 hypothetical protein FLJ11110 0.19 421904 BE143533 Hs.109309 hypothetical protein FLJ20035 0.19 417165 880137 Hs.302738 Homo sapiens cDNA: FLJ21425 fis, clone C 0.19 417771 AA804698 Hs.82547 retinoic acid receptor responder (tazaro 0.19 452802 AU076403 Hs,323468 electron-transfemng-flavoprotein dehyd 0.19 450680 AF131784 Hs.25318 Homo sapiens clone 25194 mRNA sequence 0.19 420061 AW024937 Hs.29410 ESTs 0.19 426828 NM 000020Hs,172670 activin A receptor type II-like 1 0.19 408190 A8032963 Hs.43577 ATPase, Class I, type 8B, member 2 0.19 437682 AA476652 Hs.94952 Homo Sapiens cDNA: FLJ23371 fis, clone H 0.19 449110 H56112 gb:yq95f07.r1 Soares fetal liver spleen 0.19 446727 A8011095 Hs.16032 KIAA0523 protein 0.19 408395 BE072425 Hs.44579 hypothetical protein FLJ20199 0.20 423541 AA296922 Hs.129778 gastrointestinal peptide 0.20 410850 AW362867 Hs.302738 Homo sapiens cDNA: FLJ21425 fis, clone C 0.20 412420 AL035668 Hs.73853 bone morphogenetic protein 2 0.20 423942 AF209704 Hs.135723 glycolipid transfer protein 0.20 421832 NM_016098Hs.108725 HSPC040 protein 0.20 459046 AA910339 Hs.26216 LOC50627 0.20 421360 AA297012 Hs.103839 erythrocyte membrane protein band 4.1-li 0.20 438091 AW373062 Hs.83623 nuclear receptor subfamily 1, group I, m 0.20 403047 0.20 421712 AK000140 Hs.107139 hypothetical protein 0.20 427333 AF067797 Hs.176658 aquaporin 8 0.20 421964 X73079 Hs.288579 polymeric immunoglobulin receptor 0.20 438089 W05391 Hs.83623 nuclear receptor subfamily 1, group I, m 0.21 445200 AA084460 Hs.12409 somatostatin 0.21 404854 0.21 426390 AA377299 Hs.90431 ESTs 0.21 403381 0.21 449833882252Hs.106106protein kinase (CAMP-dependent,0.21 catalyfl 457718F18572Hs.22978ESTs, Weakly similarS
to ALU4 HUMAN ALU 0.21 435730AB020635Hs.4984KIAA0828 protein 0.21 431518AA743462Hs.165337ESTs 0.21 412589828660Hs.24305ESTs 0.21 432584AA928829Hs.47099hypotheflcal protein0.21 426088AF038007Hs.166196ATPase, Class I, 0.21 type 8B, member 429143AA333327Hs.197335plasma glutamate 0.21 carboxypepfldase 414429851494Hs.71818ESTs 0.22 439670AF088076Hs.59507ESTs, Weakly similarto0.22 AC004858 3 U1 sm 406697M21388Hs.123017Human unproductively0.22 rearranged Ig mu-ch 406663U24683Hs.302063Immunoglobulin heavy0.22 constant mu 407811AW190902Hs.40098cysteine knot superfamily0.22 1, BMP antagon 417880BE241595Hs.82848selectin L (lymphocyte0.22 adhesion molecule 430107AA465293Hs.105069ESTs 0.22 424273W40460Hs.144442phospholipase A2, 0.22 group X

419559Y07828Hs.91096ring finger protein0.22 413517N76712Hs.44829ESTs, Weakly similar0.22 to 138022 hypothefl 407243AA058357Hs.74466carcinoembryonic 0.22 anflgen-related cell ad 433906AI167816Hs.43355ESTs 0.22 446203247553Hs.14286flavin containing 0.22 monooxygenase 5 403740 0.22 405701 0.22 413554AA319146Hs.75426secretogranin II 0.22 (chromogranin C) 419577L36531Hs.91296integrin, alpha 0.23 451820AW058357Hs.337353ESTs 0.23 424897D63216Hs.153684friuled-related 0.23 protein 422880AF228704Hs.121524glutathione reductase0.23 430832AI073913Hs.100686ESTs, Weakly similar0.23 to JE0350 Anterior .

430753AI432401Hs.2659fibrinogen-like 0.23 409060AI815867Hs.50130necdin (mouse) homolog0.23 412228AW503785Hs.73792complement component0.24 (3dlEpstein Barr vi 414171AA360328Hs.865RAP1A, member of 0.24 RAS oncogene family 417916NM solute tamer family0.24 006416Hs.82921 35 (CMP-sialic aci 414589AA149791Hs.68864ESTs, Weakly similar0.24 to phosphafldylseri 427167AI239607Hs.99196hypotheflcal protein0.24 440630BE561430Hs.239388Human DNA sequence from clone RP1-304814 0.24 423044AA320829Hs.97266protocadherin 18 0.24 441931BE564830Hs.23744hypothetical protein0.24 443060D78874Hs.8944procollagen C-endopepfldase0.24 enhancer 2 405441 0.24 407241M34516 gb:Human omega light0.24 chain protein 14.1 415165AW887604Hs.78065complement component0.24 426447AV655843Hs.169919electron-transfer-flavoprotein,0.24 alpha po 410748BE383816Hs.12532chromosome 1 open 0.24 reading frame 21 436032AA150797Hs.109276latexin protein 0.24 414256AW410035Hs.75862MAD (mothers against0.24 decapentaplegic, Dr 414197W44877Hs.55501ESTs 0.24 406836AW514501Hs.156110immunoglobulin kappa0.24 constant 437083AW082597Hs.244862ESTs 0.25 421709AA159394Hs.107056CED-6 protein 0.25 426512AW511656Hs.170177Meis1 (mouse) homolog0.25 Table 22A shows the accession numbers for those pkeys lacking unigeneID's for Tables 21A. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubleTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column.
Pkey: Unique Eos probeset identifier number CAT number. Gene cluster number Accession: Genbank accession numbers Pkey CAT Number Accession 449110 798430_1 H56112 H58047 AI630710 N58742 Pkey: Unique number corresponding to an Eos probeset Ref: Sequence source. The 7 dgit numbers in this column are Genbank Identifier (GI) numbers. "Dunham I. et al." refers to the publication entitled "The DNA sequence of human chromosome 22 " Dunham I. et al., Nature (1999) 402:489-495.
Strand: Indicates DNA strand from which exons were predicted.
Nt_position: Indicates nucleotide positions of predicted exons.
Pkey Ref Strand Nt~osition 4030473540153Minus59793-59968 4033819438267Minus26009-26178 4037407630882Plus 86504-87227 4048547143420Plus 14260-14537 4054417408124Plus 100952-101283 4057014263751Plus 93243-93364 TABLE 23: 175 GENES UP-REGULATED IN COLON CANCER
DERIVED LIVER METASTASES COMPARED TO COLON CANCER
PRIMARY TUMOR SAMPLES CLASSIFIED AS DUKE'S B SURVIVOR
Table 23 shows 175 genes up-regulated in colon cancer derived liver metastases compared to colon cancer primary tumor samples classified as Duke's B stage with a positive survival outcome (Duke's B survivor). These were selected from 59680 probesets on the Affymetrix/Eos Hu03 GeneChip array such that the ratio of "average" colon cancer derived liver metastases to "average" Duke's B survivor was greater than or equal to 3Ø The "average" colon cancer derived liver metastases level was set to the 50th percentile. The °'average" Duke's B survivor level was set to the 50th percentile.
Pkey: Unique Eos probeset identifier number ExAccn: ExempIarAccession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title R1: Genes up liver metastases vs Duke's B survivors Pkey ExAccn UnigenelD Unigene Title R1 426101 AL049987 Hs.166361 Homo sapiens mRNA; cDNA DKFZp564F112 (fr 9.06 432572 AI660840 Hs.191202 ESTs, Weakly similar to ALUE HUMAN !1!! 7.96 424878 H57111 Hs.221132 ESTs 7.88 428046 AW812795 Hs.155381 ESTs, 7.48 Moderately similar to 138022 hypot 407284 AI539227 Hs.214039 hypothetical7.45 protein FLJ23556 439943 AW083789 Hs.124620 ESTs 7.00 442369 AI565071 Hs.159983 ESTs 7.00 415116 AA160363 Hs.269956 ESTs 6.98 433517 AW022133 Hs.189838 ESTs 6.70 437176 AW176909 Hs.42346 calcineurin-binding6.68 protein calsarcin-1 440524 871264 Hs.16798 ESTs 6.62 408806 AW847814 Hs.289005 Homo 6.38 Sapiens cDNA: FLJ21532 fis, clone C

448974 AL049390 Hs.22689 Homo Sapiens mRNA; cDNA DKFZp58601318 (f6.28 412088 AI689496 Hs.108932 ESTs 6.04 417670 807785 gb:yf15c06.r1 Soaresfetalliverspleen5.95 440774 AI420611 Hs.127832 ESTs 5.91 426086 T94907 Hs.188572 ESTs 5.90 436100 AA704806 Hs.143842 ESTs, 5.84 Weakly similar to 2004399A chromos 453204 810799 Hs.191990 ESTs 5.84 407289 AA135159 Hs.203349 Homo 5.67 sapiens cDNA FLJ12149 fis, clone MA

432435 BE218886 Hs.282070 ESTs 5.61 434963 AW974957 Hs.288719 Homo 5.60 Sapiens cDNA FLJ12142 fis, clone MA

421221 AW276914 Hs.326714 Homo 5.54 Sapiens clone IMAGE:713177, mRNA
se 407328 AA508857 Hs.187748 ESTs, 5.51 Weakly similarto ALU1 HUMAN ALU
S

440980 AL042005 Hs.1117 tripeptidyl5.48 peptidase II

443651 W22152 Hs.282929 ESTs 5.42 412668 AA456195 Hs.10056 hypothetical5.29 protein FLJ14621 444838 AV651680 Hs.208558 ESTs 5.24 433312 AI241331 Hs.131765 ESTs, 5.11 Moderately similarto 138937 DNAIR

430665 BE350122 Hs.157367 ESTs, 5.11 Weakly similar to 178885 serinelth 434966 AA657494 gb:ni66fQ4.s1 5.10 NCI_CGAP_Pr3 Homo sapiens 426897 AW976570 Hs.97387 ESTs 5.08 432954 A1076345 Hs.214199 ESTs 5.07 431416 AA532718 Hs.178604 ESTs 5.00 420717 AA284447 Hs.271887 ESTs 4.96 424950 AA602917 Hs.156974 ESTs 4.94 438962 BE046594 gb:hn41c11.x1 NCI_CGAP_RDF2 Homo sapiens4.92 419999 AI760942 Hs.191754 ESTs 4.89 435812 AA700439 Hs.188490 ESTs 4.86 418662 AI801098 Hs.151500 ESTs 4.79 428065 AI634046 Hs.157313 ESTs 4.77 407618 AW054922 Hs.53478 Homo 4.75 sapiens cDNA FLJ12366 fis, clone MA

435981 H74319 Hs.188620 ESTs 4.74 419145 N99638 gb:za39g11.r1 Soaresfetal4.73 liver spleen 432340 AA534222 gb:nj21d02.s1 4.72 NCI_CGAP,~A1 Homosapiens 447982 H22953 Hs.137551 ESTs 4.72 449509 Hs.84561ESTs 4.72 407946AA226495Hs.154292ESTs 4.70 438607AW080237Hs.252884ESTs 4.68 438406BE273296Hs.254467Homo sapiens cDNA 4.62 FLJ13255 fis, clone OV

426818AA554827Hs.289115DKFZp434A0131 protein4.62 452220BE158006Hs.212296ESTs 4.60 436823AW749865Hs.293645ESTs, Weakly similar4.60 to 138022 hypotheti 433854AA610649Hs.333239ESTs 4,56 413816AW958181Hs.189998ESTs 4.52 428079AA421020Hs.208919ESTs 4,52 421097AI280112Hs.125232Homo sapiens cDNA 4,50 FLJ13266 fis, clone OV

417035AA192455Hs.22968Homo sapiens clone 4.48 IMAGE:451939, mRNA
se 423974AL118754 gb:DKFZp761P1910_r17614.44 (synonym: hamy2) 449618A1076459Hs.15978KIAA1272 protein 4,44 431615AW295859Hs.235860ESTs 4.44 418876AA740616 gb:ny97f11.s1 NCI_CGAP_GCB14.43 Homo sapiens 428279AA425310Hs.155766ESTs, Weakly similar4,42 to A47582 B-cell gr 430573AA744550Hs.136345ESTs 4.42 430929AA489166Hs.156933ESTs 4.40 446099T93096Hs.17126hypotheUcal protein 4.40 439362AI954880Hs.134604ESTs 4.36 421999050535Hs.110630Human BRCA2 region, 4.35 mRNA sequence CG006 434220AI174777Hs.283039Homo sapiens PR024924.33 mRNA, complete cds 432925AA878324Hs.192734ESTs 4.32 417819AI253112Hs.133540ESTs 4.30 426848H72531Hs.36190ESTs 4.30 429831AA564489Hs.137526ESTs 4.30 433735AA608955Hs.109653ESTs 4.30 418884AA230228Hs.59197ESTs 4.28 413243AA769266Hs.193657ESTs 4.26 431749AL049263Hs.306292Homo sapiens mRNA; 4.23 cDNA DKFZp564F133 (fr 428054AI948688Hs.266619ESTs 4.22 413967AW204431Hs.117853ESTs, Weakly similar4.22 to 138022 hypotheti 433230AW136134Hs.220277ESTs 4.22 421057T58283Hs.10450Homo sapiens cDNA: 4.22 FLJ22063 fis, clone H

423578AW960454Hs.222830ESTs 4.21 439717W94472Hs.59529ESTs, Moderately 4.20 similar to ALU1 HUMAN A

443696AW607444Hs.134622ESTs 4.20 432722AA830532Hs.326150ESTs 4.18 435756AI418466Hs.33665ESTs 4.14 428825AI084336Hs.128783ESTs, Weakly similar4.14 to 138022 hypotheti 439451AF086270Hs.278554heterochromatin-like4.12 protein 1 445943AW898533Hs.181574ESTs 4.12 450219AI826999Hs.224624ESTs 4.12 431379AA504264Hs.182937peptidylprolyl isomerase4.11 A (cyclophilin 432451AW972771Hs.292471ESTs, Weakly similar4.10 to ALU1 HUMAN ALU
S

443148A1034357Hs.211194ESTs, Weakly similar4.08 to ALU8_HUMAN ALU
S

450177AI698091Hs.107845ESTs 4.08 420911077413Hs.1002930-linked N-acetylglucosamine4.06 (GIcNAc) tr 421114AW975051Hs.293156ESTs, Weakly similar4.06 to 178885 serinelth 432731831178Hs.287820fibronectin 1 4.06 433588A1056872Hs.133386ESTs 4.06 434658AI624436Hs.310286ESTs 4.06 444040AF204231Hs.182982golgin-67 4.06 429512AA453987Hs.144802ESTs 4.06 443349A1052572Hs.269864ESTs, Weakly similar4.04 to ALU1 HUMAN ALU
S

439867AA847510Hs.161292ESTs 4.04 425955T96509Hs.248549ESTs, Moderately 4.02 similar to S65657 alpha 431393AW971493Hs.134269ESTs, Highly similar4.00 to cytokine recepto 432125AW972667Hs.287510Homo sapiens cDNA 4.00 FLJ12300 fis, clone MA

435468AW362803Hs.166271ESTs 3.97 412059AA317962Hs.249721ESTs, Moderately 3.95 similar to PC4259 fem 446682AW205632Hs.211198ESTs 3.95 441328AI982794Hs.159473ESTs 3.92 455778BE088746 gb:CM2-BT0693-210300-123-d09 BT0693 Homo 3.90 438996AW748336Hs.168052KIAA0421 protein 3.86 418303AA215701Hs.186541ESTs, Weakly similar3.85 to 138022 hypothe6 444816248633Hs.283742H.sapiens mRNA for 3.84 retrotransposon 429355AW973253Hs.292689ESTs 3.83 438578AA811244Hs.164168ESTs 3.83 432945AL043683Hs.8173hypothetical protein3.83 435318T97301Hs.18026ESTs 3.82 449941AW450536Hs.209260ESTs 3.80 424915842755Hs.23096ESTs 3.76 449987AW079749Hs.184719ESTs, Weakly similar3.76 to ALU1 HUMAN ALU
S

416265AA177088Hs.190065ESTs 3.75 413497 BE177661 gb:RC1-HT0598-020300-011-h02 HT0598 Homo 3.74 412093 BE242691 Hs.14947 ESTs 3.74 413822 808950 Hs.272044 ESTs, Weakly similar to ALU1 HUMAN ALU S 3.73 431915 AK000777 Hs.272197 Homo Sapiens cDNA FLJ20770 fis, clone CO 3.68 434442 Hs.152826ESTs 3.63 434959AW974949Hs.186564ESTs, Weakly similar3.63 to 138022 hypothe6 427704AW971063Hs.292882ESTs 3.62 426510AW861225Hs.194637BANP homolog, SMAR1 3.60 homolog 435714AA699325Hs.269880ESTs 3.60 432598AI341227Hs.157106ESTs 3.57 438543AA810141Hs.192182ESTs 3.55 422068AI807519Hs.104520Homo sapiens cDNA 3.54 FLJ13694 fis, clone PL

418259AA215404Hs.137289ESTs 3.54 428290AI932995Hs.183475Homo sapiens clone 3.49 25061 mRNA sequence 419457AA243146Hs.209334ESTs, Moderately 3.47 similar to S23A_HUMAN
P

439312AA833902Hs.270745ESTs 3.47 408784AW971350Hs.63386ESTs 3.45 456332AA228357 gb:nc39d05.r1 NCI_CGAP_Pr23.45 Homo sapiens 424762AL119442Hs.183684eukaryotic translation3.44 initiation factor 442884A1076570Hs.134053ESTs 3.44 421023AW449855Hs.96557Homo Sapiens cDNA 3.43 FLJ12727 fis, clone NT

434575AI133446Hs.299964Homo Sapiens clone , FLB7723 PR02055 3.42 mRNA

430433AA478883Hs.273766ESTs 3.39 419317AA236282Hs.172318ESTs 3.38 4d8710T62926Hs.304t84ESTs 3.37 439322H72245Hs.188635ESTs 3.37 430332851790Hs.239483Human clone 23933 3.35 mRNA sequence 411755BE327036Hs.117494ESTs 3.33 427882AA640987Hs.193767ESTs 3.28 438899AF085833Hs.135624ESTs 3.28 436535AW295687Hs.254420ESTs 3.25 434936A1285970Hs.183817ESTs 3.22 451730AF095687Hs.26937brain and nasopharyngeal3.18 carcinoma susce 447514AI809314Hs.208501ESTs, Weakly similar3.18 to 834087 hypotheti 413672BE156536 gb:OVO-HT0368-310100-091-h10 HT0368 Homo 3.16 435073AA664078 gb:ac04a05.s1 SUatagene3.13 lung (937210) H

450295AI766732Hs.210628ESTs 3.13 419341N71463Hs.118888ESTs, Weakly similar3.13 to ALU1 HUMAN ALU
S

434495AW352170Hs.129086Homo sapiens cDNA 3.12 FLJ12007 fis, clone HE

408113T82427Hs.194101Homo Sapiens cDNA: 3.12 FLJ20869 fis, clone A

456437AI924228Hs.115185ESTs, Moderately 3.12 similar to PC4259 fem 421489AI922821Hs.32433ESTs 3.12 436090AI640635Hs.116468EST 3.11 450230AW016607Hs.201582ESTs 3.11 438011BE466173Hs.145696splicing factor (CC1.3)3.09 418720AI381687Hs.39526ESTs 3.09 433102A1343966Hs.158528ESTs 3.08 436150AW510927Hs.125243ESTs 3.05 440116AI798851Hs.283108hemoglobin, gamma 3.04 G

414900AW452420Hs.248678ESTs 3.04 435937AA830893Hs.119769ESTs 3.02 424848At263231Hs.327090EST 3.02 435354AA678267Hs.117115ESTs 3.00 Table 23A show the accession numbers for those pkeys lacking unigene>D's for tables 1-20A, 21A, 22A, and 23A. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubleTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession" column.
Pkey: Unique Eos probeset identifier number CAT number Gene cluster number Accession: Genbank accession numbers Pkey CAT Number Accession 413672 1382512_1 BE156536 BE156439 BE156700 BE156449 BE156653 BE156533 417670 1692163_1 807785 T85948 T86972 418876 179960_1 AA740616 AA654854 AA229923 434966 396504_1 AA657494 AI582663 AI581639 438962 467390_1 BE046594 BE046667 AA828585 AI207343 455778 1364506_1 BE088746 BE088802 BE088755 BE088876 BE088947 BE088881 456332 179104_1 AA228357 AW841786 AW841716 TABLE 24: 34 GENES DOWN-REGULATED IN COLON CANCER
DERIVED LIVER METASTASES COMPARED TO COLON CANCER
PRIMARY TUMOR SAMPLES CLASSIFIED AS DUKE'S B SURVIVOR
Table 24 shows 34 genes down-regulated in colon cancer derived liver metastases compared to colon cancer primary tumor samples classified as Duke's B stage with a positive survival outcome (Duke's B survivor). These were selected from 59680 probesets on the Affymetrix/Eos Hu03 GeneChip array such that the ratio of "average" colon cancer derived liver metastases to "average" Duke's B survivor was greater than or equal to 0.25. The "average" colon cancer derived liver metastases level was set to the 50th percentile. The "average" Duke's B survivor level was set to the 50th percentile.
Pkey: Unique Eos probeset identifier number ExAccn: ExempIarAccession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title R1: Genes down liver metastases vs Duke's B survivors Pkey ExAccn UnigenelD Unigene Title R1 414522 AW518944 Hs.76325 step 0.05 II splicing factor SLU7 416768 AA363733 Hs.1032 regenerating0.07 islet-derived 1 alpha (panc 409153 W03754 Hs.50813 hypotheUcal0.07 protein FLJ20022 414555 N98569 Hs.7(i422 phospholipase0.11 A2, group IIA (platelets, 418007 M13509 Hs.83169 mafix metalloproteinase0.11 1 (interstitial 424326 NM_014479Hs.145296 disintegrin0.11 protease 428934 AF039401 Hs.194659 chloride0.12 channel, calcium activated, fam 417233 W25005 Hs.24395 small inducible0.12 cytokine subfamily B (Cy 422260 AA315993 Hs.105484 regenerating0.12 gene type IV

425196 AL037915 Hs.155097 carbonic0.13 anhydrase II

433336 AF017986 Hs.31386 secreted0.13 frizzled-related protein 2 450685 L15533 Hs.423 pancreatifis-associated0.14 protein 407811 AW190902 Hs.40098 cysteine0.15 knot superfamily 1, BMP antagon 414798 AI286323 Hs.97411 hypothetical0.16 protein MGC12335 452852 AK001972 Hs.30822 hypothetical0.17 protein FLJ11110 447513 AW955776 Hs.313500 ESTs, 0.17 Moderately similar to ALU7 HUMAN
A

423541 AA296922 Hs.129778 gastrointestinal0.17 peptide 425071 NM_013989Hs.154424 deiodinase,0.18 iodothyronine, type II

406636 L12064 gb:Homo Sapiens 0.18 (clone WR4.12VL) anti-th 421515 Y11339 Hs.105352 GaINAc 0.18 alpha-2, 6-sialylfransferase I, I

428368 BE440042 Hs.83326 matrix 0.19 metalloproteinase 3 (stromelysin 414812 X72755 Hs.77367 monokine 0.20 induced by gamma interferon 452594 AU076405 Hs.29981 solute 0.20 tamer family 26 (sulfate transp 428227 AA321649 Hs.2248 small 0.21 inducible cytokine subfamily B (Cy 408741 M73720 Hs.646 carboxypepGdase0.21 A3 (mast cellj 453064 840334 Hs.89463 potassium 0.21 large conductance calcium-acti 431727 AW293464 Hs.162031 ESTs 0.22 433658 L03678 Hs.156110 immunoglobulin0.22 kappa constant 442064 AI422867 Hs.88594 ESTs 0.22 417880 BE241595 Hs.82848 selectin0.22 L (lymphocyte adhesion molecule 430280 AA361258 Hs.237868 interleukin0.23 7 receptor 452877 AI250789 Hs.32478 ESTs 0.23 410310 J02931 Hs.62192 coagulation0.2d factor III (thromboplasUn, 402408 0.24 Pkey: Unique number corresponding to an Eos probeset Ref. Sequence source, The 7 digit numbers in this column are Genbank Identifier (GI) numbers. "Dunham I. et al," refers to the publication entitled "The DNA sequence of human chromosome 22 " Dunham I. et al., Nature (1999) 402:489-495.
Strand: Indicates DNA strand from which exons were predicted.
Nt_position: Indicates nucleotide positicns of predicted exons.
Pkey Ref Strand Nt~osition 402408 9796239 Minus 110326-110491 TABLE 25:
Table 25 depicts Seq m No., Unigenem, UnigeneTitle, Pkey, and ExAccn for all of the sequences in Table 26. Seq m No links the nucleic acid and protein sequence information in Table 26 to Table 25.
Pkey: Unique Eos probeset identifier number ExAccn: Exemplar Accession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title Seq.ID.No.: Sequence Identification Numberfound in Table 26 Pkey ExAccn UnigenelD Unigene Title Seq ID No.
426101 AL049987 Homo sapiens mRNA;
cDNA DKFZp564F112 (fr 1-4 419145 N99638 gb 5 &

426818 AA554827 Hs.340046 DKFZp434A01317 protein &

421057 T58283 Homo Sapiens cDNA 9 446619 AU076643 Hs.313 secreted 10 phosphoprotein 1 (osteopontin, &

431958 X63629 Hs.2877 cadherin 12 3, type 1, P-cadherin (placenta &

409041 AB033025 Hs.50081 Hypothetical14 protein, XP_051860 (KIAA119 &15 443162 T49951 Hs.9029 DKFZP434G03216 protein &17 436385 BE551618 Hs.144097 ESTs 18-20 447033 A1357412 Hs.157601 ESTs 21 &

439608 AW864696 Hs.301732 hypothetical23-27 protein MGC5306 449032 AA045573 Hs.22900 nuclear 28 factor (erythroid-derived 2)-lik &

442577 AA292998 Hs.163900 ESTs 30 &

429970 AK000072 Hs.227059 chloride32 channel, calcium activated, fam &

424566 M16801 Hs.1790 nuclear 34 receptorsubfamily 3, group C, &
m 35 457407 AA505035 Hs.345911 ESTs 36 430378 229572 Hs.2556 tumor necrosis37 factor receptor superfami &

417332 AW972717 Hs.288462 hypothetical39 protein FLJ21511 &

Pkey: Unique Eos probeset identifier number CAT number. Gene cluster number Accession: Genbank accession numbers Pkey CAT Number Accession 417332 166755_1 AW972717 AA523805 AI962905 AI373245 AW235545 AI812045 AW589434 419145 182217_1 N99638 AW973750 AA328271 H90994 AA558020 AA234435 N59599 421057 198849_1 158283 AA765038 AA283052 H99396 AA814751 A1032674 N81016 424566 2408_1 M16801 NM_000901 D57171 AL041328 AF068623 AI201179 AA151766 426101 26088_1 AL049987 AW362842178981 AA247541 AI217018 AW961515 AA632986 426818 272427_1 AA554827 AA701001 AW972954 AL039129 AA385540 AA911663 429970 31134_1 AK000072 AW840683 AW843764 AW844444 AW844515 AW603469 AW862395 431958 3394_1 X63629 NM 001793 BE175433 BE153414 BE153425 AW364593 BE315317 436385 418907_1 BE551618 AI207338 BE220568 AI261568 AW841737 AA714722 AA946891 442577 54549_1 AA292998 AW238350 AI676059 AW074092 BE566458 AW078677 AW514801 443162 5613_1 149951 AA025326 H04839 AA393303 863101 W57657 W25628 AI961431 446619 685_1 AU076643 AA594604 AA346866 818197 AA345192 AA337773 N40517 J04765 AA379957 AA362403 NM_000582 AF052124 AA300290 AA333447 AA343721 447033 704603_1 AI357412 AI870708 AI590539 W07459 449032 7945_1 AA045573 AA279920 820139 AA372783 AW963629 H21473 878318 W74359 457407 333252_1 AA505035 AW235098 AI634028 Table 26 Seq ID NO; 1 DNA seouence Nucleic Acid Accession #: see Table 25 & 25A for complete list GTGTCCTGGG CTGAGTCCCC GGGGAAGAAT ATGAT
Seq ID N0: 2 DNA seauence Nucleic Acid Accession #: X83301.1 CTGGGTGACA GAGCCAGACT CCGTCTCTAC TAAAAAAAAA AAAAAAAAAA AAA
Seq ID NO: 3 Protein seouence:
Protein Accession #: CAA58280.1 LLVSQLRAPG VDSAAAGRPV
Seq ID NO: 4 DNA seauence Nucleic Acid Accession #: BC002622.I

CAGCCTGGGC AACACAGTGA GACTCCATCT CAAAAAAAAA AAAAAAAAAA AA
Seq ID NO: 5 Protein seauence:
Protein Accession #: AAH02622.1 LLVSQLRAPG VDSAAAGRPV
Seq ID NO: 6 DNA seouence Nucleic Acid Accession #: see Table 25 & 25A for complete list ATAGGTTAATTGGTAAATTTTCTNATAGNC ACC
Seq ID NO: 7 DNA seauence Nucleic Acid Accession #: AK000942 Coding sequence: 1204-1503 CTCAG
Seq ID NO: 8 DNA seauence Nucleic Acid Accession #: see Table 25 & 25A for complete list AAAAAAAAAA
Seq ID NO: 9 DNA seauence Nucleic Acid Accession #: BC010433.1 Coding sequence: 3-335 CACTTTTGAC TTCCTGGGGT CCTTCTTCAG TTAAAAAAAA AAAAAAAAAA
Seq ID NO: 10 DNA seouence Nucleic Acid Accession #: see Table 25 & 25A for complete List AAAAAA
Seq ID NO: 11 DNA seouence Nucleic Acid Accession #: NM_000582.1 Coding sequence: 88-990 1 11 21 3t 41 51 GCCTAAAAAA AAAAAAAAAA AAAA
Seq ID NO: 12 Protein seauence:
Protein Accession #: NP 000573.1 NEHSDVIDSQ ELSKV SREFH SHEFHSHEDM LV VDPKSKEE DKHLKFRISH ELDSASSEVN
Seq ID NO: 13 DNA seauence Nucleic Acid Accession #: NM_001793 Coding sequence: 71-2560 TAAAGAAACT TTTCCCAGAA AAAAA
Seq ID NO: 14 Protein seauence:
Protein Accession #: NP 001784.2 DYEGSGSDAA SLSSLTSSAS DQDQDYDYLN EWGSRFKKLA DMYGGGEDD
Seq ID NO: 15 DNA seauence Nucleic Acid Accession #: XM_051860.2 Coding sequence: 261-4346 TTATTATATG TGCACTTCAA GAAGTCACTG TCAGAGAAAT AAAGAATTGT CTTAAATGTC
Seq ID NO: 16 Protein seauence:
Protein Accession #: XP 051860.2 SRNLDDMARK AMTKLGSKHF LHI.GFRHPWS FLTVKGNPSS SVEDHIEYHG HItGSAAARVF 300 GTELKHMGQQ LVGQYPIHFH LAGDVDERGG YDPPTYIRDL SIHITT'FSRCV TVHGSNGLLI 600 RHTSALAFRL NNAWQSCPHN NVTGIAFEDV PITSRVFFGE PGPWFNQLDM DGDKTSVFHI) 960 NDFPSHI'LYLEGALTRSTHYQQYQPVVTLQKGYTIHWDQTAPAELAIWLINFNKGDWIRV 1080 QMAFVGFKGS FRPIWVTLDT EDHKAKIFQV VPIPVVKKKK L
Seq ID NO: 17 DNA seauence Nucleic Acid Accession #: NM_015515.1 Coding sequence: 61-1329 AGCCTTCAGA TTCTCATCAT TTTGCATCTA TTTTGTAGCC AATAAAACTC CGCACTAGC
Seq ID NO: 18 Protein seouence:
Protein Accession #: NP 056330.1 HA
Seq ID NO: 19 DNA seouence Nucleic Acid Accession #: see Table 25 & 25A for complete list GACTCAAAGG GAACATATAA ATGTTTCCTA TTTTTNNNNN NNNNNNNNNN NI'RJNNNNNNN 180 NNNNACCCAT CGTGCGATGA TCI;RJNNNNNN 1;11'~1V1'fNNNNNN NNNNNTTGGG ATCCAGTTTC 240 TGGCCTTCAA CCCAAGCCAG GAGTTTGGCT CAAATGA
Seq ID NO: 20 DNA seouence Nucleic Acid Accession #: D32051.1 Coding sequence: 72-1373 TAAAATCAAT AAAGTCTTAG TTGG
Seq ID NO: 21 Protein seauence:
Protein Accession #: BAA06809.1 IGFRAIAFLQ QPR
Seq ID NO: 22 DNA seouence Nucleic Acid Accession #: EOS cloned Coding sequence: 1-2424 DEMANDES OU BREVETS VOLUMINEUX
LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVETS
COMPRI~:ND PLUS D'UN TOME.
CECI EST L,E TOME 1 DE 2 NOTE: Pour les tomes additionels, veillez contacter le Bureau Canadien des Brevets.
JUMBO APPLICATIONS / PATENTS
THIS SECTION OF THE APPLICATION / PATENT CONTAINS MORE
THAN ONE VOLUME.

NOTE: For additional valumes please contact the Canadian Patent Office.

Claims

WHAT IS CLAIMED IS:

1. A method of detecting a metastatic colorectal cancer-associated transcript in a cell from a patient, the method comprising contacting a biological sample from the patient with a polynucleotide that selectively hybridizes to a sequence at least 80%
identical to a sequence as shown in Tables 1-26.

2. The method of claim 1, wherein the biological sample comprises isolated nucleic acids.

3. The method of claim 1, wherein the polynucleotide is labeled.

4. The method of claim 1, wherein the polynucleotide is immobilized on a solid surface.

5. An isolated nucleic acid molecule consisting of a polynucleotide sequence as shown in Tables 1-26.

6. An expression vector comprising the nucleic acid of claim 5.

7. A host cell comprising the expression vector of claim 6.

8. An isolated polypeptide which is encoded by a nucleic acid molecule having polynucleotide sequence as shown in Tables 1-26.

9. An antibody that specifically binds a polypeptide of claim 8.

10. The antibody of claim 10, which is an antibody fragment.

11. The antibody of claim 10, which is a humanized antibody

12. A method of detecting a metastatic colorectal cancer cell in a biological sample from a patient, the method comprising contacting the biological sample with an antibody of claim 9.

13. The method of claim 12, wherein the antibody is labeled.

14. A method of detecting antibodies specific to metastatic colorectal cancer in a patient, the method comprising contacting a biological sample from the patient with a polypeptide encoded by a nucleic acid comprises a sequence from Tables 1-26.

15. A method for identifying a compound that modulates a metastatic colorectal cancer-associated polypeptide, the method comprising the steps of:
(i) contacting the compound with a metastatic colorectal cancer-associated polypeptide, the polypeptide encoded by a polynucleotide that selectively hybridizes to a sequence at least 80% identical to a sequence as shown in Tables 1-26.; and (ii) determining the functional effect of the compound upon the polypeptide.

16. The method of claim 15, wherein the functional effect is determined by measuring ligand binding to the polypeptide.

17. A method of inhibiting proliferation of a metastatic colorectal cancer-associated cell to treat colorectal cancer in a patient, the method comprising the step of administering to the subject a therapeutically effective amount of a compound that modulates a polypeptide encoded by a sequence as shown in Tables 1-26.

18. A drug screening assay comprising the steps of (i) administering a test compound to a mammal having colorectal cancer or a cell isolated therefrom;
(ii) comparing the level of gene expression of a polynucleotide that selectively hybridizes to a sequence at least 80% identical to a sequence as shown in Tables 1-26. in a treated cell or mammal with the level of gene expression of the polynucleotide in a control cell or mammal, wherein a test compound that modulates the level of expression of the polynucleotide is a candidate for the treatment of colorectal cancer.

19. A pharmaceutical composition for treating a mammal having colorectal cancer, the composition comprising a compound identified by the assay of claim 18 and a physiologically acceptable excipient.

20. A method of detecting a metastatic colorectal cancer-associated polypeptide in a cell from a patient, the method comprising contacting a biological sample from the patient with a antibody that that specifically binds a polypeptide encoded by a nucleic acid molecule having polynucleotide sequence as shown in Tables 1-26.

21. The method of claim 21, wherein the antibody is labeled.