CA2525181A1 - Tnf-like secreted protein - Google Patents
Tnf-like secreted protein Download PDFInfo
- Publication number
- CA2525181A1 CA2525181A1 CA002525181A CA2525181A CA2525181A1 CA 2525181 A1 CA2525181 A1 CA 2525181A1 CA 002525181 A CA002525181 A CA 002525181A CA 2525181 A CA2525181 A CA 2525181A CA 2525181 A1 CA2525181 A1 CA 2525181A1
- Authority
- CA
- Canada
- Prior art keywords
- polypeptide
- nucleic acid
- disease
- acid molecule
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/472—Complement proteins, e.g. anaphylatoxin, C3a, C5a
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/18—Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/525—Tumour necrosis factor [TNF]
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; CARE OF BIRDS, FISHES, INSECTS; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Abstract
This invention relates to novel protein INSP058, herein identified as TNF-li ke secreted protein, and to the use of this protein and the nucleic acid sequen ce from the encoding gene in the diagnosis, prevention and treatment of disease .
Description
TNF-like Secreted Protein This invention relates to a novel protein, termed INSP058, herein identified as a TNF-like secreted protein, and to the use of this protein and the nucleic acid sequence from the encoding gene in the diagnosis, prevention and treatment of disease.
All publications, patents and patent applications cited herein are incorporated in full by reference.
Background The process of drug discovery is presently undergoing a fundamental revolution as the era of functional genomics comes of age. The term "functional genomics" applies to an to approach utilising bioinformatics tools to ascribe function to protein sequences of interest.
Such tools are becoming increasingly necessary as the speed of generation of sequence data is rapidly outpacing the ability of research laboratories to assign functions to these protein sequences.
As bioinformatics tools increase in potency and in accuracy, these tools are rapidly replacing the conventional techniques of biochemical characterisation. Indeed, the advanced bioinformatics tools used in identifying the present invention are now capable of outputting results in which a high degree of confidence can be placed.
Various institutions and commercial organisations are examining sequence data as they become available and significant discoveries are being made on an on-going basis. Incyte 2o Genomics, Inc., for example, have a published patent application (WO
00/68380) relating to sequences associated with human extracellular matrix and adhesion-associated proteins (EXMAD) and polynucleotides which identify and encode EXMAD. However, there remains a continuing need to identify and characterise further genes and the polypeptides that they encode, as targets for research and for drug discovery.
SECRETED PROTEINS
3o The ability of cells to make and secrete extracellular proteins is central to many biological processes. Enzymes, growth factors, extracellular matrix proteins and signalling molecules are all secreted by cells. This is through fusion of a secretory vesicle with the plasma membrane. In most cases, but not all, proteins are directed to the endoplasmic reticulum and into secretory vesicles by a signal peptide. Signal peptides are cis-acting sequences that affect the transport of polypeptide chains from the cytoplasm to a membrane bound compartment such as a secretory vesicle. Polypeptides that are targeted to the secretory vesicles are either secreted into the extracellular matrix or are retained in the plasma membrane. The polypeptides that are retained in the plasma membrane will have one or more transmembrane domains. Examples of secreted proteins that play a central role in the functioning of a cell are cytokines, hormones, extracellular matrix proteins (adhesion molecules), proteases, TNF-like proteins and growth and differentiation factors.
Alteration of the activity of secreted proteins thus provides a means to alter disease phenotype and as such, identification of novel secreted proteins, particularly TNF-like to secreted proteins, is highly relevant as they may play a role in certain diseases and thus be useful in the development of novel therapies.
THE INVENTION
The invention is based on the discovery that the INSP058 protein is a T'NF-like secreted protein. In one embodiment of the first aspect of the invention, there is provided a polypeptide which:
(i) comprises the amino acid sequence as recited in SEQ ID N0:8 andlor SEQ ID
N0:12;
(ii) is a fragment thereof which is a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptides of (i); or 2o (iii) is a functional equivalent of (i) or (ii).
According to a second embodiment of this first aspect of the invention, there is provided a polypeptide which:
(i) consists of the amino acid sequence as recited in SEQ ID N0:8 and/or SEQ
ID
NO:12, (ii) is a fragment thereof having the function of a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptide of (i); or (iii) is a functional equivalent of (i) or (ii).
Preferably, the fragment or functional equivalent of the first or second embodiments consists of the amino acid recited in SEQ ID N0:9 or SEQ ID N0:16.
3o The polypeptide having the sequence recited in SEQ ID N0:8 is referred to hereafter as "the INSP058 polypeptide". This protein is annotated herein as a TNF-like secreted protein. The closest link identified for this protein to proteins of known function is to complement 1 q proteins. Complement 1 q (C 1 q) proteins are TNF-related proteins in that crystollographic studies have revealed that TNF and the globular gC 1 q domain of mouse ACRP30 have a closely related tertiary structure and trimeric organization suggestive of an evolutionary link between the TNF and C 1 q families. The human C 1 q gene family comprises, to date, of 13 members, including collagenous members such as CRF, ACRP30, CORS26, EMILIN-1, EMILIN-2, collagens VII and X, and non-collagenous members such as precerebellin and multimerin. ACRP30 is an abundant serum protein, to synthesized in adipose tissue in response to insulin, and is down-regulated in the obese mouse and humans. For a recent review of the C 1 q family, see Bodmer et al., (2002), TRENDS in Biochemical Sciences 27(1):19-26.
C 1 q ~ family members may be useful for the treatment, prevention and/or diagnosis of medical conditions and diseases such as cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours;
myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma;
autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection;
cardiovascular 2o disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia; neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain;
developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by Clq family proteins.
It is anticipated that the INSP058 polypeptide is encoded by three axons (axon 1 encoding a polypeptide having the sequence recited in SEQ ID N0:2, axon 2 encoding a polypeptide having the sequence recited SEQ ID N0:4 and axon 3 encoding a polypeptide having the 3o sequence SEQ ID N0:6). A sequence of some similarity to SEQ ID N0:8 has been disclosed in the prior art, although the protein was not annotated as a secreted protein with a TNF-like fold. This polypeptide sequence, presented in SEQ ID N0:8 of International patent application WO00/68380, is explicitly excluded from the scope of this aspect of the present invention.
The polypeptide having the sequence recited in SEQ ID NO:10 is referred to hereafter as the "INSP058SV polypeptide" or "INSP058SV". The INSP0158SV polypeptide is a splice variant of the INSP058 polypeptide, caused by a deletion in the central portion of exon 3 (SEQ ID NO:S). The deletion, as well as deleting a portion of exon 3, introduces a frameshift into the nucleotide sequence, the result being an early stop codon, so that the translated INSPOSBSV polypeptide is much shorter in length than the INSP058 polypeptide (Figure 10). The INSP058SV protein lacks a domain matching the Clq domain that is found in the full length INSP058, suggesting that INSP058SV may be an antagonist of to INSP058, acting, for example, to compete with the INSP058 version of the polypeptide for the same binding site on the receptor. In such a mechanism, the INSP058SV
polypeptide would not stimulate the receptor, so that the normal biological effect would not be induced.
Such a polypeptide would therefore be a competitive inhibitor of the natural polypeptide.
Although the Applicant does not wish to be bound by this theory, it is postulated that the 1s first 15 amino acids of INSP058 polypeptide and INSP058SV polypeptide each form a signal peptide.
The full length INSP058 polypeptide sequence without this postulated signal sequence is recited in SEQ ID NO: 14.
The polypeptide having the sequence recited in SEQ ID N0:14 is referred to hereafter as 2o the "INSP058 mature polypeptide".
The term "INSP058 polypeptides" as used herein includes polypeptides comprising the INSP058 exon 1 polypeptide, the INSP058 exon 2 polypeptide, the INSP058 exon 3 polypeptide, the INSP058 polypeptide and the 1NSP058 mature polypeptide.
The full length INSP058SV polypeptide sequence without this postulated signal sequence 25 is recited in SEQ ID N0:16.
The polypeptide having the sequence recited in SEQ ID NO:16 is referred to hereafter as the "INSP058SV mature polypeptide".
The term "INSP058SV polypeptides" as used herein includes polypeptides comprising the the TNSP058SV mature polypeptide.
3o In a second aspect, the invention provides a purified nucleic acid molecule which encodes a polypeptide of the first aspect of the invention.
Preferably, the purified nucleic acid molecule comprises the nucleic acid sequence as recited in SEQ ID N0:7 (encoding the INSPOS8 polypeptide), SEQ ID N0:9 (encoding the INSP058SV polypeptide), SEQ ID NO:11 (encoding the exon 1 polypeptide of mature INSP058), SEQ ID NO:I3 (encoding the mature 1NSP058 polypeptide), SEQ ID NO:15 5 (encoding the mature INSP058SV polypeptide), or is a redundant equivalent or fragment of this sequence.
The invention further provides that the purified nucleic acid molecule consists of the nucleic acid sequence as recited in SEQ ID N0:7, SEQ ID N0:9 (encoding the INSP058SV polypeptide), SEQ ID NO:11 (encoding the exon 1 polypeptide of mature to INSP058 or mature INSP058SV), SEQ ID N0:13 (encoding the mature INSP058 polypeptide), SEQ ID NO:15 (encoding the mature INSP058SV polypeptide), or is a redundant equivalent or fragment of this sequence.
In a third aspect, the invention provides a purified nucleic acid molecule which hybridizes under high stringency conditions with a nucleic acid molecule of the second aspect of the invention.
In a fourth aspect, the invention provides a vector, such as an expression vector, that contains a nucleic acid molecule of the second or third aspect of the invention.
In a fifth aspect, the invention provides a host cell transformed with a vector of the fourth aspect of the invention.
2o In a sixth aspect, the invention provides a ligand that binds specifically to the polypeptide of the first aspect of the invention. Preferably, the ligand inhibits the function of a polypeptide of the first aspect of the invention which is a secreted protein with a TNF-lilce activity. Ligands to a polypeptide according to the invention may come in various forms, including natural or modified substrates, enzymes, receptors, small organic molecules such as small natural or synthetic organic molecules of up to 2000D, preferably 800D or lesss, peptidomimetics, inorganic molecules, peptides, polypeptides, antibodies, structural or functional mimetics of the aforementioned.
In a seventh aspect, the invention provides a compound that is effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the 3o invention or to regulate the activity of a polypeptide of the first aspect of the invention.
A compound of the seventh aspect of the invention may either increase (agonise) or decrease (antagonise) the level of expression of the gene or the activity of the polypeptide.
Importantly, the identification of the function of the INSP058 allows for the design of screening methods capable of identifying compounds that are effective in the treatment and/or diagnosis of disease. Ligands and compounds according to the sixth and seventh aspects of the invention may be identified using such methods. These methods are included as aspects of the present invention.
In an eighth aspect, the invention provides a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the f fth aspect of the l0 invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in therapy or diagnosis of diseases in which TNF-like secreted proteins are implicated. Such diseases may include, but are not limited to, cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours; myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma; autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis; psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection; cardiovascular disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia;
neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C 1 q family proteins. These molecules may also be used in the manufacture of a medicament for the treatment such diseases. The moieties of the first, second, third, fourth, fifth, sixth or seventh aspect of the invention may also be used in the maufacture of a medicament for the treatment of such diseases.
In a ninth aspect, the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide of the first aspect of the invention or the activity of a polypeptide of the first aspect of the invention in tissue from said patient and comparing said level of expression or activity to a control level, wherein a level that is different to said control level is indicative of disease.
Such a method will preferably be carried out i~z vitro. Similar methods may be used for monitoring the therapeutic treatment of disease in a patient, wherein altering the level of expression or activity of a polypeptide or nucleic acid molecule over the period of time towards a control level is indicative of regression of disease.
A preferred method for detecting polypeptides of the first aspect of the invention comprises the steps of (a) contacting a ligand, such as an antibody, of the sixth aspect of the invention with a biological sample under conditions suitable for the formation of a Iigand-polypeptide complex; and (b) detecting said complex.
to A number of different such methods according to the ninth aspect of the invention exist, as the skilled reader will be aware, such as methods of nucleic acid hybridization with short probes, point mutation analysis, polymerase chain reaction (PCR) amplification and methods using antibodies to detect aberrant protein levels. Similar methods may be used on a short or long term basis to allow therapeutic treatment of a disease to be monitored in a patient. The invention also provides kits that are useful in these methods for diagnosing disease.
Preferably, the disease diagnosed by a method of the ninth aspect of the invention is a disease in which a TNF-like secreted protein is implicated, as described above.
In a tenth aspect, the invention provides for the use of a polypeptide of the first aspect of 2o the invention as a TNF-like secreted protein.
In an eleventh aspect, the invention provides a pharmaceutical composition comprising a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, in conjunction with a pharmaceutically-acceptable carrier.
In a twelfth aspect, the present invention provides a polypeptide of the first aspect of the invention, ox a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the 3o invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in the manufacture of a medicament for the diagnosis or treatment of a disease.
Preferably, the disease is a disease in which TNF-like secreted proteins are implicated, as described above.
In a thirteenth aspect, the invention provides a method of treating a disease in a patient comprising administering to the patient a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention.
For diseases in which the expression of a natural gene encoding a polypeptide of the first to aspect of the invention, or in which the activity of a polypeptide of the first aspect of the invention, is lower in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an agonist.
Conversely, for diseases in which the expression of the natural gene or activity of the polypeptide is higher in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an antagonist. Examples of such antagonists include antisense nucleic acid molecules, ribozymes and ligands, such as antibodies.
s Preferably, the disease is a disease in which a TNF-like secreted protein is implicated, as 2o described above.
In a fourteenth aspect, the invention provides transgenic or knockout non-human animals that have been transformed to express higher, lower or absent levels of a polypeptide of the first aspect of the invention. Such transgenic animals are very useful models for the study of disease and may also be used in screening regimes for the identification of compounds that are effective in the treatment or diagnosis of such a disease.
A summary of standard techniques and procedures which may be employed in order to utilise the invention is given below. It will be understood that this invention is not limited to the particular methodology, protocols, cell lines, vectors and reagents described. It is also to be understood that the terminology used herein is for the purpose of describing 3o particular embodiments only and it is not intended that this terminology should limit the scope of the present invention. The extent of the invention is limited only by the terms of the appended claims.
Standard abbreviations fox nucleotides and amino acids are used in this specification.
The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA technology and immunology, which are within the skill of those working in the art.
Such techniques are explained fully in the literature. Examples of particularly suitable texts for consultation include the following: Molecular Cloning; A Laboratory Manual, Third Edition (Sambrook ed. 2001); DNA Cloning, Volumes I and II (D.N Glover ed.
I985);
Oligonucleotide Synthesis (M.J. Gait ed. I984); Nucleic Acid Hybridization (B.D. Hames to & S.J. Higgins eds. 1984); Transcription and Translation (B.D. Hames & S.J.
Higgins eds.
1984); Animal Cell Culture (R.I. Freshney ed. 1986); Immobilized Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide to Molecular Cloning (1984);
the Methods in Enzymology series (Academic Press, Inc.), especially volumes I54 ~ 155;
Gene Transfer Vectors for Mammalian Cells (J.H. Miller and M.P. Calos eds. 1987, Cold Spring Harbor Laboratory); Immunochemical Methods in Cell and Molecular Biology (Mayer and Walker, eds. 1987, Academic Press, London); Scopes, (I987) Protein Purification:
Principles and Practice, Second Edition (Springer Verlag, N.Y.); and Handbook of Experimental Immunology, Volumes I-IV (D.M. Weir and C. C. Blackwell eds.
I986).
As used herein, the term "polypeptide" includes any peptide or protein comprising two or 2o more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e.
peptide isosteres. This term refers both to short chains (peptides and oligopeptides) and to longer chains (proteins).
The polypeptide of the present invention may be in the form of a mature protein or may be a pre-, pro- or prepro- protein that can be activated by cleavage of the pre-, pro- or prepro-portion to produce an active mature polypeptide. In such polypeptides, the pre-, pro- or prepro- sequence may be a leader or secretory sequence or may be a sequence that is employed for purification of the mature polypeptide sequence.
The polypeptide of the first aspect of the invention may form part of a fusion protein. For example, it is often advantageous to include one or more additional amino acid sequences 3o which may contain secretory or leader sequences, pro-sequences, sequences which aid in purification, or sequences that confer higher protein stability, for example during recombinant production. Alternatively or additionally, the mature polypeptide may be :Cased with another compound, such as a compound to increase the half life of the polypeptide (for example, polyethylene glycol).
Polypeptides may contain amino acids other than the 20 gene-encoded amino acids, 5 modified either by natural processes, such as by post-translational processing or by chemical modification techniques which are well known in the axt. Among the known modifications which may commonly be present in polypeptides of the present invention are glycosylation, lipid attachment, sulphation, gamma-carboxylation, for instance of glutamic acid residues, hydroxylation and ADP-ribosylation. Other potential modifications l0 include acetylation, acylation, amidation, covalent attachment of flavin, covalent attachment of a haeme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulphide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, GPI anchor formation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. In fact, blockage of the amino or carboxyl terminus in a polypeptide, or both, by a covalent modification is common in naturally-occurring and synthetic polypeptides and such modifications may be present in polypeptides of the present invention.
The modifications that occur in a polypeptide often will be a function of how the polypeptide is made. For polypeptides that are made recombinantly, the nature and extent of the modifications in large part will be determined by the post-translational modification capacity of the particular host cell and the modification signals that are present in the amino acid sequence of the polypeptide in question. For instance, glycosylation patterns vary between different types of host cell.
The polypeptides of the present invention can be prepared in any suitable manner. Such 3o polypeptides include isolated naturally-occurring polypeptides (for example puxified from cell culture), recombinantly-produced polypeptides (including fusion proteins), synthetically-produced polypeptides or polypeptides that are produced by a combination of these methods.
The functionally-equivalent polypeptides of the first aspect of the invention may be polypeptides that are homologous to the INSP058 polypeptide. Two polypeptides are said to be "homologous", as the term is used herein, if the sequence of one of the polypeptides has a high enough degree of identity or similarity to the sequence of the other polypeptide.
"Identity" indicates that at any particular position in the aligned sequences, the amino acid residue is identical between the sequences. "Similarity" indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences. Degrees of identity and similarity can be readily calculated (Computational to Molecular Biology, Lesk, A.M., ed., Oxford University Press, New York, 1988;
Biocomputing. Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M.
and Devereux, J., eds., M Stockton Press, New York, 1991 ).
Homologous polypeptides therefore include natural biological variants (for example, allelic variants or geographical variations within the species from which the polypeptides are derived) and mutants (such as mutants containing amino acid substitutions, insertions or deletions) of the INSPOS8 polypeptide. Such mutants may include polypeptides in 2o which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code.
Typical such substitutions are among Ala, Val, Leu and Ile; among Ser and Thr;
among the acidic residues Asp and Glu; among Asn and Gln; among the basic residues Lys and Arg;
or among the aromatic residues Phe and Tyr. Particularly preferred are variants in which several, i.e. between 5 and 10, 1 and 5, 1 and 3, 1 and 2 or just 1 amino acids are substituted, deleted or added in any combination. Especially preferred are silent substitutions, additions and deletions, which do not alter the properties and activities of the protein. Also especially preferred in this regard are conservative substitutions. Such 3o mutants also include polypeptides in which one or more of the amino acid residues includes a substituent group.
Typically, greater than 30% identity between two polypeptides is considered to be an indication of functional equivalence. Preferably, functionally equivalent polypeptides of the first aspect of the invention have a degree of sequence identity with the polypeptide, or with active fragments thereof, of greater than 80%. More preferred polypeptides of the present invention have degrees of identity of greater than 85%, 90%, 95%, 98% or 99%, respectively to INSP058 polypeptide.
The functionally-equivalent polypeptides of the first aspect of the invention may also be polypeptides which have been identified using one or more techniques of structural alignment. For example, the Inpharmatica Genome Threader technology that forms one aspect of the search tools used to generate the Biopendium search database may be used (see co-pending International Patent Application PCT/GBOl/01105) to identify polypeptides of presently-unknown function which, while having low sequence identity as compared to the INSP058 polypeptide, are predicted to have the function of a TNF-like secreted protein, by virtue of sharing significant structural homology with the INSP058 polypeptide. By "significant structural homology" is meant that the Inpharmatica Genome Threader predicts two proteins to share structural homology with a certainty of 10% and above.
The polypeptides of the first aspect of the invention also include fragments of the 1NSP058 polypeptide and fragments of the functional equivalents of the INSP058 polypeptide, provided that those fragments retain the function of a TNF-like secreted protein or have an antigenic determinant in common with the INSP058 polypeptide.
As used herein, the term "fragment" refers to a polypeptide having an amino acid sequence that is the same as part, but not all, of the amino acid sequence of the polypeptide, or one of their functional equivalents. The fragments should comprise at least n consecutive amino acids from the sequence and, depending on the particular sequence, n preferably is 7 or more (for example, 8, 10, 12, 14, 16, 18, 20 or more).
Small fragments may form an antigenic determinant.
Fragments of the full length INSP058 polypeptide may consist of combinations of 1 or more of neighbouring exon sequences or even combinations of partial exon sequences.
For example, such combinations may include exons 1, 2 and the partial sequence of exon 3 of the INSP058 polypeptide, as is the case with INSP058SV.
Such fragments may be "free-standing", i.e. not part of or fused to other amino acids or polypeptides, or they may be comprised within a larger polypeptide of which they form a part or region. When comprised within a larger polypeptide, the fragment of the invention most preferably forms a single continuous region. For instance, certain preferred embodiments relate to a fragment having a pre - and/or pro- polypeptide region fused to the amino terminus of the fragment and/or an additional region fused to the carboxyl terminus of the fragment. However, several fragments may be comprised within a single larger polypeptide.
The polypeptides of the present invention or their immunogenic fragments (comprising at least one antigenic determinant) can be used to generate ligands, such as polyclonal or monoclonal antibodies, that are immunospecific for the polypeptides. Such antibodies may I o be employed to isolate or to identify clones expressing the polypeptides of the invention or to purify the polypeptides by affinity chromatography. The antibodies may also be employed as diagnostic or therapeutic aids, amongst other applications, as will be apparent to the skilled reader.
The term "immunospecific" means that the antibodies have substantially greater affinity for the polypeptides of the invention than their affinity for other related polypeptides in the prior art. As used herein, the term "antibody" refers to intact molecules as well as to fragments thereof, such as Fab, F(ab')2 and Fv, which are capable of binding to the antigenic determinant in question. Such antibodies thus bind to the polypeptides of the first aspect of the invention.
2o By "substantially greater affinity" we mean that there is a measurable increase in the affinity for a polypeptide of the invention as compared with the affinity for known cell-surface receptors.
Preferably, the affinity is at least I .5-fold, 2-fold, 5-fold 10-fold, 100-fold, 103-fold, 104-fold, 1 OS-fold or 106-fold greater for a polypeptide of the invention than for known cell-surface receptor polypeptides.
If polyclonal antibodies are desired, a selected mammal, such as a mouse, rabbit, goat or horse, may be immunised with a polypeptide of the first aspect of the invention. The polypeptide used to immunise the animal can be derived by recombinant DNA
technology or can be synthesized chemically. If desired, the polypeptide can be conjugated to a carrier 3o protein. Commonly used carriers to which the polypeptides may be chemically coupled include bovine serum albumin, thyroglobulin and keyhole limpet haemocyanin.
The coupled polypeptide is then used to immunise the animal. Serum from the immunised animal is collected and treated according to known procedures, for example by immunoaffinity chromatography.
Monoclonal antibodies to the polypeptides of the first aspect of the invention can also be readily produced by one skilled in the art. The general methodology for making monoclonal antibodies using hybridoma technology is well known (see, for example, Kohler, G. and Milstein, C., Nature 256: 495-497 (1975); Kozbor et al., Immunology Today 4: 72 (1983); Cole et al., 77-96 in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. (1985).
to Panels of monoclonal antibodies produced against the polypeptides of the first aspect of the invention can be screened for various properties, i.e., for isotype, epitope, affinity, etc.
Monoclonal antibodies are particularly useful in purification of the individual polypeptides against which they are directed. Alternatively, genes encoding the monoclonal antibodies of interest may be isolated from hybridomas, for instance by PCR techniques known in the art, and cloned and expressed in appropriate vectors.
Chimeric antibodies, in which non-human variable regions are joined or fused to human constant regions (see, fox example, Liu et al., Proc. Natl. Acad. Sci. USA, 84, 3439 (1987)), may also be of use.
The antibody may be modified to make it less immunogenic in an individual, for example 2o by humanisation (see Jones et al., Nature, 321, 522 (1986); Verhoeyen et al., Science, 239, 1534 (1988); Kabat et al., J. Immunol., 147, 1709 (199I); Queen et al., Proc.
Natl Acad.
Sci. USA, 86, 10029 (1989); Gorman et al., Proc. Natl Acad. Sci. USA, 88, 34181 (1991);
and Hodgson et al., Bio/Technology, 9, 421 (1991)). The term "humanised antibody", as used herein, refers to antibody molecules in which the CDR amino acids and selected other amino acids in the variable domains of the heavy and/or light chains of a non-human donor antibody have been substituted in place of the equivalent amino acids in a human antibody.
The humanised antibody thus closely resembles a human antibody but has the binding ability of the donor antibody.
In a further alternative, the antibody may be a "bispecific" antibody, that is an antibody 3o having two different antigen binding domains, each domain being directed against a different epitope.
Phage display technology may be utilised to select genes which encode antibodies with binding activities towards the polypeptides of the invention either from repertoires of PCR
amplified V-genes of lymphocytes from humans screened for possessing the relevant antibodies, or from naive libraries (McCafferty, J. et al., (1990), Nature 348, 552-554;
s Marks, J. et al., (1992) Biotechnology 10, 779-783). The affinity of these antibodies can also be improved by chain shuffling (Clackson, T. et al., (1991) Nature 352, 624-628).
Antibodies generated by the above techniques, whether polyclonal or monoclonal, have additional utility in that they may be employed as reagents in immunoassays, radioimmunoassays (RIA) or enzyme-linked immunosorbent assays (ELISA). In these 1 o applications, the antibodies can be labelled with an analytically-detectable reagent such as a radioisotope, a fluorescent molecule or an enzyme.
Preferred nucleic acid molecules of the second and third aspects of the invention are those which encode the polypeptide sequence recited in SEQ ID N0:8 and functionally equivalent polypeptides. These nucleic acid molecules may be used in the methods and 15 applications described herein. The nucleic acid molecules of the invention preferably comprise at least n consecutive nucleotides from the sequences disclosed herein where, depending on the particular sequence, n is 10 or more (for example, 12, 14, 15, 18, 20, 25, 30, 35, 40 or more).
The nucleic acid molecules of the invention also include sequences that are complementary 2o to nucleic acid molecules described above (for example, for antisense or probing purposes).
Nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance cDNA, synthetic DNA or genomic DNA. Such nucleic acid molecules may be obtained by cloning, by chemical synthetic techniques or by a combination thereof. The nucleic acid molecules can be prepared, for example, by chemical synthesis using techniques such as solid phase phosphoramidite chemical synthesis, from genomic or cDNA libraries or by separation from an organism.
RNA molecules may generally be generated by the in vitro or in vivo transcription of DNA
sequences.
3o The nucleic acid molecules may be double-stranded or single-stranded.
Single-stranded DNA may be the coding strand, also known as the sense strand, or it may be the non-coding strand, also referred to as the anti-sense strand.
The term "nucleic acid molecule" also includes analogues of DNA and RNA, such as those containing modified backbones, and peptide nucleic acids (PNA). The term "PNA", as used herein, refers to an antisense molecule or an anti-gene agent which comprises an oligonucleotide of at least five nucleotides in length linked to a peptide backbone of amino acid residues, which preferably ends in lysine. The terminal lysine confers solubility to the composition. PNAs may be pegylated to extend their lifespan in a cell, where they preferentially bind complementary single stranded DNA and RNA and stop transcript elongation (Nielsen, P.E. et al., (I993) Anticancer Drug Des. 8:53-63).
A nucleic acid molecule which encodes the polypeptide of SEQ ID N0:8, may be identical 1 o to the coding sequence of the nucleic acid molecule shown in SEQ ID N0:7.
These molecules also may have a different sequence which, as a result of the degeneracy of the genetic code, encodes a polypeptide of SEQ ID N0:8. Such nucleic acid molecules may include, but are not limited to, the coding sequence for the mature polypeptide by itself; the coding sequence for the mature polypeptide and additional coding sequences, such as those encoding a leader or secretory sequence, such as a pro-, pre- or prepro-polypeptide sequence; the coding sequence of the mature polypeptide, with or without the aforementioned additional coding sequences, together with further additional, non-coding sequences, including non-coding 5' and 3' sequences, such as the transcribed, non-translated sequences that play a role in transcription (including termination signals), 2o ribosome binding and mRNA stability. The nucleic acid molecules may also include additional sequences which encode additional amino acids, such as those which provide additional functionalities.
The nucleic acid molecules of the second and third aspects of the invention may also encode the fragments or the functional equivalents of the polypeptides and fragments of the first aspect of the invention. Such a nucleic acid molecule may be a naturally-occurring variant such as a naturally-occurring allelic variant, or the molecule may be a variant that is not known to occur naturally. Such non-naturally occurring variants of the nucleic acid molecule may be made by mutagenesis techniques, including those applied to nucleic acid molecules, cells or organisms.
Among variants in this regard are variants that differ from the aforementioned nucleic acid molecules by nucleotide substitutions, deletions or insertions. The substitutions, deletions or insertions may involve one or more nucleotides. The variants may be altered in coding or non-coding regions or both. Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or insertions.
The nucleic acid molecules of the invention can also be engineered, using methods generally known in the art, for a variety of reasons, including modifying the cloning, processing, and/or expression of the gene product (the polypeptide). DNA
shuffling by xandom fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides are included as techniques which may be used to engineer the nucleotide sequences. Site-directed mutagenesis may be used to insert new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, introduce 1 o mutations and so forth.
Nucleic acid molecules which encode a polypeptide of the first aspect of the invention may be ligated to a heterologous sequence so that the combined nucleic acid molecule encodes a fusion protein. Such combined nucleic acid molecules are included within the second or third aspects of the invention. For example, to screen peptide libraries for inhibitors of the activity of the polypeptide, it may be useful to express, using such a combined nucleic acid molecule, a fusion protein that can be recognised by a commercially-available antibody. A
fusion protein may also be engineered to contain a cleavage site located between the sequence of the polypeptide of the invention and the sequence of a heterologous protein so that the polypeptide may be cleaved and purified away from the heterologous protein.
2o The nucleic acid molecules of the invention also include antisense molecules that are partially complementary to nucleic acid molecules encoding polypeptides of the present invention and that therefore hybridize to the encoding nucleic acid molecules (hybridization). Such antisense molecules, such as oligonucleotides, can be designed to recognise, specifically bind to and prevent transcription of a target nucleic acid encoding a polypeptide of the invention, as will be lcnown by those of ordinary skill in the art (see, for example, Cohen, J.S., Trends in Pharm. Sci., 10, 435 (1989), Okano, J.
Neurochem. 56, 560 (1991); O'Connor, J. Neurochem 56, 560 (1991); Lee et al., Nucleic Acids Res 6, 3073 (1979); Cooney et al., Science 241, 456 (1988); Dervan et al., Science 251, 1360 (I99I).
The term "hybridization" as used here refers to the association of two nucleic acid 3o molecules with one another by hydrogen bonding. Typically, one molecule will be fixed to a solid support and the other will be free in solution. Then, the two molecules may be placed in contact with one another under conditions that favour hydrogen bonding. Factors l~
that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase molecule to the solid support (Denhardt's reagent or BLOTTO); the concentration of the molecules; use of compounds to increase the rate of association of molecules (dextran sulphate or polyethylene glycol); and the stringency of the washing conditions following hybridization (see Sambrook et al., [supra]).
The inhibition of hybridization of a completely complementary molecule to a target molecule may be examined using a hybridization assay, as known in the art (see, for example, Sambrook et al., [sups°a]). A substantially homologous molecule will then compete for and inhibit the binding of a completely homologous molecule to the target molecule under various conditions of stringency, as taught in Wahl, G.M. and S.L. Berger (1987; Methods Enzymol. 152:399-407) and Kimmel, A.R. (1987; Methods Enzymol.
I 52:507-S I 1 ).
"Stringency" refers to conditions in a hybridization reaction that favour the association of very similar molecules over association of molecules that differ. High stringency hybridisation conditions are defined as overnight incubation at 42°C in a solution comprising 50% formamide, SXSSC (150mM NaCI, ISmM trisodium citrate), SOmM
sodium phosphate (pH7.6), Sx Denhardts solution, 10% dextran sulphate, and 20 microgram/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 2o O.IX SSC at approximately 65°C. Low stringency conditions involve the hybridisation reaction being carried out at 35°C (see Sambrook et al., [supra]).
Preferably, the conditions used for hybridization are those of high stringency.
Preferred embodiments of this aspect of the invention are nucleic acid molecules that are at least 70% identical over their entire length to a nucleic acid molecule encoding the INSP058 polypeptide (SEQ ID N0:8), and nucleic acid molecules that axe substantially complementary to said nucleic acid molecules of this embodiment. Preferably, a nucleic acid molecule according to this aspect of the invention comprises a region that is at least 97% identical over its entire length to such coding sequences, or is a nucleic acid molecule that is complementary thereto. In this regard, nucleic acid molecules at least 98%, 3o preferably at least 99% or more identical over their entire length to the same axe particularly preferred. Preferred embodiments in this respect are nucleic acid molecules that encode polypeptides which retain substantially the same biological function or activity as the INSP058 polypeptide.
The invention also provides a process for detecting a nucleic acid molecule of the invention, comprising the steps of (a) contacting a nucleic probe according to the invention with a biological sample under hybridizing conditions to form duplexes; and (b) detecting any such duplexes that are formed.
As discussed additionally below in connection with assays that may be utilised according to the invention, a nucleic acid molecule as described above may be used as a hybridization probe for RNA, cDNA or genomic DNA, in order to isolate full-length cDNAs and genomic clones encoding the INSP058 polypeptide and to isolate cDNA
and to genomic clones of homologous or orthologous genes that have a high sequence similarity to the gene encoding this polypeptide.
In this regard, the following techniques, among others known in the art, may be utilised and are discussed below for purposes of illustration. Methods for DNA
sequencing and analysis are well known and are generally available in the art and may, indeed, be used to practice many of the embodiments of the invention discussed herein. Such methods may employ such enzymes as the Klenow fragment of DNA polyrnerase I, Sequenase (US
Biochemical Corp, Cleveland, OH), Taq polymerase (Pexkin Elmer), thexmostable polymerase (Amersham, Chicago, IL), or combinations of polymerases and proof reading exonucleases such as those found in the ELONGASE Amplification System marketed by 2o Gibco/BRL (Gaithersburg, MD). Preferably, the sequencing process may be automated using machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), the Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) and the ABI Catalyst and and 377 DNA Sequencers (Perkin Elmer).
One method for isolating a nucleic acid molecule encoding a polypeptide with an equivalent function to that of the INSP058 polypeptide is to probe a genomic or cDNA
library with a natural or artifcially-designed probe using standard procedures that are recognised in the art (see, for example, "Current Protocols in Molecular Biology", Ausubel et al., (eds). Greene Publishing Association and John Wiley Interscience, New York, 1989,1992). Probes comprising at least 15, preferably at least 30, and more preferably at least 50, contiguous bases that correspond to, or are complementary to, nucleic acid sequences from the appropriate encoding gene (SEQ ID N0:7), are particularly useful probes. Such probes may be labelled with an analytically-detectable reagent to facilitate their identification. Useful reagents include, but are not limited to, radioisotopes, fluorescent dyes and enzymes that are capable of catalysing the formation of a detectable product. Using these probes, the ordinarily skilled artisan will be capable of isolating complementary copies of genomic DNA, cDNA or RNA polynucleotides encoding s proteins of interest from human, mammalian or other animal sources and screening such sources for related sequences, for example, for additional members of the family, type and/or subtype.
In many cases, isolated cDNA sequences will be incomplete, in that the region encoding the polypeptide will be cut short, normally at the 5' end. Several methods are available to to obtain full length cDNAs, or to extend short cDNAs. Such sequences may be extended utilising a partial nucleotide sequence and employing various methods known in the art to detect upstream sequences such as promoters and regulatory elements. For example, one method which may be employed is based on the method of Rapid Amplification of cDNA
Ends (RACE; see, for example, Frohman et al., PNAS USA 85, 8998-9002, 1988).
Recent i s modifications of this technique, exemplified by the MarathonTM technology (Clontech Laboratories Inc.), for example, have significantly simplified the search for longer cDNAs.
A slightly different technique, termed "restriction-site" PCR, uses universal primers to retrieve unknown nucleic acid sequence adjacent a known locus (Sarkar, G.
(1993) PCR
Methods Applic. 2:318-322). Inverse PCR may also be used to amplify or to extend 2o sequences using divergent primers based on a known region (Triglia, T. et al., (1988) Nucleic Acids Res. 16:8186). Another method which may be used is capture PCR
which involves PCR amplification of DNA fragments adjacent a known sequence in human and yeast artificial chromosome DNA (Lagerstrom, M. et al., (1991) PCR Methods Applic., l, 111-119). Another method which may be used to retrieve unknown sequences is that of Parker, J.D. et al., (1991); Nucleic Acids Res. 19:3055-3060). Additionally, one may use PCR, nested primers, and PromoterFinderTM libraries to walk genomic DNA
(Clontech, Palo Alto, CA). This process avoids the need to screen libraries and is useful in finding intron/exon junctions.
When screening for full-length cDNAs, it is preferable to use libraries that have been size-3o selected to include larger cDNAs. Also, random-primed libraries are preferable, in that they will contain more sequences that contain the 5' regions of genes. Use of a randomly primed library may be especially preferable for situations in which an oligo d(T) library does not yield a full-length cDNA. Genomic libraries may be useful for extension of sequence into 5' non-transcribed regulatory regions.
In one embodiment of the invention, the nucleic acid molecules of the present invention may be used for chromosome localisation. In this technique, a nucleic acid molecule is specifically targeted to, and can hybridize with, a particular location on an individual human chromosome. The mapping of relevant sequences to chromosomes according to the present invention is an important step in the confirmatory correlation of those sequences with the gene-associated disease. Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found in, for example, V.
McKusick, to Mendelian Inheritance in Man (available on-line through Johns Hopkins University Welch Medical Library). The relationships between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes). This provides valuable information to investigators searching for disease genes using positional cloning or other gene discovery techniques.
Once the disease or syndrome has been crudely localised by genetic linkage to a particular genomic region, any sequences mapping to that area may represent associated or regulatory genes for further investigation. The nucleic acid molecule may also be used to detect differences in the chromosomal location due to translocation, inversion, etc, among normal, carrier, or affected individuals.
2o The nucleic acid molecules of the present invention are also valuable for tissue localisation. Such techniques allow the determination of expression patterns of the polypeptide in tissues by detection of the mRNAs that encode them. These techniques include in situ hybridization techniques and nucleotide amplification techniques, such as PCR. Results from these studies provide an indication of the normal functions of the polypeptide in the organism. In addition, comparative studies of the normal expression pattern of mRNAs with that of mRNAs encoded by a mutant gene provide valuable insights into the role of mutant polypeptides in disease. Such inappropriate expression may be of a temporal, spatial or quantitative nature.
Gene silencing approaches may also be undertaken to down-regulate endogenous 3o expression of a gene encoding a polypeptide of the invention. RNA
interference (RNAi) (Elbashir, SM et al., Nature 2001, 41 l, 494-49~) is one method of sequence specific post-transcriptional gene silencing that may be employed. Short dsRNA
olignonucleotides are synthesised in vitf°o and introduced into a cell. The sequence specific binding of these dsRNA oligonuclotides triggers the degradation of target mRNA, reducing or ablating target protein expression.
Efficacy of the gene silencing approaches assessed above may be assessed through the measurement of polypeptide expression (for example, by Western blotting), and at the RNA level using TaqMan-based methodologies.
The vectors of the present invention comprise nucleic acid molecules of the invention and may be cloning or expression vectors. The host cells of the invention, which may be transformed, transfected or transduced with the vectors of the invention may be 1 o prokaryotic or eukaryotic.
The polypeptides of the invention may be prepared in recombinant form by expression of their encoding nucleic acid molecules in vectors contained within a host cell.
Such expression methods are well known to those of skill in the art and many are described in detail by Sambrook et al., (suy°a) and Fernandez & Hoeffler (1998, eds.
"Gene expression systems. Using nature for the art of expression". Academic Press, San Diego, London, Boston, New York, Sydney, Tokyo, Toronto).
Generally, any system or vector that is suitable to maintain, propagate or express nucleic acid molecules to produce a polypeptide in the required host may be used. The appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-2o known and routine techniques, such as, for example, those described in Sambrook et al., (supra). Generally, the encoding gene can be placed under the control of a control element such as a promoter, ribosome binding site (for bacterial expression) and, optionally, an operator, so that the DNA sequence encoding the desired polypeptide is transcribed into RNA in the transformed host cell.
Examples of suitable expression systems include, for example, chromosomal, episomal and virus-derived systems, including, for example, vectors derived from: bacterial plasmids, bacteriophage, transposons, yeast episomes, insertion elements, yeast chromosomal elements, viruses such as baculoviruses, papova viruses such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, or combinations 3o thereof, such as those derived from plasmid and bacteriophage genetic elements, including cosmids and phagemids. Human artificial chromosomes (HACs) may also be employed to deliver larger fragments of DNA than can be contained and expressed in a plasmid.
Particularly suitable expression systems include microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors;
yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (for example, baculovirus); plant cell systems transformed with virus expression vectors (for example, cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (for example, Ti or pBR322 plasmids); or animal cell systems. Cell-free translation systems can also be employed to produce the polypeptides of the invention.
Introduction of nucleic acid molecules encoding a polypeptide of the present invention into 1 o host cells can be effected by methods described in many standard laboratory manuals, such as Davis et al., Basic Methods in Molecular Biology (1986) and Sambrook et al.,[supra].
Particularly suitable methods include calcium phosphate transfection, DEAE-dextran mediated transfection, transfection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction or infection (see Sambrook et al., 1989 [supra]; Ausubel et al., 1991 [supra]; Spector, Goldman ~
Leinwald, 1998). In eukaryotic cells, expression systems may either be transient (for example, episomal) or permanent (chromosomal integration) according to the needs of the system.
The encoding nucleic acid molecule may or may not include a sequence encoding a control 2o sequence, such as a signal peptide or leader sequence, as desired, for example, for secretion of the translated polypeptide into the lumen of the endoplasmic reticulum, into the periplasmic space or into the extracellular environment. These signals may be endogenous to the polypeptide or they may be heterologous signals. Leader sequences can be removed by the bacterial host in post-translational processing.
In addition to control sequences, it may be desirable to add regulatory sequences that allow for regulation of the expression of the polypeptide relative to the growth of the host cell.
Examples of regulatory sequences are those which cause the expression of a gene to be increased or decreased in response to a chemical or physical stimulus, including the presence of a regulatory compound or to various temperature or metabolic conditions.
Regulatory sequences are those non-translated regions of the vector, such as enhancers, promoters and 5' and 3' untranslated regions. These interact with host cellular proteins to carry out transcription and translation. Such regulatory sequences may vary in their strength and specificity. Depending on the vector system and host utilised, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. For example, when cloning in bacterial systems, inducible promoters such as the hybrid lack promoter of the Bluescript phagemid (Stratagene, LaJolla, CA) or pSportlTM plasmid (Gibco BRL) and the like may be used. The baculovirus polyhedrin promoter may be used in insect cells. Promoters or enhancers derived from the genomes of plant cells (for example, heat shock, RUBISCO and storage protein genes) or from plant viruses (for example, viral promoters or leader sequences) may be cloned into the vector. In mammalian cell systems, promoters from mammalian genes or from to mammalian viruses axe preferable. If it is necessary to generate a cell line that contains multiple copies of the sequence, vectors based on SV40 or EBV may be used with an appropriate selectable marker.
An expression vector is constructed so that the particular nucleic acid coding sequence is located in the vector with the appropriate regulatory sequences, the positioning and orientation of the coding sequence with respect to the regulatory sequences being such that the coding sequence is transcribed under the "control" of the regulatory sequences, i.e., RNA polymerase which binds to the DNA molecule at the control sequences transcribes the coding sequence. In some cases it may be necessary to modify the sequence so that it may be attached to the control sequences with the appropriate orientation;
i.e., to maintain 2o the reading frame.
The control sequences and other regulatory sequences may be ligated to the nucleic acid coding sequence prior to insertion into a vector. Alternatively, the coding sequence can be cloned directly into an expression vector that already contains the control sequences and an appropriate restriction site.
For long-term, high-yield production of a recombinant polypeptide, stable expression is preferred. For example, cell lines which stably express the polypeptide of interest may be transformed using expression vectors which may contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells may be allowed to grow for 1-2 days 3o in an enriched media before they are switched to selective media. The purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences.
Resistant clones of stably transformed cells may be proliferated using tissue culture techniques appropriate to the cell type.
Mammalian cell lines available as hosts for expression are known in the art and include many immortalised cell lines available from the American Type Culture Collection 5 (ATCC) including, but not limited to, Chinese hamster ovary (CHO), HeLa, baby hamster kidney (BHK), monkey kidney (COS), C127, 3T3, BHK, HEK 293, Bowes melanoma and human hepatocellular carcinoma (for example Hep G2) cells and a number of other cell lines.
In the baculovirus system, the materials for baculovirus/insect cell expression systems are Io commercially available in kit form from, inter alia, Invitrogen, San Diego CA (the "MaxBac" kit). These techniques are generally known to those skilled in the art and are described fully in Summers and Smith, Texas Agricultural Experiment Station Bulletin No.
1555 (1987). Particularly suitable host cells for use in this system include insect cells such as Drosophila S2 and Spodoptera Sf3 cells.
15 There are many plant cell culture and whole plant genetic expression systems known in the art. Examples of suitable plant cellular genetic expression systems include those described in US 5,693,506; US 5,659,122; and US 5,608,143. Additional examples of genetic expression in plant cell culture has been described by Zenk, Phytochemistry 30:3861-3863 (1991).
2o In particular, all plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be utilised, so that whole plants are recovered which contain the transferred gene. Practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugar cane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
25 Examples of particularly prefewed bacterial host cells include streptococci, staphylococci, E. coli, Streptomyces and Bacillus subtilis cells.
Examples of particularly suitable host cells for fungal expression include yeast cells (for example, S. cerevisiae) and Aspergillus cells.
Any number of selection systems are known in the art that may be used to recover 3o transformed cell lines. Examples include the herpes simplex virus thymidine kinase (Wigler, M. et al., (1977) Cell 11:223-32) and adenine phosphoribosyltransferase (Lowy, I.
et al., (1980) Cell 22:817-23) genes that can be employed in tk~ or aprt~
cells, respectively.
Also, antimetabolite, antibiotic or herbicide resistance can be used as the basis for selection; for example, dihydrofolate reductase (DHFR) that confers resistance to methotrexate (Wigler, M, et al., (1980) Proc. Natl. Acad. Sci. 77:3567-70);
npt, which confers resistance to the aminoglycosides neomycin and G-418 (Colbere-Garapin, F. et al., (1981) J. Mol. Biol. 150:1-14) and als or pat, which confer resistance to chlorsulfiuon and phosphinotricin acetyltransferase, respectively. Additional selectable genes have been described, examples of which will be clear to those of skill in the art.
Although the presence or absence of marker gene expression suggests that the gene of to interest is also present, its presence and expression may need to be confirmed. For example, if the relevant sequence is inserted within a marker gene sequence, transformed cells containing the appropriate sequences can be identif ed by the absence of marker gene function. Alternatively, a marker gene can be placed in tandem with a sequence encoding a polypeptide of the invention under the control of a single promoter.
Expression of the marker gene in response to induction or selection usually indicates expression of the tandem gene as well.
Alternatively, host cells that contain a nucleic acid sequence encoding a polypeptide of the invention and which express said polypeptide may be identified by a variety of procedures known to those of skill in the art. These procedures include, but are not limited to, DNA-2o DNA or DNA-RNA hybridizations and protein bioassays, fox example, fluorescence activated cell sorting (FACS) or immunoassay techniques (such as the enzyme-linked immunosorbent assay [ELISA] and radioimmunoassay [RIA]), that include membrane, solution, or chip based technologies for the detection andlor quantification of nucleic acid or protein (see Hampton, R. et al., (1990) Serological Methods, a Laboratory Manual, APS
Press, St Paul, MN) and Maddox, D.E. et al., (1983) J. Exp. Med, 158, 1211-1216).
A wide variety of labels and conjugation techniques are known by those skilled in the art and may be used in various nucleic acid and amino acid assays. Means for producing labelled hybridization or PCR probes for detecting sequences related to nucleic acid molecules encoding polypeptides of the present invention include oligolabelling, nick 3o translation, end-labelling or PCR amplification using a labelled polynucleotide.
Alternatively, the sequences encoding the polypeptide of the invention may be cloned into a vector for the production of an mRNA probe. Such vectors are known in the art, are commercially available, and may be used to synthesise RNA probes in vitro by addition of an appropriate RNA polymerase such as T7, T3 or SP6 and labelled nucleotides.
These procedures may be conducted using a variety of commercially available kits (Pharmacia &
Upjohn, (Kalamazoo, MI); Promega (Madison WI); and U.S. Biochemical Corp., Cleveland, OH)).
Suitable reporter molecules or labels, which may be used for ease of detection, include radionuclides, enzymes and fluorescent, chemiluminescent or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
Nucleic acid molecules according to the present invention may also be used to create Io transgenic animals, particularly rodent animals. Such transgenic animals form a further aspect of the present invention. This may be done locally by modification of somatic cells, or by germ line therapy to incorporate heritable modifcations. Such transgenic animals may be particularly useful in the generation of animal models for drug molecules effective as modulators of the polypeptides of the present invention.
The polypeptide can be recovered and purif ed from recombinant cell cultures by well-known methods including ammonium sulphate or ethanol precipitation, acid extraction, anion or ration exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. High performance liquid chromatography is 2o particularly useful for purification. Well known techniques for refolding proteins may be employed to regenerate an active conformation when the polypeptide is denatured during isolation and or purification.
Specialised vector constructions may also be used to facilitate purification of proteins, as desired, by joining sequences encoding the polypeptides of the invention to a nucleotide sequence encoding a polypeptide domain that will facilitate purification of soluble proteins. Examples of such purification-facilitating domains include metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilised metals, protein A domains that allow purification on immobilised immunoglobulin, and the domain utilised in the FLAGS extension/affinity purification system (Immunex Corp., 3o Seattle, WA). The inclusion of cleavable linker sequences such as those specific fox Factor XA or enterolcinase (Invitrogen, San Diego, CA) between the purification domain and the polypeptide of the invention may be used to facilitate purification. One such expression vector provides for expression of a fusion protein containing the polypeptide of the invention fused to several histidine residues preceding a thioredoxin or an enterokinase cleavage site. The histidine residues facilitate purification by IMAC
(immobilised metal ion affinity chromatography as described in Porath, J. et al., (1992), Prot.
Exp. Purif. 3:
263-281) while the thioredoxin or enterokinase cleavage site provides a means for purifying the polypeptide from the fusion protein. A discussion of vectors which contain fusion proteins is provided in Kroll, D.J. et al., (1993; DNA Cell Biol.
12:441-453).
If the polypeptide is to be expressed for use in screening assays, generally it is preferred that it be produced at the surface of the host cell in which it is expressed.
In this event, the 1 o host cells may be harvested prior to use in the screening assay, for example using techniques such as fluorescence activated cell sorting (FACS) or immunoaffinity techniques. If the polypeptide is secreted into the medium, the medium can be recovered in order to recover and purify the expressed polypeptide. If polypeptide is produced intracellularly, the cells must first be lysed before the polypeptide is recovered.
The polypeptide of the invention can be used to screen libraries of compounds in any of a variety of drug screening techniques. Such compounds may activate (agonise) or inhibit (antagonise) the level of expression of the gene or the activity of the polypeptide of the invention and form a further aspect of the present invention. Preferred compounds are effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the invention or to regulate the activity of a polypeptide of the fzrst aspect of the invention.
Agonist or antagonist compounds may be isolated from, for example, cells, cell-free preparations, chemical libraries or natural product mixtuxes. These agonists or antagonists may be natural or modified substrates, ligands, enzymes, receptors or structural or functional mimetics. For a suitable review of such screening techniques, see Coligan et al., Current Protocols in Immunology 1(2):Chapter 5 (1991).
Compounds that are most likely to be good antagonists are molecules that bind to the polypeptide of the invention without inducing the biological effects of the polypeptide upon binding to it. Potential antagonists include small organic molecules, peptides, 3o polypeptides and antibodies that bind to the polypeptide of the invention and thereby inhibit or extinguish its activity. In this fashion, binding of the polypeptide to normal cellular binding molecules may be inhibited, such that the normal biological activity of the polypeptide is prevented.
The polypeptide of the invention that is employed in such a screening technique may be free in solution, affixed to a solid support, borne on a cell surface or located intracellularly.
In general, such screening procedures may involve using appropriate cells or cell membranes that express the polypeptide that are contacted with a test compound to observe binding, or stimulation or inhibition of a functional response. The functional response of the cells contacted with the test compound is then compared with control cells that were not contacted with the test compound. Such an assay may assess whether the test compound results in a signal generated by activation of the polypeptide, using an to appropriate detection system. Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist in the presence of the test compound is observed.
A preferred method for identifying an agonist or antagonist compound of a polypeptide of the present invention comprises:
(a) contacting a cell expressing on the surface thereof the polypeptide according to the first aspect of the invention, the polypeptide being associated with a second component capable of providing a detectable signal in response to the binding of a compound to the polypeptide, with a compound to be screened under conditions to permit binding to the polypeptide; and 2o (b) determining whether the compound binds to and activates or inhibits the polypeptide by measuring the level of a signal generated from the interaction of the compound with the polypeptide.
A further preferred method for identifying an agonist or antagonist of a polypeptide of the invention comprises:
(a) contacting a cell expressing on the surface thereof the polypeptide, the polypeptide being associated with a second component capable of providing a detectable signal in response to the binding of a compound to the polypeptide, with a compound to be screened under conditions to permit binding to the polypeptide; and (b) determining whether the compound binds to and activates or inhibits the polypeptide by comparing the level of a signal generated from the interaction of the compound with the polypeptide with the level of a signal in the absence of the compound.
In further preferred embodiments, the general methods that are described above may further comprise conducting the identification of agonist or antagonist in the presence of labelled or unlabelled ligand for the polypeptide.
In another embodiment of the method for identifying an agonist or antagonist of a 5 polypeptide of the present invention comprises:
determining the inhibition of binding of a ligand to cells which have a polypeptide of the invention on the surface thereof, or to cell membranes containing such a polypeptide, in the presence of a candidate compound under conditions to permit binding to the polypeptide, and determining the amount of ligand bound to the polypeptide. A
compound to capable of causing reduction of binding of a ligand is considered to be an agonist or antagonist. Preferably the ligand is labelled.
More particularly, a method of screening for a polypeptide antagonist or agonist compound comprises the steps of:
(a) incubating a labelled ligand with a whole cell expressing a polypeptide according to the 15 invention on the cell surface, or a cell membrane containing a polypeptide of the invention, (b) measuring the amount of labelled ligand bound to the whole cell or the cell membrane;
(c) adding a candidate compound to a mixture of labelled ligand and the whole cell or the cell membrane of step (a) and allowing the mixture to attain equilibrium;
(d) measuring the amount of labelled ligand bomd to the whole cell or the cell membrane 2o after step (c); and (e) comparing the difference in the labelled ligand bound in step (b) and (d), such that the compound which causes the reduction in binding in step (d) is considered to be an agonist or antagonist.
In certain of the embodiments described above, simple binding assays may be used, in 25 which the adherence of a test compound to a surface bearing the polypeptide is detected by means of a label directly or indirectly associated with the test compound or in an assay involving competition with a labelled competitor. In another embodiment, competitive drug screening assays may be used, in which neutralising antibodies that are capable of binding the polypeptide specifically compete with a test compound for binding.
In this 3o manner, the antibodies can be used to detect the presence of any test compound that possesses specific binding affinity for the polypeptide.
Alternatively, if the wild type version of the polypeptide of the present invention (INSP058) normally binds to a receptor in nature, then in another aspect of the invention, the polypeptide of the present invention may be an antagonist of the wild type version of the polypeptide. An example of such a polypeptide is thought to be INSP058SV.
In this s aspect of the invention, the polypeptide of the present invention is able to compete with the INSP058 polypeptide for the same binding site on the receptor. The INSP058SV
polypeptide would not stimulate the receptor, so that the normal biological effect is not induced. The polypeptide of the present invention is therefore a competitive inhibitor of the natural polypeptide. Preferably, a competitive inhibitor according to this aspect of the 1 o invention comprises or consists of the amino acid sequence as recited in SEQ ID NO: I O or SEQ ID N0:16. The methods described above for screening antagonists can be readily adapted by a skilled person to screen for competitive inhibitors.
Assays may also be designed to detect the effect of added test compounds on the production of mRNA encoding the polypeptide in cells. For example, an ELISA
may be i s constructed that measures secreted or cell-associated levels of polypeptide using monoclonal or polyclonal antibodies by standard methods known in the art, and this can be used to search for compounds that may inhibit or enhance the production of the polypeptide from suitably manipulated cells or tissues. The formation of binding complexes between the polypeptide and the compound being tested may then be measured.
2o Assay methods that are also included within the terms of the present invention are those that involve the use. of the genes and polypeptides of the invention in overexpression or ablation assays. Such assays involve the manipulation of levels of these genes/polypeptides in cells and assessment of the impact of this manipulation event on the physiology of the manipulated cells. Fox example, such experiments reveal details of signalling and 25 metabolic pathways in which the particular genes/polypeptides are implicated, generate information regarding the identities of polypeptides with which the studied polypeptides interact and provide clues as to methods by which related genes and proteins are regulated.
Another technique for drug screening which may be used provides for high throughput screening of compounds having suitable binding affinity to the polypeptide of interest (see 3o International patent application W084/03564). In this method, large numbers of different small test compounds are synthesised on a solid substrate, which may then be reacted with the polypeptide of the invention and washed. One way of immobilising the polypeptide is to use non-neutralising antibodies. Bound polypeptide may then be detected using methods that are well known in the art. Purified polypeptide can also be coated directly onto plates for use in the aforementioned drug screening techniques.
The polypeptide of the invention may be used to identify membrane-bound or soluble receptors, through standard receptor binding techniques that are known in the art, such as ligand binding and crosslinking assays in which the polypeptide is labelled with a radioactive isotope, is chemically modified, or is fused to a peptide sequence that facilitates its detection or purification, and incubated with a source of the putative receptor (for example, a composition of cells, cell membranes, cell supernatants, tissue extracts, or 1 o bodily fluids). The efficacy of binding may be measured using biophysical techniques such as surface plasmon resonance (supplied by Biacore AB, Uppsala, Sweden) and spectroscopy. Binding assays may be used for the purification and cloning of the receptor, but may also identify agonists and antagonists of the polypeptide, that compete with the binding of the polypeptide to its receptor. Standard methods for conducting screening I5 assays are well understood in the ant.
The invention also includes a screening kit useful in the methods for identifying agonists, antagonists, ligands, receptors, substrates, enzymes, that are described above.
The invention includes the agonists, antagonists, ligands, receptors, substrates and enzymes, and other compounds which modulate the activity or antigenicity of the 2o polypeptide of the invention discovered by the methods that are described above.
The invention also provides pharmaceutical compositions comprising a polypeptide, nucleic acid, ligand or compound of the invention in combination with a suitable pharmaceutical carrier. These compositions may be suitable as therapeutic or diagnostic reagents, as vaccines, or as othex immunogenic compositions, as outlined in detail below.
25 According to the terminology used herein, a composition containing a polypeptide, nucleic acid, ligand or compound [X~ is "substantially free of impurities [herein, Y]
when at least 85% by weight of the total X+y in the composition is X. Preferably, X
comprises at least about 90% by weight ofthe total of X+y in the composition, more preferably at least about 95%, 98% or even 99% by weight.
3o The pharmaceutical compositions should preferably comprise a therapeutically effective amount of the polypeptide, nucleic acid molecule, ligand, or compound of the invention.
The term "therapeutically effective amount" as used herein refers to an amount of a therapeutic agent needed to treat, ameliorate, or prevent a targeted disease or condition, or to exhibit a detectable therapeutic or preventative effect. For any compound, the therapeutically effective dose can be estimated initially either in cell culture assays, for example, of neoplastic cells, or in animal models, usually mice, rabbits, dogs, or pigs. The animal model may also be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
The precise effective amount for a human subject will depend upon the severity of the to disease state, general health of the subject, age, weight, and gender of the subject, diet, time and frequency of administration, drug combination(s), reaction sensitivities, and tolerance/response to therapy. This amount can be determined by routine experimentation and is within the judgement of the clinician. Generally, an effective dose will be from 0.01 mg/kg to 50 mg/kg, preferably 0.05 mg/kg to 10 mg/kg. Compositions may be administered individually to a patient or may be administered in combination with other agents, drugs or hormones.
A pharmaceutical composition may also contain a pharmaceutically acceptable carrier, for administration of a therapeutic agent. Such carriers include antibodies and other polypeptides, genes and other therapeutic agents such as liposomes, provided that the 2o carrier does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity.
Suitable carriers may be large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles.
Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulphates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharnaceutically acceptable carriers is available in Remington's Pharnaceutical Sciences (Mack Pub. Co., N.J. 1991).
3o Pharnaceutically acceptable Garners in therapeutic compositions may additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for ingestion by the patient.
Once formulated, the compositions of the invention can be administered directly to the subject. The subjects to be treated can be animals; in particular, human subjects can be treated.
The pharmaceutical compositions utilised in this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, intraventricular, transdermal or transcutaneous 1 o applications (for example, see W098/20734), subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, intravaginal or rectal means. Gene guns or hyposprays may also be used to administer the pharmaceutical compositions of the invention.
Typically, the therapeutic compositions may be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared.
Direct delivery of the compositions will generally be accomplished by injection, subcutaneously, intraperitoneally, intravenously or intramuscularly, or delivered to the interstitial space of a tissue. The compositions can also be administered into a lesion.
Dosage treatment may be a single dose schedule or a multiple dose schedule.
2o If the activity of the polypeptide of the invention is in excess in a particular disease state, several approaches are available. One approach comprises administering to a subject an inhibitor compound (antagonist) as described above, along with a pharmaceutically acceptable carrier in an amount effective to inhibit the function of the polypeptide, such as by blocking the binding of ligands, substrates, enzymes, receptors, or by inhibiting a second signal, and thereby alleviating the abnormal condition. Preferably, such antagonists are antibodies. Most preferably, such antibodies are chimeric and/or humanised to minimise their immunogenicity, as described previously.
In another approach, soluble forms of the polypeptide that retain binding affinity for the ligand, substrate, enzyme, receptor, in question, may be administered.
Typically, the 3o polypeptide may be administered in the form of fragments that retain the relevant portions.
In an alternative approach, expression of the gene encoding the polypeptide can be inhibited using expression blocking techniques, such as the use of antisense nucleic acid molecules (as described above), either internally generated or separately administered.
Modifications of gene expression can be obtained by designing complementary sequences or antisense molecules (DNA, RNA, or PNA) to the control, 5' or regulatory regions 5 (signal sequence, promoters, enhancers and introns) of the gene encoding the polypeptide.
Similarly, inhibition can be achieved using "triple helix" base-pairing methodology. Triple helix pairing is useful because it causes inhibition of the ability of the double helix to open sufficiently for the binding of polymerases, transcription factors, or regulatory molecules.
Recent therapeutic advances using triplex DNA have been described in the literature (Gee, to J.E. et al., (1994) In: Huber, B.E. and B.I. Carr, Molecular and Immunologic Approaches, Futura Publishing Co., Mt. Kisco, NY). The complementary sequence or antisense molecule may also be designed to block translation of mRNA by preventing the transcript from binding to ribosomes. Such oligonucleotides may be administered or may be generated in situ from expression in vivo.
15 In addition, expression of the polypeptide of the invention may be prevented by using ribozymes specific to its encoding mRNA sequence. Ribozymes are catalytically active RNAs that can be natural or synthetic (see for example Usman, N, et al., Curr.
Opin.
Struct. Biol (1996) 6(4), 527-33). Synthetic ribozymes can be designed to specifically cleave mRNAs at selected positions thereby preventing translation of the mRNAs into 2o functional polypeptide. Ribozymes may be synthesised with a natural ribose phosphate backbone and natural bases, as normally found in RNA molecules. Alternatively the ribozymes may be synthesised with non-natural backbones, for example, 2'-O-methyl RNA, to provide protection from ribonuclease degradation and may contain modified bases.
25 RNA molecules may be modified to increase intracellular stability and half life. Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends of the molecule or the use of phosphorothioate or 2' O-methyl rather than phosphodiesterase linkages within the backbone of the molecule. This concept is inherent in the production of PNAs and can be extended in all of these molecules by the inclusion 30 of non-traditional bases such as inosine, queosine and butosine, as well as acetyl-, methyl-, thio- and similarly modified forms of adenine, cytidine, guanine, thymine and uridine which are not as easily recognised by endogenous endonucleases.
For treating abnormal conditions related to an under-expression of the polypeptide of the invention and its activity, several approaches are also available. One approach comprises administering to a subject a therapeutically effective amount of a compound that activates the polypeptide, i.e., an agonist as described above, to alleviate the abnormal condition.
s Alternatively, a therapeutic amount of the polypeptide in combination with a suitable pharmaceutical carrier may be administered to restore the relevant physiological balance of polypeptide.
Gene therapy may be employed to effect the endogenous production of the polypeptide by the relevant cells in the subject. Gene therapy is used to treat permanently the inappropriate to production of the polypeptide by replacing a defective gene with a corrected therapeutic gene.
Gene therapy of the present invention can occur iya vivo or ex vivo. Ex vivo gene therapy requires the isolation and purification of patient cells, the introduction of a therapeutic gene and introduction of the genetically altered cells back into the patient.
In contrast, ih 15 vivo gene therapy does not require isolation and purification of a patient's cells.
The therapeutic gene is typically "packaged" for administration to a patient.
Gene delivery vehicles may be non-viral, such as liposomes, or replication-deficient viruses, such as adenovirus as described by Berkner, K.L., in Curr. Top. Microbiol. Immunol., 15~, 39-66 (1992) or adeno-associated virus (AAV) vectors as described by Muzyczka, N., in Curr.
2o Top. Microbiol. Immunol., 158, 97-129 (1992) and U.S. Patent No. 5,252,479.
For example, a nucleic acid molecule encoding a polypeptide of the invention may be engineered for expression in a replication-defective retroviral vector. This expression construct may then be isolated and introduced into a packaging cell transduced with a retroviral plasmid vector containing RNA encoding the polypeptide, such that the 25 packaging cell now produces infectious viral particles containing the gene of interest.
These producer cells may be administered to a subject for engineering cells in vivo and expression of the polypeptide ijz vivo (see Chapter 20, Gene Therapy and other Molecular Genetic-based Therapeutic Approaches, (and references cited therein) in Human Molecular Genetics (1996), T Strachan and A P Read, BIOS Scientific Publishers Ltd).
3o Another approach is the administration of "naked DNA" in which the therapeutic gene is directly injected into the bloodstream or muscle tissue.
In situations in which the polypeptides or nucleic acid molecules of the invention are disease causing agents, the invention provides that they can be used in vaccines to raise antibodies against the disease-causing agent.
Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat disease after infection). Such vaccines comprise immunising antigen(s), irmmnogen(s), polypeptide(s), proteins) or nucleic acid, usually in combination with pharmaceutically-acceptable carriers as described above, which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Additionally, these carriers may function as immunostimulating agents ("adjuvants"). Furthermore, the antigen or immunogen may be conjugated to a 1 o bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H.
pylori, and other pathogens.
Since polypeptides may be broken down in the stomach, vaccines comprising polypeptides are preferably administered parenterally (for instance, subcutaneous, intramuscular, intravenous, or intradermal injection). Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the recipient, and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents.
The vaccine formulations of the invention may be presented in unit-dose or multi-dose 2o containers. For example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use.
The dosage will depend on the specific activity of the vaccine and can be readily determined by routine experimentation.
Genetic delivery of antibodies that bind to polypeptides according to the invention may also be effected, for example, as described in International paten application W098/55607.
The technology referred to as jet injection (see, for example, www.powderject.com) may also be useful in the formulation of vaccine compositions.
A number of suitable methods for vaccination and vaccine delivery systems are described in International patent application WO00/29428.
3o This invention also relates to the use of nucleic acid molecules according to the present invention as diagnostic reagents. Detection of a mutated form of the gene characterised by the nucleic acid molecules of the invention which is associated with a dysfunction will provide a diagnostic tool that can add to, or define, a diagnosis of a disease, or susceptibility to a disease, which results from under-expression, over-expression or altered spatial or temporal expression of the gene. Individuals carrying mutations in the gene may be detected at the DNA level by a variety of techniques.
Nucleic acid molecules for diagnosis may be obtained from a subject's cells, such as from blood, urine, saliva, tissue biopsy or autopsy material. The genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR, ligase chain reaction (LCR), strand displacement amplification (SDA), or other amplification to techniques (see Saiki et al., Nature, 324, 163-166 (1986); Bej, et al., Crit. Rev. Biochem.
Molec. Biol., 26, 301-334 (1991); Birkenmeyer et al., J. Virol. Meth., 35, 117-126 (1991);
Van Brunt, J., Bio/Technology, 8, 291-294 (1990)) prior to analysis.
In one embodiment, this aspect of the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide according to the invention and comparing said level of expression to a control level, wherein a level that is different to said control level is indicative of disease. The method may comprise the steps of:
a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid 2o molecule of the invention and the probe;
b) contacting a control sample with said probe under the same conditions used in step a);
c) and detecting the presence of hybrid complexes in said samples;
wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease.
A further aspect of the invention comprises a diagnostic method comprising the steps of:
a) obtaining a tissue sample from a patient being tested for disease;
b) isolating a nucleic acid molecule according to the invention from said tissue sample; and c) diagnosing the patient for disease by detecting the presence of a mutation in the nucleic acid molecule which is associated with disease.
3o To aid the detection of nucleic acid molecules in the above-described methods, an amplification step, for example using PCR, may be included.
Deletions and insertions can be detected by a change in the size of the amplified product in comparison to the normal genotype. Point mutations can be identified by hybridizing amplified DNA to labelled RNA of the invention or alternatively, labelled antisense DNA
sequences of the invention. Perfectly-matched sequences can be distinguished from mismatched duplexes by RNase digestion or by assessing differences in melting temperatures. The presence or absence of the mutation in the patient may be detected by contacting DNA with a nucleic acid probe that hybridises to the DNA under stringent conditions to form a hybrid double-stranded molecule, the hybrid double-stranded l0 molecule having an unhybridised portion of the nucleic acid probe strand at any portion corresponding to a mutation associated with disease; and detecting the presence or absence of an unhybridised portion of the probe strand as an indication of the presence or absence of a disease-associated mutation in the corresponding portion of the DNA
strand.
Such diagnostics are particularly useful for prenatal and even neonatal testing.
Point mutations and other sequence differences between the reference gene and "mutant"
genes can be identified by other well-known techniques, such as direct DNA
sequencing or single-strand conformational polymorphisriz, (see Orita et al., Genomics, 5, (1989)). For example, a sequencing primer may be used with double-stranded PCR
product or a single-stranded template molecule generated by a modified PCR. The sequence determination is performed by conventional procedures with radiolabelled nucleotides or by automatic sequencing procedures with fluorescent-tags. Cloned DNA segments may also be used as probes to detect specific DNA segments. The sensitivity of this method is greatly enhanced when combined with PCR. Further, point mutations and other sequence variations, such as polymorphisms, can be detected as described above, for example, through the use of allele-specific oligonucleotides for PCR amplification of sequences that differ by single nucleotides.
DNA sequence differences may also be detected by alterations in the electrophoretic mobility of DNA fragments in gels, with or without denaturing agents, or by direct DNA
sequencing (for example, Myers et al., Science (1985) 230:1242). Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and Sl protection or the chemical cleavage method (see Cotton et al., Proc. Natl.
Acad. Sci.
USA (1985) 85: 4397-4401).
In addition to conventional gel electrophoresis and DNA sequencing, mutations such as microdeletions, aneuploidies, translocations, inversions, can also be detected by in situ analysis (see, for example, I~eller et al., DNA Probes, 2nd Ed., Stockton Press, New York, N.Y., USA (1993)), that is, DNA or RNA sequences in cells can be analysed for mutations 5 without need for their isolation and/or immobilisation onto a membrane.
Fluorescence ih situ hybridization (FISH) is presently the most commonly applied method and numerous reviews of FISH have appeared (see, for example, Trachuck et al., Science, 250, 559-562 (1990), and Trask et al., Trends, Genet., 7, 149-154 (1991)).
In another embodiment of the invention, an array of oligonucleotide probes comprising a 1 o nucleic acid molecule according to the invention can be constructed to conduct efficient screening of genetic variants, mutations and polymorphisms. Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see for example: M.Chee et al., Science (1996), Vol 274, pp 610-613).
15 In one embodiment, the array is prepared and used according to the methods described in PCT application W095/11995 (Chee et al.); Lockhart, D. J. et al., (1996) Nat.
Biotech. 14:
1675-1680; and Schena, M. et al., (1996) Proc. Natl. Acad. Sci. 93:10614-10619).
Oligonucleotide pairs may range from two to over one million. The oligomers are synthesized at designated areas on a substrate using a light-directed chemical process. The 2o substrate may be paper, nylon or other type of membrane, filter, chip, glass slide or any other suitable solid support. In another aspect, an oligonucleotide may be synthesized on the surface of the substrate by using a chemical coupling procedure and an ink jet application apparatus, as described in PCT application W095/25116 (Baldeschweiler et al.). In another aspect, a "gridded" array analogous to a dot (or slot) blot may be used to 25 arrange and link cDNA fragments or oligonucleotides to the surface of a substrate using a vacuum system, thermal, UV, mechanical or chemical bonding procedures. An array, such as those described above, may be produced by hand or by using available devices (slot blot or dot blot apparatus), materials (any suitable solid support), and machines (including robotic instruments), and may contain 8, 24, 96, 384, 1536 or 6144 oligonucleotides, or 3o any other number between two and over one million which lends itself to the efficient use of commercially-available instrumentation.
In addition to the methods discussed above, diseases may be diagnosed by methods comprising determining, from a sample derived from a subject, an abnormally decreased or increased level of polypeptide or mRNA. Decreased or increased expression can be measured at the RNA level using any of the methods well known in the art for the quantitation of polynucleotides, such as, for example, nucleic acid amplification, for instance PCR, RT-PCR, RNase protection, Northern blotting and other hybridization methods.
Assay techniques that can be used to determine levels of a polypeptide of the present invention in a sample derived from a host are well-known to those of skill in the art and are discussed in some detail above (including radioimmunoassays, competitive-binding assays, to Western Blot analysis and ELISA assays). This aspect of the invention provides a diagnostic method which comprises the steps of: (a) contacting a ligand as described above with a biological sample under conditions suitable for the formation of a ligand-polypeptide complex; and (b) detecting said complex.
Protocols such as ELISA (as previously described), RIA, and FACS for measuring polypeptide levels may additionally provide a basis for diagnosing altered or abnormal levels of polypeptide expression. Normal or standard values for polypeptide expression are established by combining body fluids or cell extracts taken from normal mammalian subjects, preferably humans, with antibody to the polypeptide under conditions suitable for complex formation. The amount of standard complex formation may be quantified by 2o various methods, such as by photometric means.
Antibodies which specifically bind to a polypeptide of the invention may be used for the diagnosis of conditions or diseases characterised by expression of the polypeptide, or in assays to monitor patients being treated with the polypeptides, nucleic acid molecules, ligands and other compounds of the invention. Antibodies useful for diagnostic purposes may be prepared in the same manner as those described above for therapeutics.
Diagnostic assays for the polypeptide include methods that utilise the antibody and a label to detect the polypeptide in human body fluids or extracts of cells or tissues. The antibodies may be used with or without modification, and may be labelled by joining them, either covalently or non-covalently, with a reporter molecule. A wide variety of reporter molecules known 3o in the art may be used, several of which are described above.
Quantities of polypeptide expressed in subject, control and disease samples from biopsied tissues are compared with the standard values. Deviation between standard and subject values establishes the parameters for diagnosing disease. Diagnostic assays may be used to distinguish between absence, presence, and excess expression of polypeptide and to monitor regulation of polypeptide levels during therapeutic intervention. Such assays may also be used to evaluate the efficacy of a particular therapeutic treatment regimen in animal studies, in clinical trials or in monitoring the treatment of an individual patient.
A diagnostic kit of the present invention may comprise:
(a) a nucleic acid molecule of the present invention;
(b) a polypeptide of the present invention; or (c) a ligand of the present invention.
to In one aspect of the invention, a diagnostic kit may comprise a first container containing a nucleic acid probe that hybridises under stringent conditions with a nucleic acid molecule according to the invention; a second container containing primers useful for amplifying the nucleic acid molecule; and instructions for using the probe and primers for facilitating the diagnosis of disease. The kit may further comprise a third container holding an agent for digesting unhybridised RNA.
In an alternative aspect of the invention, a diagnostic kit may comprise an array of nucleic acid molecules, at least one of which may be a nucleic acid molecule according to the invention.
To detect polypeptide according to the invention, a diagnostic kit may comprise one or 2o more antibodies that bind to a polypeptide according to the invention; and a reagent useful for the detection of a binding reaction between the antibody and the polypeptide.
Such kits will be of use in diagnosing a disease or susceptibility to disease, such as cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours; myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma; autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection; cardiovascular disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia;
neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C 1 q family proteins.
Various aspects and embodiments of the present invention will now be described in more detail by way of example, with particular reference to the INSP058 polypeptide.
It will be appreciated that modification of detail may be made without departing from the scope of the invention.
Brief description of the Figures l0 Figure 1: Top ten results from BLAST against the NCBI non-redundant database using SEQ
ID N0:8 (INSP058 polypeptide sequence).
Figure 2: Alignment generated by BLAST between SEQ ID N0:8 (INSP058 polypeptide sequence) and the closest related sequence, otolin-1 from Onco~hyhchus keta..
Figure 3: Top 20 results from Genome Threader using SEQ ID NO:B (INSP058 polypeptide sequence). The PDB codes for the top three results refer to the following protein structures: 1 c28 chains A, C and B. The crystal structure of a complement-1 q family protein suggests an evolutionary link to tumor necrosis factor.
Figure 4: Structural alignment generated by Genome Threader between SEQ ID
N0:8 (INSP058 polypeptide sequence) and the top PDB structure in Figure 3 (1c28).
2o Figure SA: SignaIP-NN prediction of the signal peptide present in the polypeptide sequence (SEQ ID N0:8).
Figure SB: SignalP-HMM prediction of the signal peptide present in the INSP058 polypeptide sequence (SEQ ID N0:8).
Figure 6: Predicted nucleotide sequence of INSP058 with translation.
Figure 7: Nucleotide sequence with translation of PCR product cloned using primers INSP058-CPland INSP058-CP2.
Figure 8: Map of pCRII-TOPO-INSP058SV.
Figure 9: Alignment of cloned nucleotide sequence of INSP058 (INSP058SV) with predicted INSP058 sequence.
Figure 10: Alignment of INSP058 predicted amino acid sequence with amino acid sequence of cloned INSP058SV.
Figure 11: Map of expression vector pEAKl2d Figure 12: Map of Gateway vector pDONR20I
Figure 13: Map ofpEAKl2d-INSPOSBSV-6HIS
EXAMPLES
Example l: INSP058 SEQ ID N0:8 was used as a BLAST query against the NCBI non-xedundant Sequence to database. The closest match to the query sequence is for otolin-1 from OncorlZynchus keta (Figure 1). Figure 2 shows the alignment of the INSP058 query sequence to the sequence of otolin-1 from Oucorynchus keta. Figure 3 shows the top 20 results from Genome Threader using SEQ ID N0:8 (INSP058 polypeptide sequence). The PDB codes for the top three results refex to the following protein structuxes: 1c28 chains A, C and B. The crystal structure of a complement-1 q family protein suggests an evolutionary link to tumor necrosis factor. Figure 4 shows the structural alignment generated by Genome Threader between SEQ ID N0:8 (INSP058 polypeptide sequence) and the top PDB structure in Figure 3 (1c28).
The 1NSPOSB polypeptide sequence (SEQ ID N0:8) was subjected to analysis using SignalP
2o v2.0 (as described on the www.cbs.dtu.dk/services/SignaIP-2.0 website), a program that predicts the presence and location of signal peptide cleavage sites in amino acid sequences from different organisms. SignaIP v2.0 comprises two signal peptide prediction methods, SignaIP-NN (based on neural networks) and SignalP-HMM (based on hidden Markov models). The SignaIP results for INSP058 polypeptide sequence (SEQ ID N0:8) are shown as Figures SA and SB. Figure SA and SB show that the most likely cleavage site for INSP058 polypeptide sequence (SEQ ID N0:8) falls between positions 15 and 16.
Example 2:INSP058 splice variant 1.1 cDNA libraries Human cDNA libraries (in bacteriophage lambda (~,) vectors) were purchased from Stratagene or Clontech or prepared at the Serono Pharmaceutical Research Institute in ~, 5 ZAP or ~. GT10 vectors according to the manufacturer's protocol (Stratagene).
Bacteriophage ~, DNA was prepared from small scale cultures of infected E.coli host strain using the Wizard Lambda Preps DNA purification system according to the manufacturer's instructions (Promega, Corporation, Madison WL) The list of libraries and host strains used is shown in Table 1. Seven pools representing 26 different libraries (100 ng/~l phage to DNA) or phage DNA from individual libraries were used in subsequent PCR
reactions.
Library Tissue/cell source Vector Host strainSupplierCat.
no.
human substantia nigra GT10 LE392 in house human fetal brain GT10 LE392 in house human cortex brain GT10 LE392 in house human colon GT10 LE392 ClontechHL1034a human fetal lung GT10 LE392 ClontechHL1072a ~2 human fetal kidney GT10 LE392 ClontechHL1071a 14 human bone marrow GT10 LE392 ClontechHL1058a human U373 cell line GT10 LE392 in house human CFPoc-1 cell line Uni Zap XL1-Blue Stratagene936206 MRF' 2o human retina GT10 LE392 ClontechHL1132a 21 human urinary bladder GT10 LE392 in house 22 human platelets Uni Zap XL1-Blue in house MRF' 23 human neuroblastoma ICanGT10 LE392 in house + TS
24 human bronchial smooth GT10 LE392 in house muscle 25 human bronchial smooth GT10 LE392 in house muscle 26 human Thymus GT10 LE392 ClontechHL1127a 27 human spleen 5' stretch GT11 LE392 ClontechHL1134b 2$ human peripheral blood GT10 LE392 ClontechHL1050a monocytes 29 human tesfis GT10 LE392 ClontechHL1065a 3o human fetal brain GT10 LE392 ClontechHL1065a 3~ human substantia nigra GT10 LE392 ClontechHL1093a 32 human placenta#11 GT11 LE392 ClontechHL1075b 33 human Fetal brain GT10 LE392 Clontechcustom 34 human placenta #59 GT10 LE392 ClontechHL5014a 35 human pituitary GT10 LE392 ClontechHL1097a 36 human pancreas #63 Uni Zap XL1-Blue Stratagene937208 XR MRF' Table 1 Hufnafz cDNA libraries 1. 2 PCR of virtual cDNAs frofn phage libraf y DNA
Gene-specific PCR amplification primers (INSP058-CPl and INSP058-CP2, Figure 6 and Table 2) were designed to amplify a 990 by product expected to contain almost the full predicted coding sequence of INSP058. These were used in PCR on the phage eDNA
library pools shown in Table 1. The PCR was performed in a final volume of 50 ~.1 containing 1X AmpliTaqTM buffer, 200 ~,M dNTPs, 50 pmoles each of cloning primers, 2.5 units of AmpliTaq~M (Perkin Elmer) and 100 ng of each phage library pool DNA
using an MJ Research DNA Engine, programmed as follows: 40 cycles at 94 °C for 1 min and 72 °C for 1 min; followed by 1 cycle at 72 °C for 7 min and a holding cycle at 4 °C.
Primer Sequence (5'-3') GCP Forward G
GGG
ACA
AGT
TTG
TAC
AAA
AAA
GCA
GGC
TTC
_GCC
ACC
GCP Reverse GGGGAC CACTTTGTA CAAGAA AGC TGG GTT TCA
GTGATG GTGATGGTG ATG
CTTGCC ATT CTG
CCTGAA CA ACA
pEAKl2-F GCCAGC TTGGCACTT GATGT
pEAKl2-R GATGGA GGTGGACGT GTCAG
Sp6 ATTTAG GTGACACTA TAG
TAC
Table 2 lN~f USc~ cloning and sequencing prirnef-s unaernnea sequence - riUGaX
~GHuG114G, Bold = Stop codon and Italic sequence= HIS tag The amplification products were visualized on 0.8 % agarose gels in 1 X TAE
buffer (Invitrogen) and were purified from the gel using the Wizard PCR Preps DNA
Purification System (Promega). PCR products eluted in 50 ~l of sterile water were either subcloned directly or stored at 20 C.
1.3 Gene specific cloning primers fog PCR
A pair of PCR primers having a length of between 18 and 25 bases were designed for amplifying a partial sequence of TNSP058 cDNA using Primer Designer Software (Scientific ~ Educational Software, PO Box 72045, Durham, NC 27722-2045, USA).
PCR
primers were optimized to have a Tm close to 55 + 10 °C and a GC
content of 40-60%.
2o Primers were selected which had high selectivity for the target sequence INSP058 (little or no none specific priming). INSP058-CP1 lacks the first 8 by of the INSP058 predicted coding sequence due to optimization of the PCR primer design.
1.4 Subcloning ofPCR Py~oducts PCR products were subcloned into the topoisomerase I modified cloning vector (pCRII
TOPO) using the TA cloning kit purchased from the Invitrogen Corporation using the conditions specified by the manufacturer. Briefly, 4 ~l of gel purified PCR
product from the human library pool P amplification was incubated for 15 min at room temperature with 1 ~l of TOPO vector and 1 ~.~1 salt solution. The reaction mixture was then transformed into E. coli strain TOP10 (Invitrogen) as follows: a 50 p,l aliquot of One Shot TOPIO cells was thawed on ice and 2 ~,l of TOPO reaction was added. The mixture was incubated for 15 min on ice and then heat shocked by incubation at 42 °C for exactly 30 s. Samples were to returned to ice and 250 ~,1 of warm SOC media (room temperature) was added.
Samples were incubated with shaking (220 rpm) for 1 h at 37 °C. The transformation mixture was then plated on L-broth (LB) plates containing ampicillin (100 ~.g/ml) and incubated overnight at 37 °C.
1.5 Selection of an~plicillih resistant colonies A number of ampicillin resistant colonies were selected and the cells stabbed into individual wells of a 96 well plate each containing L-broth containing ampicillin (100 pg/ml).
1. 6 Plasrnid DNA preparation and Sequev~cing Miniprep plasmid DNA was prepared from the stab culture's and subjected to DNA
2o sequencing with T7 primer at GATC Biotech AG (Jakob-Stadler-Platz 7, D-Konstanz). The sequence of the cloned cDNA fragment is shown in figure 7.
2. Idefztificatiou of cDNA librar~iesltenzplates co~ctai~cirzg INSPOS8Sv PCR products obtained with INSP058-CPl and INSP058-CP2 and migrating at 453 bp, a smaller size than expected, were identified in ~, cDNA library Pool P (human thymus, spleen, peripherial blood monocytes, and testis). The plasmid map of the cloned PCR
product (pCRII-TOPO-INSP058) (plasmid ID number 12917) is shown in Figure 8.
The cloned sequence lacks the first 8 by of the INSP058 predicted coding sequence but is otherwise identical to the predicted INSP058 sequence up to nucleotide position 267 where it diverges from the prediction due to a 538 by deletion (Figure 9).
Translation of the longest ORF (including the 8 by missing at the 5' end) yields a protein of 99 amino acids of which amino acids 1-89 are identical to the INSP058 prediction (Figure 11).
The cloned sequence therefore corresponds to a short splice variant of INSP058 (called INSP058SV).
3. Cofzstructiou ofplasryzids for expression of INSP058SV ih HEK293/EBNA
cells.
A pCRII-TOPO clone containing the coding sequence (ORF) of INSP058SV
identified by DNA sequencing (Figure 7) was then used to subclone the insert into the mammalian cell expression vector pEAKl2d (figure 11) using the GatewayTM cloning methodology (Invitrogen).
3.1 Gene~atiofz of Gateway compatible INSP058SV ORF fused to afz i~ frame 6HIS
tag sequence to The first stage of the Gateway cloning process involves a two step PCR
reaction which generates the ORF of INSP058SV flanked at the 5' end by an attBl recombination site and Kozak sequence, and flanked at the 3' end by a sequence encoding an in frame 6 histidine (6HIS) tag, a stop codon and the attB2 recombination site (Gateway compatible cDNA).
The first PCR reaction (in a final volume of 50 ~,l) contains: 1.5 ~,1 (approx. 25 ng) of pCR
II TOPO-INSP058SV (plasmid 12917 and Figure 8), 1.5 ~l dNTPs (10 mM), 5~1 of lOX
Pfx polymerase buffer, 1 ~l MgS04 (50 mM), 0.5 ~l each of gene specific primer (100 ~,M) (INSP058-EXl forward and INSP058-EX2 reverse) and 0.5 ~,l Platinum Pfx DNA
polymerase (Invitrogen). The PCR reaction was performed using an initial denaturing step of 95°C for 1 min, followed by 10 cycles of 94 °C for 15 s; 55 °C for 30 s and 68°C for 2 2o min; and a holding cycle of 4 °C. PCR products were purified directly from the reaction mixture using the Wizard PCR prep DNA purification system (Promega) according to the manufacturer's instructions. The second PCR reaction (in a final volume of 50 ~.l) contained 10 ~.l purified PCR product, 1.5 ~,l dNTPs (10 mM), 5 ~,l of lOX Pfx polymerase buffer, 1 ~,l MgS04 (50 mM), 0.5 yl of each Gateway conversion primer (100 ~.M) (GCP
forward and GCP reverse) and 0.5 ~,l of Platinum Pfx DNA polymerase. The conditions for the 2nd PCR reaction were: 95 °C for 1 min; 4 cycles of 94 °C, 15 sec; 50 °C, 30 sec and 68 °C for 2 min; 25 cycles of 94 °C, 15 sec; 55 °C , 30 sec and 68 °C, 2 min; followed by a holding cycle of 4 °C. PCR products were purified as described above.
3.2 Subclofzihg of Gateway compatible INSP058ST1 ORF into Gateway erztyy vector 3o pDONR201 and expression vector pEAI~l2d The second stage of the Gateway cloning process involves subcloning of the Gateway modified PCR product into the Gateway entry vector pDONR20I (Invitrogen, figure I2) as follows: 5 pl of purified PCR product is incubated with 1.5 ~l pDONR201 vector (0.1 q,g/~.1), 2 ~1 BP buffer and 1.5 ~l of BP clonase enzyme mix (Invitrogen) at RT for 1 h.
The reaction was stopped by addition of proteinase K (2 p,g) and incubated at 37°C for a further 10 min. An aliquot of this reaction (2 ~.1) was transformed into E.
coli DH10B
cells by electroporation using a Biorad Gene Pulser. Transformants were plated on LB-kanamycin plates. Plasmid mini-prep DNA was prepared from 1-4 of the resultant colonies using Wizard Plus SV Minipreps kit (Promega), and 1.5 p.l of the plasmid eluate to was then used in a recombination reaction containing 1.5 ~,l pEAKl2d vector (figure 9) (0.1 ~g / ~,I), 2 ~.1 LR buffer and 1.5 ~.l of LR clonase (Invitrogen) in a final volume of 10 p.l. The mixture was incubated at RT for 1 h, stopped by addition of proteinase K (2 fig) and incubated at 37°C for a further 10 min. An aliquot of this reaction (1 ~.1) was used to transform E. coli DHlOB cells by electroporation.
Clones containing the correct insert were identified by performing colony PCR
as described above except that pEAKl2d primers (pEAKl2d F and pEAKl2d R) were used for the PCR. Plasmid mini prep DNA was isolated from clones containing the correct insert using a Qiaprep Turbo 9600 robotic system (Qiagen) or manually using a Wizard Plus SV minipreps kit (Promega) and sequence verified using the pEAKl2d F and 2o pEAKl2d R primers.
CsC1 gradient purified maxi-prep DNA of plasmid pEAKl2d-INSP058SV-6HIS
(plasmid ID number 13081, Figure 13) was prepared from a 500 ml culture of sequence verified clones (Sambrook J. et al., in Molecular Cloning, a Laboratory Manual, 2nd edition, 1989, Cold Spring Harbor Laboratory Press), resuspended at a concentration of 1 ~,g/~,l in sterile water and stored at -20 C.
In addition, further experiments may now be performed using the pEAKl2d-6HIS expression vector. Transfection of mammalian cell lines with this vector may enable the high level expression of the INSP058SV protein and thus enable the continued investigation of the functional characteristics of the INSP058SV polypeptides.
The 3o following material and methods are an example of those suitable in such experiments:
Cell Culture Human Embryonic Kidney 293 cells expressing the Epstein-Barr virus Nuclear Antigen (HEK293-EBNA, Invitrogen) are maintained in suspension in Ex-cell VPRO serum-free medium (seed stock, maintenance medium, JRH). Sixteen to 20 hours prior to transfection (Day-1), cells are seeded in 2x T225 flasks (50 ml per flask in DMEM / F12 (l:l) 5 containing 2% FBS seeding medium (JRH) at a density of 2x105 cells/ ml). The next day (transfection day 0) transfection takes place using the JetPEITM reagent (2p1/~g of plasmid DNA, PolyPlus-transfection). For each flask, plasmid DNA is co-transfected with GFP
(fluorescent reporter gene) DNA. The transfection mix is then added to the 2xT225 flasks and incubated at 37°C (5%C02) for 6 days. Confirmation of positive transfection may be to carried out by qualitative fluorescence examination at day 1 and day 6 (Axiovert 10 Zeiss).
On day 6 (harvest day), supernatants from the two flasks are pooled and centrifuged (e.g.
4°C, 400g) and placed into a pot bearing a unique identifier. One aliquot (500 pl) is kept for QC of the 6His-tagged protein (internal bioprocessing QC).
Scale-up batches may be produced by following the protocol called "PEI
transfection of 15 suspension cells", referenced BP/PEI/HH/02/04, with PolyEthyleneImine from Polysciences as transfection agent.
Purification process The culture medium sample containing the recombinant protein with a C-terminal 6His tag is diluted with cold buffer A (50 mM NaH2P04; 600 mM NaCl; 8.7 % (wlv) glycerol, pH
20 7.5). The sample is filtered then through a sterile filter (Millipore) and kept at 4°C in a sterile square media bottle (Nalgene).
The purification is performed at 4°C on the VISION workstation (Applied Biosystems) connected to an automatic sample loader (Labomatic). The purification procedure is composed of two sequential steps, metal affinity chromatography on a Poros 20 MC
25 (Applied Biosystems) column charged with Ni ions (4.6 x 50 mm, 0.83 ml), followed by gel filtration on a Sephadex G-25 medium (Amersham Pharmacia) column (1,0 x 10 cm).
For the first chromatography step the metal affinity column is regenerated with 30 column volumes of EDTA solution (100 mM EDTA; 1 M NaCI; pH 8.0), recharged with Ni ions through washing with 15 column volumes of a 100 mM NiS04 solution, washed with 3o column volumes of buffer A, followed by 7 column volumes of buffer B (50 mM
NaH2P04; 600 mM NaCl; 8.7 % (w/v) glycerol, 400 mM; imidazole, pH 7.5), and finally equilibrated with 15 column volumes of buffer A containing 15 mM imidazole.
The sample is transferred, by the Labomatic sample loader, into a 200 ml sample loop and subsequently charged onto the Ni metal affinity column at a flow rate of 10 ml/min. The column is washed with 12 column volumes of buffer A, followed by 28 column volumes of buffer A containing 20 mM imidazole. During the 20 mM imidazole wash loosely attached contaminating proteins are eluted from the column. The recombinant His-tagged protein is finally eluted with 10 column volumes of buffer B at a flow rate of 2 ml/min, and the eluted protein is collected.
For the second chromatography step, the Sephadex G-25 gel-filtration column is 1o regenerated with 2 ml of buffer D (1.137 M NaCI; 2.7 mM KCI; 1.5 mM KH2P04;
8 mM
NaZHP04; pH 7.2), and subsequently equilibrated with 4 column volumes of buffer C (137 mM NaCI; 2.7 mM KCI; 1.5 mM KH2P04; 8 mM Na2HP04; 20 % (w/v) glycerol; pH
7.4).
The peak fraction eluted from the Ni-column is automatically loaded onto the Sephadex G-25 column through the integrated sample loader on the VISION and the protein is eluted with buffer C at a flow rate of 2 ml/min. The fraction was filtered through a sterile centrifugation filter (Millipore), frozen and stored at -80°C. An aliquot of the sample is analyzed on SDS-PAGE (4-12% NuPAGE gel; Novex) Western blot with anti-His antibodies. The NuPAGE gel may be stained in a 0.1 % coomassie blue 8250 staining solution (30 % methanol, 10 % acetic acid) at room temperature for 1 h and subsequently 2o destained in 20 % methanol, 7.5 % acetic acid until the background is clear and the protein bands clearly visible.
Following the electrophoresis the proteins are electrotransferred from the gel to a nitrocellulose membrane. The membrane is blocked with 5 % milk powder in buffer E
(137 mM NaCI; 2.7 mM KCI; 1.5 mM KHZPO4; 8 mM Na2HP04; 0.1 % Tween 20, pH
7.4) for 1 h at room temperature, and subsequently incubated with a mixture of 2 rabbit polyclonal anti-His antibodies (G-18 and H-15, 0.2ug/ml each; Santa Cruz) in 2.5 % milk powder in buffer E overnight at 4°C. After a further 1 hour incubation at room temperature, the membrane is washed with buffer E (3 x 10 min), and then incubated with a secondary HRP-conjugated anti-rabbit antibody (DAKO, HRP 0399) diluted 1/3000 in 3o buffer E containing 2.5 % milk powder for 2 hours at room temperature.
After washing with buffer E (3 x 10 minutes), the membrane is developed with the ECL kit (Amersham Pharmacia) for 1 min. The membrane is subsequently exposed to a Hyperfilm (Amersham Pharmacia), the film developed and the western blot image visually analysed.
For samples that showed detectable protein bands by Coomassie staining, the protein concentration may be determined using the BCA protein assay kit (Pierce) with bovine serum albumin as standard.
Furthermore, overexpression or knock-down of the expression of INSP058SV
polypeptides in cell lines may be used to determine the effect on transcriptional activation of the host cell genome. Dimerisation partners, co-activators and co-repressors of the INSP058SV polypeptides may be identified by immunoprecipitation combined with Western blotting and immunoprecipitation combined with mass spectroscopy.
SEQUENCE LISTING:
SEQ ID NO: 1 (INSP058 nucleotide sequence exon 1) IO
SEQ ID N0: 2 (INSP058 protein sequence exon 1) SEQ ID NO: 3 (INSP058 nucleotide sequence exon 2) SEQ ID NO: 4 (INSP058 protein sequence exon 2) 1 EPGRPGSPGK DGTSGEF<GER G
SEQ ID NO:
5 (INSP058 nucleotide sequence exon 3) SEQ ID N0: 6 (INSP058 protein sequence exon 3) SEQ ID N0: nucleotidesequence) 7 (INSP058 full SEQ ID N0: 8 (1NSP058 full protein sequence) SEQ ID NO: 9 (INSP058SV full nucleotide sequence) ATGAGGATCTGGTGGCTTCTGCTTGCCATTGAAATCTGCACAGGGAACATAAACTCACAGGACACCTGCAGGC
AAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGCCTGGAAGAGATGGACGAGACGGAGCGAA
GGGTGACAAAGGCGATGCAGGAGAACCAGGATGTCCTGGCAGCCCGGGGAAGGATGGGACGAGTGGAGAGAAG
GGAGAACGAGGAGCAGATGGAAAAGTTGAAGCAAAAGGCATCAAAGGAATGTTCAGGTGTCTTTGGTCAAAAA
CGGAGTAA
SEQ ID N0: 10 (INSP058SV full protein sequence) GERGADGKVEAKGIKGMFRCLWSKTE
SEQ ID N0: 11 (mature INSP058 and INSP058SV nucleotide sequence exon 1) AACATAAACTCACAGGACACCTGCAGGCAAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGC
CTGGAAGAGATGGACGAGACGGAGCGAAGGGTGACAAAGGCGATGCAG
SEQ ID N0: 12 (mature INSP058 and INSP058SV protein sequence exon 1) NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAG
SEQ ID N0: 13 (mature INSP058 nucleotide sequence) AACATAAACTCACAGGACACCTGCAGGCAAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGC
CTGGAAGAGATGGACGAGACGGAGCGAAGGGTGACAAAGGCGATGCAGGAGAACCAGGACGTCCTGGCAGCCC
GGGGAAGGATGGGACGAGTGGAGAGAAGGGAGAACGAGGAGCAGATGGAAAAGTTGAAGCAAAAGGCATCAAA
GGTGATCAAGGCTCAAGAGGATCCCCAGGAAAACATGGCCCCAAGGGGCTTGCAGGGCCCATGGGAGAGAAGG
GCCTCCGAGGAGAGACTGGGCCTCAGGGGCAGAAGGGGAATAAGGGTGACGTGGGTCCCACTGGTCCTGAGGG
GCCAAGGGGCAACATTGGGCCTTTGGGCCCAACTGGTTTACCGGGCCCCATGGGCCCTATTGGAAAGCCTGGT
CCCAAAGGAGAAGCTGGACCCACGGGGCCCCAGGGTGAGCCAGGAGTCCGGGGAATAAGAGGCTGGAAAGGAG
ATCGAGGAGAGAAAGGGAAAATCGGTGAGACTCTAGTCTTGCCAAAAAGTGCTTTCACTGTGGGGCTCACGGT
GCTGAGCAAGTTTCCTTCTTCAGATATGCCCATTAAATTTGATAAGATCCTGTATAACGAATTCAACCATTAT
GATACAGCAGCGGGGAAATTCACGTGCCACATTGCTGGGGTCTATTACTTCACCTACCACATCACTGTTTTCT
CCAGAAATGTTCAGGTGTCTTTGGTCAAAAATGGAGTAAAAATACTGCACACCAAAGATGCTTACATGAGCTC
TGAGGACCAGGCCTCTGGCGGCATTGTCCTGCAGCTGAAGCTCGGGGATGAGGTGTGGCTGCAGGTGACAGGA
GGAGAGAGGTTCAATGGCTTGTTTGCTGATGAGGACGATGACACAACTTTCACAGGGTTCCTTCTGTTCAGCA
GCCCG
SEQ ID NO: 14 (mature INSP058 protein sequence) NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIK
GDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPG
PKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHY
DTAAGKFTCHIAGVYYFTYHTTVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTG
GERFNGLFADEDDDTTFTGFLLFSSP
SEQ ID NO: 15 (mature INSP058SV nucleotide sequence) AACATAAACTCACAGGACACCTGCAGGCAAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGC
CTGGAAGAGATGGACGAGACGGAGCGAAGGGTGACAAAGGCGATGCAGGAGAACCAGGATGTCCTGGCAGCCC
GGGGAAGGATGGGACGAGTGGAGAGAAGGGAGAACGAGGAGCAGATGGAAAAGTTGAAGCAAAAGGCATCAAA
GGAATGTTCAGGTGTCTTTGGTCAAAAACGGAGTAA
SEQ ID N0: l6 (mature INSP058SV protein sequence) NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGCPGSPGKDGTSGEKGERGADGKVEAKGIK
GMFRCLWSKTE
All publications, patents and patent applications cited herein are incorporated in full by reference.
Background The process of drug discovery is presently undergoing a fundamental revolution as the era of functional genomics comes of age. The term "functional genomics" applies to an to approach utilising bioinformatics tools to ascribe function to protein sequences of interest.
Such tools are becoming increasingly necessary as the speed of generation of sequence data is rapidly outpacing the ability of research laboratories to assign functions to these protein sequences.
As bioinformatics tools increase in potency and in accuracy, these tools are rapidly replacing the conventional techniques of biochemical characterisation. Indeed, the advanced bioinformatics tools used in identifying the present invention are now capable of outputting results in which a high degree of confidence can be placed.
Various institutions and commercial organisations are examining sequence data as they become available and significant discoveries are being made on an on-going basis. Incyte 2o Genomics, Inc., for example, have a published patent application (WO
00/68380) relating to sequences associated with human extracellular matrix and adhesion-associated proteins (EXMAD) and polynucleotides which identify and encode EXMAD. However, there remains a continuing need to identify and characterise further genes and the polypeptides that they encode, as targets for research and for drug discovery.
SECRETED PROTEINS
3o The ability of cells to make and secrete extracellular proteins is central to many biological processes. Enzymes, growth factors, extracellular matrix proteins and signalling molecules are all secreted by cells. This is through fusion of a secretory vesicle with the plasma membrane. In most cases, but not all, proteins are directed to the endoplasmic reticulum and into secretory vesicles by a signal peptide. Signal peptides are cis-acting sequences that affect the transport of polypeptide chains from the cytoplasm to a membrane bound compartment such as a secretory vesicle. Polypeptides that are targeted to the secretory vesicles are either secreted into the extracellular matrix or are retained in the plasma membrane. The polypeptides that are retained in the plasma membrane will have one or more transmembrane domains. Examples of secreted proteins that play a central role in the functioning of a cell are cytokines, hormones, extracellular matrix proteins (adhesion molecules), proteases, TNF-like proteins and growth and differentiation factors.
Alteration of the activity of secreted proteins thus provides a means to alter disease phenotype and as such, identification of novel secreted proteins, particularly TNF-like to secreted proteins, is highly relevant as they may play a role in certain diseases and thus be useful in the development of novel therapies.
THE INVENTION
The invention is based on the discovery that the INSP058 protein is a T'NF-like secreted protein. In one embodiment of the first aspect of the invention, there is provided a polypeptide which:
(i) comprises the amino acid sequence as recited in SEQ ID N0:8 andlor SEQ ID
N0:12;
(ii) is a fragment thereof which is a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptides of (i); or 2o (iii) is a functional equivalent of (i) or (ii).
According to a second embodiment of this first aspect of the invention, there is provided a polypeptide which:
(i) consists of the amino acid sequence as recited in SEQ ID N0:8 and/or SEQ
ID
NO:12, (ii) is a fragment thereof having the function of a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptide of (i); or (iii) is a functional equivalent of (i) or (ii).
Preferably, the fragment or functional equivalent of the first or second embodiments consists of the amino acid recited in SEQ ID N0:9 or SEQ ID N0:16.
3o The polypeptide having the sequence recited in SEQ ID N0:8 is referred to hereafter as "the INSP058 polypeptide". This protein is annotated herein as a TNF-like secreted protein. The closest link identified for this protein to proteins of known function is to complement 1 q proteins. Complement 1 q (C 1 q) proteins are TNF-related proteins in that crystollographic studies have revealed that TNF and the globular gC 1 q domain of mouse ACRP30 have a closely related tertiary structure and trimeric organization suggestive of an evolutionary link between the TNF and C 1 q families. The human C 1 q gene family comprises, to date, of 13 members, including collagenous members such as CRF, ACRP30, CORS26, EMILIN-1, EMILIN-2, collagens VII and X, and non-collagenous members such as precerebellin and multimerin. ACRP30 is an abundant serum protein, to synthesized in adipose tissue in response to insulin, and is down-regulated in the obese mouse and humans. For a recent review of the C 1 q family, see Bodmer et al., (2002), TRENDS in Biochemical Sciences 27(1):19-26.
C 1 q ~ family members may be useful for the treatment, prevention and/or diagnosis of medical conditions and diseases such as cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours;
myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma;
autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection;
cardiovascular 2o disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia; neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain;
developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by Clq family proteins.
It is anticipated that the INSP058 polypeptide is encoded by three axons (axon 1 encoding a polypeptide having the sequence recited in SEQ ID N0:2, axon 2 encoding a polypeptide having the sequence recited SEQ ID N0:4 and axon 3 encoding a polypeptide having the 3o sequence SEQ ID N0:6). A sequence of some similarity to SEQ ID N0:8 has been disclosed in the prior art, although the protein was not annotated as a secreted protein with a TNF-like fold. This polypeptide sequence, presented in SEQ ID N0:8 of International patent application WO00/68380, is explicitly excluded from the scope of this aspect of the present invention.
The polypeptide having the sequence recited in SEQ ID NO:10 is referred to hereafter as the "INSP058SV polypeptide" or "INSP058SV". The INSP0158SV polypeptide is a splice variant of the INSP058 polypeptide, caused by a deletion in the central portion of exon 3 (SEQ ID NO:S). The deletion, as well as deleting a portion of exon 3, introduces a frameshift into the nucleotide sequence, the result being an early stop codon, so that the translated INSPOSBSV polypeptide is much shorter in length than the INSP058 polypeptide (Figure 10). The INSP058SV protein lacks a domain matching the Clq domain that is found in the full length INSP058, suggesting that INSP058SV may be an antagonist of to INSP058, acting, for example, to compete with the INSP058 version of the polypeptide for the same binding site on the receptor. In such a mechanism, the INSP058SV
polypeptide would not stimulate the receptor, so that the normal biological effect would not be induced.
Such a polypeptide would therefore be a competitive inhibitor of the natural polypeptide.
Although the Applicant does not wish to be bound by this theory, it is postulated that the 1s first 15 amino acids of INSP058 polypeptide and INSP058SV polypeptide each form a signal peptide.
The full length INSP058 polypeptide sequence without this postulated signal sequence is recited in SEQ ID NO: 14.
The polypeptide having the sequence recited in SEQ ID N0:14 is referred to hereafter as 2o the "INSP058 mature polypeptide".
The term "INSP058 polypeptides" as used herein includes polypeptides comprising the INSP058 exon 1 polypeptide, the INSP058 exon 2 polypeptide, the INSP058 exon 3 polypeptide, the INSP058 polypeptide and the 1NSP058 mature polypeptide.
The full length INSP058SV polypeptide sequence without this postulated signal sequence 25 is recited in SEQ ID N0:16.
The polypeptide having the sequence recited in SEQ ID NO:16 is referred to hereafter as the "INSP058SV mature polypeptide".
The term "INSP058SV polypeptides" as used herein includes polypeptides comprising the the TNSP058SV mature polypeptide.
3o In a second aspect, the invention provides a purified nucleic acid molecule which encodes a polypeptide of the first aspect of the invention.
Preferably, the purified nucleic acid molecule comprises the nucleic acid sequence as recited in SEQ ID N0:7 (encoding the INSPOS8 polypeptide), SEQ ID N0:9 (encoding the INSP058SV polypeptide), SEQ ID NO:11 (encoding the exon 1 polypeptide of mature INSP058), SEQ ID NO:I3 (encoding the mature 1NSP058 polypeptide), SEQ ID NO:15 5 (encoding the mature INSP058SV polypeptide), or is a redundant equivalent or fragment of this sequence.
The invention further provides that the purified nucleic acid molecule consists of the nucleic acid sequence as recited in SEQ ID N0:7, SEQ ID N0:9 (encoding the INSP058SV polypeptide), SEQ ID NO:11 (encoding the exon 1 polypeptide of mature to INSP058 or mature INSP058SV), SEQ ID N0:13 (encoding the mature INSP058 polypeptide), SEQ ID NO:15 (encoding the mature INSP058SV polypeptide), or is a redundant equivalent or fragment of this sequence.
In a third aspect, the invention provides a purified nucleic acid molecule which hybridizes under high stringency conditions with a nucleic acid molecule of the second aspect of the invention.
In a fourth aspect, the invention provides a vector, such as an expression vector, that contains a nucleic acid molecule of the second or third aspect of the invention.
In a fifth aspect, the invention provides a host cell transformed with a vector of the fourth aspect of the invention.
2o In a sixth aspect, the invention provides a ligand that binds specifically to the polypeptide of the first aspect of the invention. Preferably, the ligand inhibits the function of a polypeptide of the first aspect of the invention which is a secreted protein with a TNF-lilce activity. Ligands to a polypeptide according to the invention may come in various forms, including natural or modified substrates, enzymes, receptors, small organic molecules such as small natural or synthetic organic molecules of up to 2000D, preferably 800D or lesss, peptidomimetics, inorganic molecules, peptides, polypeptides, antibodies, structural or functional mimetics of the aforementioned.
In a seventh aspect, the invention provides a compound that is effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the 3o invention or to regulate the activity of a polypeptide of the first aspect of the invention.
A compound of the seventh aspect of the invention may either increase (agonise) or decrease (antagonise) the level of expression of the gene or the activity of the polypeptide.
Importantly, the identification of the function of the INSP058 allows for the design of screening methods capable of identifying compounds that are effective in the treatment and/or diagnosis of disease. Ligands and compounds according to the sixth and seventh aspects of the invention may be identified using such methods. These methods are included as aspects of the present invention.
In an eighth aspect, the invention provides a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the f fth aspect of the l0 invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in therapy or diagnosis of diseases in which TNF-like secreted proteins are implicated. Such diseases may include, but are not limited to, cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours; myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma; autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis; psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection; cardiovascular disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia;
neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C 1 q family proteins. These molecules may also be used in the manufacture of a medicament for the treatment such diseases. The moieties of the first, second, third, fourth, fifth, sixth or seventh aspect of the invention may also be used in the maufacture of a medicament for the treatment of such diseases.
In a ninth aspect, the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide of the first aspect of the invention or the activity of a polypeptide of the first aspect of the invention in tissue from said patient and comparing said level of expression or activity to a control level, wherein a level that is different to said control level is indicative of disease.
Such a method will preferably be carried out i~z vitro. Similar methods may be used for monitoring the therapeutic treatment of disease in a patient, wherein altering the level of expression or activity of a polypeptide or nucleic acid molecule over the period of time towards a control level is indicative of regression of disease.
A preferred method for detecting polypeptides of the first aspect of the invention comprises the steps of (a) contacting a ligand, such as an antibody, of the sixth aspect of the invention with a biological sample under conditions suitable for the formation of a Iigand-polypeptide complex; and (b) detecting said complex.
to A number of different such methods according to the ninth aspect of the invention exist, as the skilled reader will be aware, such as methods of nucleic acid hybridization with short probes, point mutation analysis, polymerase chain reaction (PCR) amplification and methods using antibodies to detect aberrant protein levels. Similar methods may be used on a short or long term basis to allow therapeutic treatment of a disease to be monitored in a patient. The invention also provides kits that are useful in these methods for diagnosing disease.
Preferably, the disease diagnosed by a method of the ninth aspect of the invention is a disease in which a TNF-like secreted protein is implicated, as described above.
In a tenth aspect, the invention provides for the use of a polypeptide of the first aspect of 2o the invention as a TNF-like secreted protein.
In an eleventh aspect, the invention provides a pharmaceutical composition comprising a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, in conjunction with a pharmaceutically-acceptable carrier.
In a twelfth aspect, the present invention provides a polypeptide of the first aspect of the invention, ox a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the 3o invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention, for use in the manufacture of a medicament for the diagnosis or treatment of a disease.
Preferably, the disease is a disease in which TNF-like secreted proteins are implicated, as described above.
In a thirteenth aspect, the invention provides a method of treating a disease in a patient comprising administering to the patient a polypeptide of the first aspect of the invention, or a nucleic acid molecule of the second or third aspect of the invention, or a vector of the fourth aspect of the invention, or a host cell of the fifth aspect of the invention, or a ligand of the sixth aspect of the invention, or a compound of the seventh aspect of the invention.
For diseases in which the expression of a natural gene encoding a polypeptide of the first to aspect of the invention, or in which the activity of a polypeptide of the first aspect of the invention, is lower in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an agonist.
Conversely, for diseases in which the expression of the natural gene or activity of the polypeptide is higher in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, host cell, ligand or compound administered to the patient should be an antagonist. Examples of such antagonists include antisense nucleic acid molecules, ribozymes and ligands, such as antibodies.
s Preferably, the disease is a disease in which a TNF-like secreted protein is implicated, as 2o described above.
In a fourteenth aspect, the invention provides transgenic or knockout non-human animals that have been transformed to express higher, lower or absent levels of a polypeptide of the first aspect of the invention. Such transgenic animals are very useful models for the study of disease and may also be used in screening regimes for the identification of compounds that are effective in the treatment or diagnosis of such a disease.
A summary of standard techniques and procedures which may be employed in order to utilise the invention is given below. It will be understood that this invention is not limited to the particular methodology, protocols, cell lines, vectors and reagents described. It is also to be understood that the terminology used herein is for the purpose of describing 3o particular embodiments only and it is not intended that this terminology should limit the scope of the present invention. The extent of the invention is limited only by the terms of the appended claims.
Standard abbreviations fox nucleotides and amino acids are used in this specification.
The practice of the present invention will employ, unless otherwise indicated, conventional techniques of molecular biology, microbiology, recombinant DNA technology and immunology, which are within the skill of those working in the art.
Such techniques are explained fully in the literature. Examples of particularly suitable texts for consultation include the following: Molecular Cloning; A Laboratory Manual, Third Edition (Sambrook ed. 2001); DNA Cloning, Volumes I and II (D.N Glover ed.
I985);
Oligonucleotide Synthesis (M.J. Gait ed. I984); Nucleic Acid Hybridization (B.D. Hames to & S.J. Higgins eds. 1984); Transcription and Translation (B.D. Hames & S.J.
Higgins eds.
1984); Animal Cell Culture (R.I. Freshney ed. 1986); Immobilized Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide to Molecular Cloning (1984);
the Methods in Enzymology series (Academic Press, Inc.), especially volumes I54 ~ 155;
Gene Transfer Vectors for Mammalian Cells (J.H. Miller and M.P. Calos eds. 1987, Cold Spring Harbor Laboratory); Immunochemical Methods in Cell and Molecular Biology (Mayer and Walker, eds. 1987, Academic Press, London); Scopes, (I987) Protein Purification:
Principles and Practice, Second Edition (Springer Verlag, N.Y.); and Handbook of Experimental Immunology, Volumes I-IV (D.M. Weir and C. C. Blackwell eds.
I986).
As used herein, the term "polypeptide" includes any peptide or protein comprising two or 2o more amino acids joined to each other by peptide bonds or modified peptide bonds, i.e.
peptide isosteres. This term refers both to short chains (peptides and oligopeptides) and to longer chains (proteins).
The polypeptide of the present invention may be in the form of a mature protein or may be a pre-, pro- or prepro- protein that can be activated by cleavage of the pre-, pro- or prepro-portion to produce an active mature polypeptide. In such polypeptides, the pre-, pro- or prepro- sequence may be a leader or secretory sequence or may be a sequence that is employed for purification of the mature polypeptide sequence.
The polypeptide of the first aspect of the invention may form part of a fusion protein. For example, it is often advantageous to include one or more additional amino acid sequences 3o which may contain secretory or leader sequences, pro-sequences, sequences which aid in purification, or sequences that confer higher protein stability, for example during recombinant production. Alternatively or additionally, the mature polypeptide may be :Cased with another compound, such as a compound to increase the half life of the polypeptide (for example, polyethylene glycol).
Polypeptides may contain amino acids other than the 20 gene-encoded amino acids, 5 modified either by natural processes, such as by post-translational processing or by chemical modification techniques which are well known in the axt. Among the known modifications which may commonly be present in polypeptides of the present invention are glycosylation, lipid attachment, sulphation, gamma-carboxylation, for instance of glutamic acid residues, hydroxylation and ADP-ribosylation. Other potential modifications l0 include acetylation, acylation, amidation, covalent attachment of flavin, covalent attachment of a haeme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid derivative, covalent attachment of phosphatidylinositol, cross-linking, cyclization, disulphide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, GPI anchor formation, iodination, methylation, myristoylation, oxidation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination.
Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. In fact, blockage of the amino or carboxyl terminus in a polypeptide, or both, by a covalent modification is common in naturally-occurring and synthetic polypeptides and such modifications may be present in polypeptides of the present invention.
The modifications that occur in a polypeptide often will be a function of how the polypeptide is made. For polypeptides that are made recombinantly, the nature and extent of the modifications in large part will be determined by the post-translational modification capacity of the particular host cell and the modification signals that are present in the amino acid sequence of the polypeptide in question. For instance, glycosylation patterns vary between different types of host cell.
The polypeptides of the present invention can be prepared in any suitable manner. Such 3o polypeptides include isolated naturally-occurring polypeptides (for example puxified from cell culture), recombinantly-produced polypeptides (including fusion proteins), synthetically-produced polypeptides or polypeptides that are produced by a combination of these methods.
The functionally-equivalent polypeptides of the first aspect of the invention may be polypeptides that are homologous to the INSP058 polypeptide. Two polypeptides are said to be "homologous", as the term is used herein, if the sequence of one of the polypeptides has a high enough degree of identity or similarity to the sequence of the other polypeptide.
"Identity" indicates that at any particular position in the aligned sequences, the amino acid residue is identical between the sequences. "Similarity" indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences. Degrees of identity and similarity can be readily calculated (Computational to Molecular Biology, Lesk, A.M., ed., Oxford University Press, New York, 1988;
Biocomputing. Informatics and Genome Projects, Smith, D.W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A.M., and Griffin, H.G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M.
and Devereux, J., eds., M Stockton Press, New York, 1991 ).
Homologous polypeptides therefore include natural biological variants (for example, allelic variants or geographical variations within the species from which the polypeptides are derived) and mutants (such as mutants containing amino acid substitutions, insertions or deletions) of the INSPOS8 polypeptide. Such mutants may include polypeptides in 2o which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code.
Typical such substitutions are among Ala, Val, Leu and Ile; among Ser and Thr;
among the acidic residues Asp and Glu; among Asn and Gln; among the basic residues Lys and Arg;
or among the aromatic residues Phe and Tyr. Particularly preferred are variants in which several, i.e. between 5 and 10, 1 and 5, 1 and 3, 1 and 2 or just 1 amino acids are substituted, deleted or added in any combination. Especially preferred are silent substitutions, additions and deletions, which do not alter the properties and activities of the protein. Also especially preferred in this regard are conservative substitutions. Such 3o mutants also include polypeptides in which one or more of the amino acid residues includes a substituent group.
Typically, greater than 30% identity between two polypeptides is considered to be an indication of functional equivalence. Preferably, functionally equivalent polypeptides of the first aspect of the invention have a degree of sequence identity with the polypeptide, or with active fragments thereof, of greater than 80%. More preferred polypeptides of the present invention have degrees of identity of greater than 85%, 90%, 95%, 98% or 99%, respectively to INSP058 polypeptide.
The functionally-equivalent polypeptides of the first aspect of the invention may also be polypeptides which have been identified using one or more techniques of structural alignment. For example, the Inpharmatica Genome Threader technology that forms one aspect of the search tools used to generate the Biopendium search database may be used (see co-pending International Patent Application PCT/GBOl/01105) to identify polypeptides of presently-unknown function which, while having low sequence identity as compared to the INSP058 polypeptide, are predicted to have the function of a TNF-like secreted protein, by virtue of sharing significant structural homology with the INSP058 polypeptide. By "significant structural homology" is meant that the Inpharmatica Genome Threader predicts two proteins to share structural homology with a certainty of 10% and above.
The polypeptides of the first aspect of the invention also include fragments of the 1NSP058 polypeptide and fragments of the functional equivalents of the INSP058 polypeptide, provided that those fragments retain the function of a TNF-like secreted protein or have an antigenic determinant in common with the INSP058 polypeptide.
As used herein, the term "fragment" refers to a polypeptide having an amino acid sequence that is the same as part, but not all, of the amino acid sequence of the polypeptide, or one of their functional equivalents. The fragments should comprise at least n consecutive amino acids from the sequence and, depending on the particular sequence, n preferably is 7 or more (for example, 8, 10, 12, 14, 16, 18, 20 or more).
Small fragments may form an antigenic determinant.
Fragments of the full length INSP058 polypeptide may consist of combinations of 1 or more of neighbouring exon sequences or even combinations of partial exon sequences.
For example, such combinations may include exons 1, 2 and the partial sequence of exon 3 of the INSP058 polypeptide, as is the case with INSP058SV.
Such fragments may be "free-standing", i.e. not part of or fused to other amino acids or polypeptides, or they may be comprised within a larger polypeptide of which they form a part or region. When comprised within a larger polypeptide, the fragment of the invention most preferably forms a single continuous region. For instance, certain preferred embodiments relate to a fragment having a pre - and/or pro- polypeptide region fused to the amino terminus of the fragment and/or an additional region fused to the carboxyl terminus of the fragment. However, several fragments may be comprised within a single larger polypeptide.
The polypeptides of the present invention or their immunogenic fragments (comprising at least one antigenic determinant) can be used to generate ligands, such as polyclonal or monoclonal antibodies, that are immunospecific for the polypeptides. Such antibodies may I o be employed to isolate or to identify clones expressing the polypeptides of the invention or to purify the polypeptides by affinity chromatography. The antibodies may also be employed as diagnostic or therapeutic aids, amongst other applications, as will be apparent to the skilled reader.
The term "immunospecific" means that the antibodies have substantially greater affinity for the polypeptides of the invention than their affinity for other related polypeptides in the prior art. As used herein, the term "antibody" refers to intact molecules as well as to fragments thereof, such as Fab, F(ab')2 and Fv, which are capable of binding to the antigenic determinant in question. Such antibodies thus bind to the polypeptides of the first aspect of the invention.
2o By "substantially greater affinity" we mean that there is a measurable increase in the affinity for a polypeptide of the invention as compared with the affinity for known cell-surface receptors.
Preferably, the affinity is at least I .5-fold, 2-fold, 5-fold 10-fold, 100-fold, 103-fold, 104-fold, 1 OS-fold or 106-fold greater for a polypeptide of the invention than for known cell-surface receptor polypeptides.
If polyclonal antibodies are desired, a selected mammal, such as a mouse, rabbit, goat or horse, may be immunised with a polypeptide of the first aspect of the invention. The polypeptide used to immunise the animal can be derived by recombinant DNA
technology or can be synthesized chemically. If desired, the polypeptide can be conjugated to a carrier 3o protein. Commonly used carriers to which the polypeptides may be chemically coupled include bovine serum albumin, thyroglobulin and keyhole limpet haemocyanin.
The coupled polypeptide is then used to immunise the animal. Serum from the immunised animal is collected and treated according to known procedures, for example by immunoaffinity chromatography.
Monoclonal antibodies to the polypeptides of the first aspect of the invention can also be readily produced by one skilled in the art. The general methodology for making monoclonal antibodies using hybridoma technology is well known (see, for example, Kohler, G. and Milstein, C., Nature 256: 495-497 (1975); Kozbor et al., Immunology Today 4: 72 (1983); Cole et al., 77-96 in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc. (1985).
to Panels of monoclonal antibodies produced against the polypeptides of the first aspect of the invention can be screened for various properties, i.e., for isotype, epitope, affinity, etc.
Monoclonal antibodies are particularly useful in purification of the individual polypeptides against which they are directed. Alternatively, genes encoding the monoclonal antibodies of interest may be isolated from hybridomas, for instance by PCR techniques known in the art, and cloned and expressed in appropriate vectors.
Chimeric antibodies, in which non-human variable regions are joined or fused to human constant regions (see, fox example, Liu et al., Proc. Natl. Acad. Sci. USA, 84, 3439 (1987)), may also be of use.
The antibody may be modified to make it less immunogenic in an individual, for example 2o by humanisation (see Jones et al., Nature, 321, 522 (1986); Verhoeyen et al., Science, 239, 1534 (1988); Kabat et al., J. Immunol., 147, 1709 (199I); Queen et al., Proc.
Natl Acad.
Sci. USA, 86, 10029 (1989); Gorman et al., Proc. Natl Acad. Sci. USA, 88, 34181 (1991);
and Hodgson et al., Bio/Technology, 9, 421 (1991)). The term "humanised antibody", as used herein, refers to antibody molecules in which the CDR amino acids and selected other amino acids in the variable domains of the heavy and/or light chains of a non-human donor antibody have been substituted in place of the equivalent amino acids in a human antibody.
The humanised antibody thus closely resembles a human antibody but has the binding ability of the donor antibody.
In a further alternative, the antibody may be a "bispecific" antibody, that is an antibody 3o having two different antigen binding domains, each domain being directed against a different epitope.
Phage display technology may be utilised to select genes which encode antibodies with binding activities towards the polypeptides of the invention either from repertoires of PCR
amplified V-genes of lymphocytes from humans screened for possessing the relevant antibodies, or from naive libraries (McCafferty, J. et al., (1990), Nature 348, 552-554;
s Marks, J. et al., (1992) Biotechnology 10, 779-783). The affinity of these antibodies can also be improved by chain shuffling (Clackson, T. et al., (1991) Nature 352, 624-628).
Antibodies generated by the above techniques, whether polyclonal or monoclonal, have additional utility in that they may be employed as reagents in immunoassays, radioimmunoassays (RIA) or enzyme-linked immunosorbent assays (ELISA). In these 1 o applications, the antibodies can be labelled with an analytically-detectable reagent such as a radioisotope, a fluorescent molecule or an enzyme.
Preferred nucleic acid molecules of the second and third aspects of the invention are those which encode the polypeptide sequence recited in SEQ ID N0:8 and functionally equivalent polypeptides. These nucleic acid molecules may be used in the methods and 15 applications described herein. The nucleic acid molecules of the invention preferably comprise at least n consecutive nucleotides from the sequences disclosed herein where, depending on the particular sequence, n is 10 or more (for example, 12, 14, 15, 18, 20, 25, 30, 35, 40 or more).
The nucleic acid molecules of the invention also include sequences that are complementary 2o to nucleic acid molecules described above (for example, for antisense or probing purposes).
Nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance cDNA, synthetic DNA or genomic DNA. Such nucleic acid molecules may be obtained by cloning, by chemical synthetic techniques or by a combination thereof. The nucleic acid molecules can be prepared, for example, by chemical synthesis using techniques such as solid phase phosphoramidite chemical synthesis, from genomic or cDNA libraries or by separation from an organism.
RNA molecules may generally be generated by the in vitro or in vivo transcription of DNA
sequences.
3o The nucleic acid molecules may be double-stranded or single-stranded.
Single-stranded DNA may be the coding strand, also known as the sense strand, or it may be the non-coding strand, also referred to as the anti-sense strand.
The term "nucleic acid molecule" also includes analogues of DNA and RNA, such as those containing modified backbones, and peptide nucleic acids (PNA). The term "PNA", as used herein, refers to an antisense molecule or an anti-gene agent which comprises an oligonucleotide of at least five nucleotides in length linked to a peptide backbone of amino acid residues, which preferably ends in lysine. The terminal lysine confers solubility to the composition. PNAs may be pegylated to extend their lifespan in a cell, where they preferentially bind complementary single stranded DNA and RNA and stop transcript elongation (Nielsen, P.E. et al., (I993) Anticancer Drug Des. 8:53-63).
A nucleic acid molecule which encodes the polypeptide of SEQ ID N0:8, may be identical 1 o to the coding sequence of the nucleic acid molecule shown in SEQ ID N0:7.
These molecules also may have a different sequence which, as a result of the degeneracy of the genetic code, encodes a polypeptide of SEQ ID N0:8. Such nucleic acid molecules may include, but are not limited to, the coding sequence for the mature polypeptide by itself; the coding sequence for the mature polypeptide and additional coding sequences, such as those encoding a leader or secretory sequence, such as a pro-, pre- or prepro-polypeptide sequence; the coding sequence of the mature polypeptide, with or without the aforementioned additional coding sequences, together with further additional, non-coding sequences, including non-coding 5' and 3' sequences, such as the transcribed, non-translated sequences that play a role in transcription (including termination signals), 2o ribosome binding and mRNA stability. The nucleic acid molecules may also include additional sequences which encode additional amino acids, such as those which provide additional functionalities.
The nucleic acid molecules of the second and third aspects of the invention may also encode the fragments or the functional equivalents of the polypeptides and fragments of the first aspect of the invention. Such a nucleic acid molecule may be a naturally-occurring variant such as a naturally-occurring allelic variant, or the molecule may be a variant that is not known to occur naturally. Such non-naturally occurring variants of the nucleic acid molecule may be made by mutagenesis techniques, including those applied to nucleic acid molecules, cells or organisms.
Among variants in this regard are variants that differ from the aforementioned nucleic acid molecules by nucleotide substitutions, deletions or insertions. The substitutions, deletions or insertions may involve one or more nucleotides. The variants may be altered in coding or non-coding regions or both. Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or insertions.
The nucleic acid molecules of the invention can also be engineered, using methods generally known in the art, for a variety of reasons, including modifying the cloning, processing, and/or expression of the gene product (the polypeptide). DNA
shuffling by xandom fragmentation and PCR reassembly of gene fragments and synthetic oligonucleotides are included as techniques which may be used to engineer the nucleotide sequences. Site-directed mutagenesis may be used to insert new restriction sites, alter glycosylation patterns, change codon preference, produce splice variants, introduce 1 o mutations and so forth.
Nucleic acid molecules which encode a polypeptide of the first aspect of the invention may be ligated to a heterologous sequence so that the combined nucleic acid molecule encodes a fusion protein. Such combined nucleic acid molecules are included within the second or third aspects of the invention. For example, to screen peptide libraries for inhibitors of the activity of the polypeptide, it may be useful to express, using such a combined nucleic acid molecule, a fusion protein that can be recognised by a commercially-available antibody. A
fusion protein may also be engineered to contain a cleavage site located between the sequence of the polypeptide of the invention and the sequence of a heterologous protein so that the polypeptide may be cleaved and purified away from the heterologous protein.
2o The nucleic acid molecules of the invention also include antisense molecules that are partially complementary to nucleic acid molecules encoding polypeptides of the present invention and that therefore hybridize to the encoding nucleic acid molecules (hybridization). Such antisense molecules, such as oligonucleotides, can be designed to recognise, specifically bind to and prevent transcription of a target nucleic acid encoding a polypeptide of the invention, as will be lcnown by those of ordinary skill in the art (see, for example, Cohen, J.S., Trends in Pharm. Sci., 10, 435 (1989), Okano, J.
Neurochem. 56, 560 (1991); O'Connor, J. Neurochem 56, 560 (1991); Lee et al., Nucleic Acids Res 6, 3073 (1979); Cooney et al., Science 241, 456 (1988); Dervan et al., Science 251, 1360 (I99I).
The term "hybridization" as used here refers to the association of two nucleic acid 3o molecules with one another by hydrogen bonding. Typically, one molecule will be fixed to a solid support and the other will be free in solution. Then, the two molecules may be placed in contact with one another under conditions that favour hydrogen bonding. Factors l~
that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase molecule to the solid support (Denhardt's reagent or BLOTTO); the concentration of the molecules; use of compounds to increase the rate of association of molecules (dextran sulphate or polyethylene glycol); and the stringency of the washing conditions following hybridization (see Sambrook et al., [supra]).
The inhibition of hybridization of a completely complementary molecule to a target molecule may be examined using a hybridization assay, as known in the art (see, for example, Sambrook et al., [sups°a]). A substantially homologous molecule will then compete for and inhibit the binding of a completely homologous molecule to the target molecule under various conditions of stringency, as taught in Wahl, G.M. and S.L. Berger (1987; Methods Enzymol. 152:399-407) and Kimmel, A.R. (1987; Methods Enzymol.
I 52:507-S I 1 ).
"Stringency" refers to conditions in a hybridization reaction that favour the association of very similar molecules over association of molecules that differ. High stringency hybridisation conditions are defined as overnight incubation at 42°C in a solution comprising 50% formamide, SXSSC (150mM NaCI, ISmM trisodium citrate), SOmM
sodium phosphate (pH7.6), Sx Denhardts solution, 10% dextran sulphate, and 20 microgram/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 2o O.IX SSC at approximately 65°C. Low stringency conditions involve the hybridisation reaction being carried out at 35°C (see Sambrook et al., [supra]).
Preferably, the conditions used for hybridization are those of high stringency.
Preferred embodiments of this aspect of the invention are nucleic acid molecules that are at least 70% identical over their entire length to a nucleic acid molecule encoding the INSP058 polypeptide (SEQ ID N0:8), and nucleic acid molecules that axe substantially complementary to said nucleic acid molecules of this embodiment. Preferably, a nucleic acid molecule according to this aspect of the invention comprises a region that is at least 97% identical over its entire length to such coding sequences, or is a nucleic acid molecule that is complementary thereto. In this regard, nucleic acid molecules at least 98%, 3o preferably at least 99% or more identical over their entire length to the same axe particularly preferred. Preferred embodiments in this respect are nucleic acid molecules that encode polypeptides which retain substantially the same biological function or activity as the INSP058 polypeptide.
The invention also provides a process for detecting a nucleic acid molecule of the invention, comprising the steps of (a) contacting a nucleic probe according to the invention with a biological sample under hybridizing conditions to form duplexes; and (b) detecting any such duplexes that are formed.
As discussed additionally below in connection with assays that may be utilised according to the invention, a nucleic acid molecule as described above may be used as a hybridization probe for RNA, cDNA or genomic DNA, in order to isolate full-length cDNAs and genomic clones encoding the INSP058 polypeptide and to isolate cDNA
and to genomic clones of homologous or orthologous genes that have a high sequence similarity to the gene encoding this polypeptide.
In this regard, the following techniques, among others known in the art, may be utilised and are discussed below for purposes of illustration. Methods for DNA
sequencing and analysis are well known and are generally available in the art and may, indeed, be used to practice many of the embodiments of the invention discussed herein. Such methods may employ such enzymes as the Klenow fragment of DNA polyrnerase I, Sequenase (US
Biochemical Corp, Cleveland, OH), Taq polymerase (Pexkin Elmer), thexmostable polymerase (Amersham, Chicago, IL), or combinations of polymerases and proof reading exonucleases such as those found in the ELONGASE Amplification System marketed by 2o Gibco/BRL (Gaithersburg, MD). Preferably, the sequencing process may be automated using machines such as the Hamilton Micro Lab 2200 (Hamilton, Reno, NV), the Peltier Thermal Cycler (PTC200; MJ Research, Watertown, MA) and the ABI Catalyst and and 377 DNA Sequencers (Perkin Elmer).
One method for isolating a nucleic acid molecule encoding a polypeptide with an equivalent function to that of the INSP058 polypeptide is to probe a genomic or cDNA
library with a natural or artifcially-designed probe using standard procedures that are recognised in the art (see, for example, "Current Protocols in Molecular Biology", Ausubel et al., (eds). Greene Publishing Association and John Wiley Interscience, New York, 1989,1992). Probes comprising at least 15, preferably at least 30, and more preferably at least 50, contiguous bases that correspond to, or are complementary to, nucleic acid sequences from the appropriate encoding gene (SEQ ID N0:7), are particularly useful probes. Such probes may be labelled with an analytically-detectable reagent to facilitate their identification. Useful reagents include, but are not limited to, radioisotopes, fluorescent dyes and enzymes that are capable of catalysing the formation of a detectable product. Using these probes, the ordinarily skilled artisan will be capable of isolating complementary copies of genomic DNA, cDNA or RNA polynucleotides encoding s proteins of interest from human, mammalian or other animal sources and screening such sources for related sequences, for example, for additional members of the family, type and/or subtype.
In many cases, isolated cDNA sequences will be incomplete, in that the region encoding the polypeptide will be cut short, normally at the 5' end. Several methods are available to to obtain full length cDNAs, or to extend short cDNAs. Such sequences may be extended utilising a partial nucleotide sequence and employing various methods known in the art to detect upstream sequences such as promoters and regulatory elements. For example, one method which may be employed is based on the method of Rapid Amplification of cDNA
Ends (RACE; see, for example, Frohman et al., PNAS USA 85, 8998-9002, 1988).
Recent i s modifications of this technique, exemplified by the MarathonTM technology (Clontech Laboratories Inc.), for example, have significantly simplified the search for longer cDNAs.
A slightly different technique, termed "restriction-site" PCR, uses universal primers to retrieve unknown nucleic acid sequence adjacent a known locus (Sarkar, G.
(1993) PCR
Methods Applic. 2:318-322). Inverse PCR may also be used to amplify or to extend 2o sequences using divergent primers based on a known region (Triglia, T. et al., (1988) Nucleic Acids Res. 16:8186). Another method which may be used is capture PCR
which involves PCR amplification of DNA fragments adjacent a known sequence in human and yeast artificial chromosome DNA (Lagerstrom, M. et al., (1991) PCR Methods Applic., l, 111-119). Another method which may be used to retrieve unknown sequences is that of Parker, J.D. et al., (1991); Nucleic Acids Res. 19:3055-3060). Additionally, one may use PCR, nested primers, and PromoterFinderTM libraries to walk genomic DNA
(Clontech, Palo Alto, CA). This process avoids the need to screen libraries and is useful in finding intron/exon junctions.
When screening for full-length cDNAs, it is preferable to use libraries that have been size-3o selected to include larger cDNAs. Also, random-primed libraries are preferable, in that they will contain more sequences that contain the 5' regions of genes. Use of a randomly primed library may be especially preferable for situations in which an oligo d(T) library does not yield a full-length cDNA. Genomic libraries may be useful for extension of sequence into 5' non-transcribed regulatory regions.
In one embodiment of the invention, the nucleic acid molecules of the present invention may be used for chromosome localisation. In this technique, a nucleic acid molecule is specifically targeted to, and can hybridize with, a particular location on an individual human chromosome. The mapping of relevant sequences to chromosomes according to the present invention is an important step in the confirmatory correlation of those sequences with the gene-associated disease. Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. Such data are found in, for example, V.
McKusick, to Mendelian Inheritance in Man (available on-line through Johns Hopkins University Welch Medical Library). The relationships between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes). This provides valuable information to investigators searching for disease genes using positional cloning or other gene discovery techniques.
Once the disease or syndrome has been crudely localised by genetic linkage to a particular genomic region, any sequences mapping to that area may represent associated or regulatory genes for further investigation. The nucleic acid molecule may also be used to detect differences in the chromosomal location due to translocation, inversion, etc, among normal, carrier, or affected individuals.
2o The nucleic acid molecules of the present invention are also valuable for tissue localisation. Such techniques allow the determination of expression patterns of the polypeptide in tissues by detection of the mRNAs that encode them. These techniques include in situ hybridization techniques and nucleotide amplification techniques, such as PCR. Results from these studies provide an indication of the normal functions of the polypeptide in the organism. In addition, comparative studies of the normal expression pattern of mRNAs with that of mRNAs encoded by a mutant gene provide valuable insights into the role of mutant polypeptides in disease. Such inappropriate expression may be of a temporal, spatial or quantitative nature.
Gene silencing approaches may also be undertaken to down-regulate endogenous 3o expression of a gene encoding a polypeptide of the invention. RNA
interference (RNAi) (Elbashir, SM et al., Nature 2001, 41 l, 494-49~) is one method of sequence specific post-transcriptional gene silencing that may be employed. Short dsRNA
olignonucleotides are synthesised in vitf°o and introduced into a cell. The sequence specific binding of these dsRNA oligonuclotides triggers the degradation of target mRNA, reducing or ablating target protein expression.
Efficacy of the gene silencing approaches assessed above may be assessed through the measurement of polypeptide expression (for example, by Western blotting), and at the RNA level using TaqMan-based methodologies.
The vectors of the present invention comprise nucleic acid molecules of the invention and may be cloning or expression vectors. The host cells of the invention, which may be transformed, transfected or transduced with the vectors of the invention may be 1 o prokaryotic or eukaryotic.
The polypeptides of the invention may be prepared in recombinant form by expression of their encoding nucleic acid molecules in vectors contained within a host cell.
Such expression methods are well known to those of skill in the art and many are described in detail by Sambrook et al., (suy°a) and Fernandez & Hoeffler (1998, eds.
"Gene expression systems. Using nature for the art of expression". Academic Press, San Diego, London, Boston, New York, Sydney, Tokyo, Toronto).
Generally, any system or vector that is suitable to maintain, propagate or express nucleic acid molecules to produce a polypeptide in the required host may be used. The appropriate nucleotide sequence may be inserted into an expression system by any of a variety of well-2o known and routine techniques, such as, for example, those described in Sambrook et al., (supra). Generally, the encoding gene can be placed under the control of a control element such as a promoter, ribosome binding site (for bacterial expression) and, optionally, an operator, so that the DNA sequence encoding the desired polypeptide is transcribed into RNA in the transformed host cell.
Examples of suitable expression systems include, for example, chromosomal, episomal and virus-derived systems, including, for example, vectors derived from: bacterial plasmids, bacteriophage, transposons, yeast episomes, insertion elements, yeast chromosomal elements, viruses such as baculoviruses, papova viruses such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, or combinations 3o thereof, such as those derived from plasmid and bacteriophage genetic elements, including cosmids and phagemids. Human artificial chromosomes (HACs) may also be employed to deliver larger fragments of DNA than can be contained and expressed in a plasmid.
Particularly suitable expression systems include microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors;
yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (for example, baculovirus); plant cell systems transformed with virus expression vectors (for example, cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or with bacterial expression vectors (for example, Ti or pBR322 plasmids); or animal cell systems. Cell-free translation systems can also be employed to produce the polypeptides of the invention.
Introduction of nucleic acid molecules encoding a polypeptide of the present invention into 1 o host cells can be effected by methods described in many standard laboratory manuals, such as Davis et al., Basic Methods in Molecular Biology (1986) and Sambrook et al.,[supra].
Particularly suitable methods include calcium phosphate transfection, DEAE-dextran mediated transfection, transfection, microinjection, cationic lipid-mediated transfection, electroporation, transduction, scrape loading, ballistic introduction or infection (see Sambrook et al., 1989 [supra]; Ausubel et al., 1991 [supra]; Spector, Goldman ~
Leinwald, 1998). In eukaryotic cells, expression systems may either be transient (for example, episomal) or permanent (chromosomal integration) according to the needs of the system.
The encoding nucleic acid molecule may or may not include a sequence encoding a control 2o sequence, such as a signal peptide or leader sequence, as desired, for example, for secretion of the translated polypeptide into the lumen of the endoplasmic reticulum, into the periplasmic space or into the extracellular environment. These signals may be endogenous to the polypeptide or they may be heterologous signals. Leader sequences can be removed by the bacterial host in post-translational processing.
In addition to control sequences, it may be desirable to add regulatory sequences that allow for regulation of the expression of the polypeptide relative to the growth of the host cell.
Examples of regulatory sequences are those which cause the expression of a gene to be increased or decreased in response to a chemical or physical stimulus, including the presence of a regulatory compound or to various temperature or metabolic conditions.
Regulatory sequences are those non-translated regions of the vector, such as enhancers, promoters and 5' and 3' untranslated regions. These interact with host cellular proteins to carry out transcription and translation. Such regulatory sequences may vary in their strength and specificity. Depending on the vector system and host utilised, any number of suitable transcription and translation elements, including constitutive and inducible promoters, may be used. For example, when cloning in bacterial systems, inducible promoters such as the hybrid lack promoter of the Bluescript phagemid (Stratagene, LaJolla, CA) or pSportlTM plasmid (Gibco BRL) and the like may be used. The baculovirus polyhedrin promoter may be used in insect cells. Promoters or enhancers derived from the genomes of plant cells (for example, heat shock, RUBISCO and storage protein genes) or from plant viruses (for example, viral promoters or leader sequences) may be cloned into the vector. In mammalian cell systems, promoters from mammalian genes or from to mammalian viruses axe preferable. If it is necessary to generate a cell line that contains multiple copies of the sequence, vectors based on SV40 or EBV may be used with an appropriate selectable marker.
An expression vector is constructed so that the particular nucleic acid coding sequence is located in the vector with the appropriate regulatory sequences, the positioning and orientation of the coding sequence with respect to the regulatory sequences being such that the coding sequence is transcribed under the "control" of the regulatory sequences, i.e., RNA polymerase which binds to the DNA molecule at the control sequences transcribes the coding sequence. In some cases it may be necessary to modify the sequence so that it may be attached to the control sequences with the appropriate orientation;
i.e., to maintain 2o the reading frame.
The control sequences and other regulatory sequences may be ligated to the nucleic acid coding sequence prior to insertion into a vector. Alternatively, the coding sequence can be cloned directly into an expression vector that already contains the control sequences and an appropriate restriction site.
For long-term, high-yield production of a recombinant polypeptide, stable expression is preferred. For example, cell lines which stably express the polypeptide of interest may be transformed using expression vectors which may contain viral origins of replication and/or endogenous expression elements and a selectable marker gene on the same or on a separate vector. Following the introduction of the vector, cells may be allowed to grow for 1-2 days 3o in an enriched media before they are switched to selective media. The purpose of the selectable marker is to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences.
Resistant clones of stably transformed cells may be proliferated using tissue culture techniques appropriate to the cell type.
Mammalian cell lines available as hosts for expression are known in the art and include many immortalised cell lines available from the American Type Culture Collection 5 (ATCC) including, but not limited to, Chinese hamster ovary (CHO), HeLa, baby hamster kidney (BHK), monkey kidney (COS), C127, 3T3, BHK, HEK 293, Bowes melanoma and human hepatocellular carcinoma (for example Hep G2) cells and a number of other cell lines.
In the baculovirus system, the materials for baculovirus/insect cell expression systems are Io commercially available in kit form from, inter alia, Invitrogen, San Diego CA (the "MaxBac" kit). These techniques are generally known to those skilled in the art and are described fully in Summers and Smith, Texas Agricultural Experiment Station Bulletin No.
1555 (1987). Particularly suitable host cells for use in this system include insect cells such as Drosophila S2 and Spodoptera Sf3 cells.
15 There are many plant cell culture and whole plant genetic expression systems known in the art. Examples of suitable plant cellular genetic expression systems include those described in US 5,693,506; US 5,659,122; and US 5,608,143. Additional examples of genetic expression in plant cell culture has been described by Zenk, Phytochemistry 30:3861-3863 (1991).
2o In particular, all plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be utilised, so that whole plants are recovered which contain the transferred gene. Practically all plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugar cane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
25 Examples of particularly prefewed bacterial host cells include streptococci, staphylococci, E. coli, Streptomyces and Bacillus subtilis cells.
Examples of particularly suitable host cells for fungal expression include yeast cells (for example, S. cerevisiae) and Aspergillus cells.
Any number of selection systems are known in the art that may be used to recover 3o transformed cell lines. Examples include the herpes simplex virus thymidine kinase (Wigler, M. et al., (1977) Cell 11:223-32) and adenine phosphoribosyltransferase (Lowy, I.
et al., (1980) Cell 22:817-23) genes that can be employed in tk~ or aprt~
cells, respectively.
Also, antimetabolite, antibiotic or herbicide resistance can be used as the basis for selection; for example, dihydrofolate reductase (DHFR) that confers resistance to methotrexate (Wigler, M, et al., (1980) Proc. Natl. Acad. Sci. 77:3567-70);
npt, which confers resistance to the aminoglycosides neomycin and G-418 (Colbere-Garapin, F. et al., (1981) J. Mol. Biol. 150:1-14) and als or pat, which confer resistance to chlorsulfiuon and phosphinotricin acetyltransferase, respectively. Additional selectable genes have been described, examples of which will be clear to those of skill in the art.
Although the presence or absence of marker gene expression suggests that the gene of to interest is also present, its presence and expression may need to be confirmed. For example, if the relevant sequence is inserted within a marker gene sequence, transformed cells containing the appropriate sequences can be identif ed by the absence of marker gene function. Alternatively, a marker gene can be placed in tandem with a sequence encoding a polypeptide of the invention under the control of a single promoter.
Expression of the marker gene in response to induction or selection usually indicates expression of the tandem gene as well.
Alternatively, host cells that contain a nucleic acid sequence encoding a polypeptide of the invention and which express said polypeptide may be identified by a variety of procedures known to those of skill in the art. These procedures include, but are not limited to, DNA-2o DNA or DNA-RNA hybridizations and protein bioassays, fox example, fluorescence activated cell sorting (FACS) or immunoassay techniques (such as the enzyme-linked immunosorbent assay [ELISA] and radioimmunoassay [RIA]), that include membrane, solution, or chip based technologies for the detection andlor quantification of nucleic acid or protein (see Hampton, R. et al., (1990) Serological Methods, a Laboratory Manual, APS
Press, St Paul, MN) and Maddox, D.E. et al., (1983) J. Exp. Med, 158, 1211-1216).
A wide variety of labels and conjugation techniques are known by those skilled in the art and may be used in various nucleic acid and amino acid assays. Means for producing labelled hybridization or PCR probes for detecting sequences related to nucleic acid molecules encoding polypeptides of the present invention include oligolabelling, nick 3o translation, end-labelling or PCR amplification using a labelled polynucleotide.
Alternatively, the sequences encoding the polypeptide of the invention may be cloned into a vector for the production of an mRNA probe. Such vectors are known in the art, are commercially available, and may be used to synthesise RNA probes in vitro by addition of an appropriate RNA polymerase such as T7, T3 or SP6 and labelled nucleotides.
These procedures may be conducted using a variety of commercially available kits (Pharmacia &
Upjohn, (Kalamazoo, MI); Promega (Madison WI); and U.S. Biochemical Corp., Cleveland, OH)).
Suitable reporter molecules or labels, which may be used for ease of detection, include radionuclides, enzymes and fluorescent, chemiluminescent or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles, and the like.
Nucleic acid molecules according to the present invention may also be used to create Io transgenic animals, particularly rodent animals. Such transgenic animals form a further aspect of the present invention. This may be done locally by modification of somatic cells, or by germ line therapy to incorporate heritable modifcations. Such transgenic animals may be particularly useful in the generation of animal models for drug molecules effective as modulators of the polypeptides of the present invention.
The polypeptide can be recovered and purif ed from recombinant cell cultures by well-known methods including ammonium sulphate or ethanol precipitation, acid extraction, anion or ration exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. High performance liquid chromatography is 2o particularly useful for purification. Well known techniques for refolding proteins may be employed to regenerate an active conformation when the polypeptide is denatured during isolation and or purification.
Specialised vector constructions may also be used to facilitate purification of proteins, as desired, by joining sequences encoding the polypeptides of the invention to a nucleotide sequence encoding a polypeptide domain that will facilitate purification of soluble proteins. Examples of such purification-facilitating domains include metal chelating peptides such as histidine-tryptophan modules that allow purification on immobilised metals, protein A domains that allow purification on immobilised immunoglobulin, and the domain utilised in the FLAGS extension/affinity purification system (Immunex Corp., 3o Seattle, WA). The inclusion of cleavable linker sequences such as those specific fox Factor XA or enterolcinase (Invitrogen, San Diego, CA) between the purification domain and the polypeptide of the invention may be used to facilitate purification. One such expression vector provides for expression of a fusion protein containing the polypeptide of the invention fused to several histidine residues preceding a thioredoxin or an enterokinase cleavage site. The histidine residues facilitate purification by IMAC
(immobilised metal ion affinity chromatography as described in Porath, J. et al., (1992), Prot.
Exp. Purif. 3:
263-281) while the thioredoxin or enterokinase cleavage site provides a means for purifying the polypeptide from the fusion protein. A discussion of vectors which contain fusion proteins is provided in Kroll, D.J. et al., (1993; DNA Cell Biol.
12:441-453).
If the polypeptide is to be expressed for use in screening assays, generally it is preferred that it be produced at the surface of the host cell in which it is expressed.
In this event, the 1 o host cells may be harvested prior to use in the screening assay, for example using techniques such as fluorescence activated cell sorting (FACS) or immunoaffinity techniques. If the polypeptide is secreted into the medium, the medium can be recovered in order to recover and purify the expressed polypeptide. If polypeptide is produced intracellularly, the cells must first be lysed before the polypeptide is recovered.
The polypeptide of the invention can be used to screen libraries of compounds in any of a variety of drug screening techniques. Such compounds may activate (agonise) or inhibit (antagonise) the level of expression of the gene or the activity of the polypeptide of the invention and form a further aspect of the present invention. Preferred compounds are effective to alter the expression of a natural gene which encodes a polypeptide of the first aspect of the invention or to regulate the activity of a polypeptide of the fzrst aspect of the invention.
Agonist or antagonist compounds may be isolated from, for example, cells, cell-free preparations, chemical libraries or natural product mixtuxes. These agonists or antagonists may be natural or modified substrates, ligands, enzymes, receptors or structural or functional mimetics. For a suitable review of such screening techniques, see Coligan et al., Current Protocols in Immunology 1(2):Chapter 5 (1991).
Compounds that are most likely to be good antagonists are molecules that bind to the polypeptide of the invention without inducing the biological effects of the polypeptide upon binding to it. Potential antagonists include small organic molecules, peptides, 3o polypeptides and antibodies that bind to the polypeptide of the invention and thereby inhibit or extinguish its activity. In this fashion, binding of the polypeptide to normal cellular binding molecules may be inhibited, such that the normal biological activity of the polypeptide is prevented.
The polypeptide of the invention that is employed in such a screening technique may be free in solution, affixed to a solid support, borne on a cell surface or located intracellularly.
In general, such screening procedures may involve using appropriate cells or cell membranes that express the polypeptide that are contacted with a test compound to observe binding, or stimulation or inhibition of a functional response. The functional response of the cells contacted with the test compound is then compared with control cells that were not contacted with the test compound. Such an assay may assess whether the test compound results in a signal generated by activation of the polypeptide, using an to appropriate detection system. Inhibitors of activation are generally assayed in the presence of a known agonist and the effect on activation by the agonist in the presence of the test compound is observed.
A preferred method for identifying an agonist or antagonist compound of a polypeptide of the present invention comprises:
(a) contacting a cell expressing on the surface thereof the polypeptide according to the first aspect of the invention, the polypeptide being associated with a second component capable of providing a detectable signal in response to the binding of a compound to the polypeptide, with a compound to be screened under conditions to permit binding to the polypeptide; and 2o (b) determining whether the compound binds to and activates or inhibits the polypeptide by measuring the level of a signal generated from the interaction of the compound with the polypeptide.
A further preferred method for identifying an agonist or antagonist of a polypeptide of the invention comprises:
(a) contacting a cell expressing on the surface thereof the polypeptide, the polypeptide being associated with a second component capable of providing a detectable signal in response to the binding of a compound to the polypeptide, with a compound to be screened under conditions to permit binding to the polypeptide; and (b) determining whether the compound binds to and activates or inhibits the polypeptide by comparing the level of a signal generated from the interaction of the compound with the polypeptide with the level of a signal in the absence of the compound.
In further preferred embodiments, the general methods that are described above may further comprise conducting the identification of agonist or antagonist in the presence of labelled or unlabelled ligand for the polypeptide.
In another embodiment of the method for identifying an agonist or antagonist of a 5 polypeptide of the present invention comprises:
determining the inhibition of binding of a ligand to cells which have a polypeptide of the invention on the surface thereof, or to cell membranes containing such a polypeptide, in the presence of a candidate compound under conditions to permit binding to the polypeptide, and determining the amount of ligand bound to the polypeptide. A
compound to capable of causing reduction of binding of a ligand is considered to be an agonist or antagonist. Preferably the ligand is labelled.
More particularly, a method of screening for a polypeptide antagonist or agonist compound comprises the steps of:
(a) incubating a labelled ligand with a whole cell expressing a polypeptide according to the 15 invention on the cell surface, or a cell membrane containing a polypeptide of the invention, (b) measuring the amount of labelled ligand bound to the whole cell or the cell membrane;
(c) adding a candidate compound to a mixture of labelled ligand and the whole cell or the cell membrane of step (a) and allowing the mixture to attain equilibrium;
(d) measuring the amount of labelled ligand bomd to the whole cell or the cell membrane 2o after step (c); and (e) comparing the difference in the labelled ligand bound in step (b) and (d), such that the compound which causes the reduction in binding in step (d) is considered to be an agonist or antagonist.
In certain of the embodiments described above, simple binding assays may be used, in 25 which the adherence of a test compound to a surface bearing the polypeptide is detected by means of a label directly or indirectly associated with the test compound or in an assay involving competition with a labelled competitor. In another embodiment, competitive drug screening assays may be used, in which neutralising antibodies that are capable of binding the polypeptide specifically compete with a test compound for binding.
In this 3o manner, the antibodies can be used to detect the presence of any test compound that possesses specific binding affinity for the polypeptide.
Alternatively, if the wild type version of the polypeptide of the present invention (INSP058) normally binds to a receptor in nature, then in another aspect of the invention, the polypeptide of the present invention may be an antagonist of the wild type version of the polypeptide. An example of such a polypeptide is thought to be INSP058SV.
In this s aspect of the invention, the polypeptide of the present invention is able to compete with the INSP058 polypeptide for the same binding site on the receptor. The INSP058SV
polypeptide would not stimulate the receptor, so that the normal biological effect is not induced. The polypeptide of the present invention is therefore a competitive inhibitor of the natural polypeptide. Preferably, a competitive inhibitor according to this aspect of the 1 o invention comprises or consists of the amino acid sequence as recited in SEQ ID NO: I O or SEQ ID N0:16. The methods described above for screening antagonists can be readily adapted by a skilled person to screen for competitive inhibitors.
Assays may also be designed to detect the effect of added test compounds on the production of mRNA encoding the polypeptide in cells. For example, an ELISA
may be i s constructed that measures secreted or cell-associated levels of polypeptide using monoclonal or polyclonal antibodies by standard methods known in the art, and this can be used to search for compounds that may inhibit or enhance the production of the polypeptide from suitably manipulated cells or tissues. The formation of binding complexes between the polypeptide and the compound being tested may then be measured.
2o Assay methods that are also included within the terms of the present invention are those that involve the use. of the genes and polypeptides of the invention in overexpression or ablation assays. Such assays involve the manipulation of levels of these genes/polypeptides in cells and assessment of the impact of this manipulation event on the physiology of the manipulated cells. Fox example, such experiments reveal details of signalling and 25 metabolic pathways in which the particular genes/polypeptides are implicated, generate information regarding the identities of polypeptides with which the studied polypeptides interact and provide clues as to methods by which related genes and proteins are regulated.
Another technique for drug screening which may be used provides for high throughput screening of compounds having suitable binding affinity to the polypeptide of interest (see 3o International patent application W084/03564). In this method, large numbers of different small test compounds are synthesised on a solid substrate, which may then be reacted with the polypeptide of the invention and washed. One way of immobilising the polypeptide is to use non-neutralising antibodies. Bound polypeptide may then be detected using methods that are well known in the art. Purified polypeptide can also be coated directly onto plates for use in the aforementioned drug screening techniques.
The polypeptide of the invention may be used to identify membrane-bound or soluble receptors, through standard receptor binding techniques that are known in the art, such as ligand binding and crosslinking assays in which the polypeptide is labelled with a radioactive isotope, is chemically modified, or is fused to a peptide sequence that facilitates its detection or purification, and incubated with a source of the putative receptor (for example, a composition of cells, cell membranes, cell supernatants, tissue extracts, or 1 o bodily fluids). The efficacy of binding may be measured using biophysical techniques such as surface plasmon resonance (supplied by Biacore AB, Uppsala, Sweden) and spectroscopy. Binding assays may be used for the purification and cloning of the receptor, but may also identify agonists and antagonists of the polypeptide, that compete with the binding of the polypeptide to its receptor. Standard methods for conducting screening I5 assays are well understood in the ant.
The invention also includes a screening kit useful in the methods for identifying agonists, antagonists, ligands, receptors, substrates, enzymes, that are described above.
The invention includes the agonists, antagonists, ligands, receptors, substrates and enzymes, and other compounds which modulate the activity or antigenicity of the 2o polypeptide of the invention discovered by the methods that are described above.
The invention also provides pharmaceutical compositions comprising a polypeptide, nucleic acid, ligand or compound of the invention in combination with a suitable pharmaceutical carrier. These compositions may be suitable as therapeutic or diagnostic reagents, as vaccines, or as othex immunogenic compositions, as outlined in detail below.
25 According to the terminology used herein, a composition containing a polypeptide, nucleic acid, ligand or compound [X~ is "substantially free of impurities [herein, Y]
when at least 85% by weight of the total X+y in the composition is X. Preferably, X
comprises at least about 90% by weight ofthe total of X+y in the composition, more preferably at least about 95%, 98% or even 99% by weight.
3o The pharmaceutical compositions should preferably comprise a therapeutically effective amount of the polypeptide, nucleic acid molecule, ligand, or compound of the invention.
The term "therapeutically effective amount" as used herein refers to an amount of a therapeutic agent needed to treat, ameliorate, or prevent a targeted disease or condition, or to exhibit a detectable therapeutic or preventative effect. For any compound, the therapeutically effective dose can be estimated initially either in cell culture assays, for example, of neoplastic cells, or in animal models, usually mice, rabbits, dogs, or pigs. The animal model may also be used to determine the appropriate concentration range and route of administration. Such information can then be used to determine useful doses and routes for administration in humans.
The precise effective amount for a human subject will depend upon the severity of the to disease state, general health of the subject, age, weight, and gender of the subject, diet, time and frequency of administration, drug combination(s), reaction sensitivities, and tolerance/response to therapy. This amount can be determined by routine experimentation and is within the judgement of the clinician. Generally, an effective dose will be from 0.01 mg/kg to 50 mg/kg, preferably 0.05 mg/kg to 10 mg/kg. Compositions may be administered individually to a patient or may be administered in combination with other agents, drugs or hormones.
A pharmaceutical composition may also contain a pharmaceutically acceptable carrier, for administration of a therapeutic agent. Such carriers include antibodies and other polypeptides, genes and other therapeutic agents such as liposomes, provided that the 2o carrier does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity.
Suitable carriers may be large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers and inactive virus particles.
Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulphates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharnaceutically acceptable carriers is available in Remington's Pharnaceutical Sciences (Mack Pub. Co., N.J. 1991).
3o Pharnaceutically acceptable Garners in therapeutic compositions may additionally contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such compositions. Such carriers enable the pharmaceutical compositions to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, and the like, for ingestion by the patient.
Once formulated, the compositions of the invention can be administered directly to the subject. The subjects to be treated can be animals; in particular, human subjects can be treated.
The pharmaceutical compositions utilised in this invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, intraventricular, transdermal or transcutaneous 1 o applications (for example, see W098/20734), subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, intravaginal or rectal means. Gene guns or hyposprays may also be used to administer the pharmaceutical compositions of the invention.
Typically, the therapeutic compositions may be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared.
Direct delivery of the compositions will generally be accomplished by injection, subcutaneously, intraperitoneally, intravenously or intramuscularly, or delivered to the interstitial space of a tissue. The compositions can also be administered into a lesion.
Dosage treatment may be a single dose schedule or a multiple dose schedule.
2o If the activity of the polypeptide of the invention is in excess in a particular disease state, several approaches are available. One approach comprises administering to a subject an inhibitor compound (antagonist) as described above, along with a pharmaceutically acceptable carrier in an amount effective to inhibit the function of the polypeptide, such as by blocking the binding of ligands, substrates, enzymes, receptors, or by inhibiting a second signal, and thereby alleviating the abnormal condition. Preferably, such antagonists are antibodies. Most preferably, such antibodies are chimeric and/or humanised to minimise their immunogenicity, as described previously.
In another approach, soluble forms of the polypeptide that retain binding affinity for the ligand, substrate, enzyme, receptor, in question, may be administered.
Typically, the 3o polypeptide may be administered in the form of fragments that retain the relevant portions.
In an alternative approach, expression of the gene encoding the polypeptide can be inhibited using expression blocking techniques, such as the use of antisense nucleic acid molecules (as described above), either internally generated or separately administered.
Modifications of gene expression can be obtained by designing complementary sequences or antisense molecules (DNA, RNA, or PNA) to the control, 5' or regulatory regions 5 (signal sequence, promoters, enhancers and introns) of the gene encoding the polypeptide.
Similarly, inhibition can be achieved using "triple helix" base-pairing methodology. Triple helix pairing is useful because it causes inhibition of the ability of the double helix to open sufficiently for the binding of polymerases, transcription factors, or regulatory molecules.
Recent therapeutic advances using triplex DNA have been described in the literature (Gee, to J.E. et al., (1994) In: Huber, B.E. and B.I. Carr, Molecular and Immunologic Approaches, Futura Publishing Co., Mt. Kisco, NY). The complementary sequence or antisense molecule may also be designed to block translation of mRNA by preventing the transcript from binding to ribosomes. Such oligonucleotides may be administered or may be generated in situ from expression in vivo.
15 In addition, expression of the polypeptide of the invention may be prevented by using ribozymes specific to its encoding mRNA sequence. Ribozymes are catalytically active RNAs that can be natural or synthetic (see for example Usman, N, et al., Curr.
Opin.
Struct. Biol (1996) 6(4), 527-33). Synthetic ribozymes can be designed to specifically cleave mRNAs at selected positions thereby preventing translation of the mRNAs into 2o functional polypeptide. Ribozymes may be synthesised with a natural ribose phosphate backbone and natural bases, as normally found in RNA molecules. Alternatively the ribozymes may be synthesised with non-natural backbones, for example, 2'-O-methyl RNA, to provide protection from ribonuclease degradation and may contain modified bases.
25 RNA molecules may be modified to increase intracellular stability and half life. Possible modifications include, but are not limited to, the addition of flanking sequences at the 5' and/or 3' ends of the molecule or the use of phosphorothioate or 2' O-methyl rather than phosphodiesterase linkages within the backbone of the molecule. This concept is inherent in the production of PNAs and can be extended in all of these molecules by the inclusion 30 of non-traditional bases such as inosine, queosine and butosine, as well as acetyl-, methyl-, thio- and similarly modified forms of adenine, cytidine, guanine, thymine and uridine which are not as easily recognised by endogenous endonucleases.
For treating abnormal conditions related to an under-expression of the polypeptide of the invention and its activity, several approaches are also available. One approach comprises administering to a subject a therapeutically effective amount of a compound that activates the polypeptide, i.e., an agonist as described above, to alleviate the abnormal condition.
s Alternatively, a therapeutic amount of the polypeptide in combination with a suitable pharmaceutical carrier may be administered to restore the relevant physiological balance of polypeptide.
Gene therapy may be employed to effect the endogenous production of the polypeptide by the relevant cells in the subject. Gene therapy is used to treat permanently the inappropriate to production of the polypeptide by replacing a defective gene with a corrected therapeutic gene.
Gene therapy of the present invention can occur iya vivo or ex vivo. Ex vivo gene therapy requires the isolation and purification of patient cells, the introduction of a therapeutic gene and introduction of the genetically altered cells back into the patient.
In contrast, ih 15 vivo gene therapy does not require isolation and purification of a patient's cells.
The therapeutic gene is typically "packaged" for administration to a patient.
Gene delivery vehicles may be non-viral, such as liposomes, or replication-deficient viruses, such as adenovirus as described by Berkner, K.L., in Curr. Top. Microbiol. Immunol., 15~, 39-66 (1992) or adeno-associated virus (AAV) vectors as described by Muzyczka, N., in Curr.
2o Top. Microbiol. Immunol., 158, 97-129 (1992) and U.S. Patent No. 5,252,479.
For example, a nucleic acid molecule encoding a polypeptide of the invention may be engineered for expression in a replication-defective retroviral vector. This expression construct may then be isolated and introduced into a packaging cell transduced with a retroviral plasmid vector containing RNA encoding the polypeptide, such that the 25 packaging cell now produces infectious viral particles containing the gene of interest.
These producer cells may be administered to a subject for engineering cells in vivo and expression of the polypeptide ijz vivo (see Chapter 20, Gene Therapy and other Molecular Genetic-based Therapeutic Approaches, (and references cited therein) in Human Molecular Genetics (1996), T Strachan and A P Read, BIOS Scientific Publishers Ltd).
3o Another approach is the administration of "naked DNA" in which the therapeutic gene is directly injected into the bloodstream or muscle tissue.
In situations in which the polypeptides or nucleic acid molecules of the invention are disease causing agents, the invention provides that they can be used in vaccines to raise antibodies against the disease-causing agent.
Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat disease after infection). Such vaccines comprise immunising antigen(s), irmmnogen(s), polypeptide(s), proteins) or nucleic acid, usually in combination with pharmaceutically-acceptable carriers as described above, which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition. Additionally, these carriers may function as immunostimulating agents ("adjuvants"). Furthermore, the antigen or immunogen may be conjugated to a 1 o bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H.
pylori, and other pathogens.
Since polypeptides may be broken down in the stomach, vaccines comprising polypeptides are preferably administered parenterally (for instance, subcutaneous, intramuscular, intravenous, or intradermal injection). Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the recipient, and aqueous and non-aqueous sterile suspensions which may include suspending agents or thickening agents.
The vaccine formulations of the invention may be presented in unit-dose or multi-dose 2o containers. For example, sealed ampoules and vials and may be stored in a freeze-dried condition requiring only the addition of the sterile liquid carrier immediately prior to use.
The dosage will depend on the specific activity of the vaccine and can be readily determined by routine experimentation.
Genetic delivery of antibodies that bind to polypeptides according to the invention may also be effected, for example, as described in International paten application W098/55607.
The technology referred to as jet injection (see, for example, www.powderject.com) may also be useful in the formulation of vaccine compositions.
A number of suitable methods for vaccination and vaccine delivery systems are described in International patent application WO00/29428.
3o This invention also relates to the use of nucleic acid molecules according to the present invention as diagnostic reagents. Detection of a mutated form of the gene characterised by the nucleic acid molecules of the invention which is associated with a dysfunction will provide a diagnostic tool that can add to, or define, a diagnosis of a disease, or susceptibility to a disease, which results from under-expression, over-expression or altered spatial or temporal expression of the gene. Individuals carrying mutations in the gene may be detected at the DNA level by a variety of techniques.
Nucleic acid molecules for diagnosis may be obtained from a subject's cells, such as from blood, urine, saliva, tissue biopsy or autopsy material. The genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR, ligase chain reaction (LCR), strand displacement amplification (SDA), or other amplification to techniques (see Saiki et al., Nature, 324, 163-166 (1986); Bej, et al., Crit. Rev. Biochem.
Molec. Biol., 26, 301-334 (1991); Birkenmeyer et al., J. Virol. Meth., 35, 117-126 (1991);
Van Brunt, J., Bio/Technology, 8, 291-294 (1990)) prior to analysis.
In one embodiment, this aspect of the invention provides a method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide according to the invention and comparing said level of expression to a control level, wherein a level that is different to said control level is indicative of disease. The method may comprise the steps of:
a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid 2o molecule of the invention and the probe;
b) contacting a control sample with said probe under the same conditions used in step a);
c) and detecting the presence of hybrid complexes in said samples;
wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease.
A further aspect of the invention comprises a diagnostic method comprising the steps of:
a) obtaining a tissue sample from a patient being tested for disease;
b) isolating a nucleic acid molecule according to the invention from said tissue sample; and c) diagnosing the patient for disease by detecting the presence of a mutation in the nucleic acid molecule which is associated with disease.
3o To aid the detection of nucleic acid molecules in the above-described methods, an amplification step, for example using PCR, may be included.
Deletions and insertions can be detected by a change in the size of the amplified product in comparison to the normal genotype. Point mutations can be identified by hybridizing amplified DNA to labelled RNA of the invention or alternatively, labelled antisense DNA
sequences of the invention. Perfectly-matched sequences can be distinguished from mismatched duplexes by RNase digestion or by assessing differences in melting temperatures. The presence or absence of the mutation in the patient may be detected by contacting DNA with a nucleic acid probe that hybridises to the DNA under stringent conditions to form a hybrid double-stranded molecule, the hybrid double-stranded l0 molecule having an unhybridised portion of the nucleic acid probe strand at any portion corresponding to a mutation associated with disease; and detecting the presence or absence of an unhybridised portion of the probe strand as an indication of the presence or absence of a disease-associated mutation in the corresponding portion of the DNA
strand.
Such diagnostics are particularly useful for prenatal and even neonatal testing.
Point mutations and other sequence differences between the reference gene and "mutant"
genes can be identified by other well-known techniques, such as direct DNA
sequencing or single-strand conformational polymorphisriz, (see Orita et al., Genomics, 5, (1989)). For example, a sequencing primer may be used with double-stranded PCR
product or a single-stranded template molecule generated by a modified PCR. The sequence determination is performed by conventional procedures with radiolabelled nucleotides or by automatic sequencing procedures with fluorescent-tags. Cloned DNA segments may also be used as probes to detect specific DNA segments. The sensitivity of this method is greatly enhanced when combined with PCR. Further, point mutations and other sequence variations, such as polymorphisms, can be detected as described above, for example, through the use of allele-specific oligonucleotides for PCR amplification of sequences that differ by single nucleotides.
DNA sequence differences may also be detected by alterations in the electrophoretic mobility of DNA fragments in gels, with or without denaturing agents, or by direct DNA
sequencing (for example, Myers et al., Science (1985) 230:1242). Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and Sl protection or the chemical cleavage method (see Cotton et al., Proc. Natl.
Acad. Sci.
USA (1985) 85: 4397-4401).
In addition to conventional gel electrophoresis and DNA sequencing, mutations such as microdeletions, aneuploidies, translocations, inversions, can also be detected by in situ analysis (see, for example, I~eller et al., DNA Probes, 2nd Ed., Stockton Press, New York, N.Y., USA (1993)), that is, DNA or RNA sequences in cells can be analysed for mutations 5 without need for their isolation and/or immobilisation onto a membrane.
Fluorescence ih situ hybridization (FISH) is presently the most commonly applied method and numerous reviews of FISH have appeared (see, for example, Trachuck et al., Science, 250, 559-562 (1990), and Trask et al., Trends, Genet., 7, 149-154 (1991)).
In another embodiment of the invention, an array of oligonucleotide probes comprising a 1 o nucleic acid molecule according to the invention can be constructed to conduct efficient screening of genetic variants, mutations and polymorphisms. Array technology methods are well known and have general applicability and can be used to address a variety of questions in molecular genetics including gene expression, genetic linkage, and genetic variability (see for example: M.Chee et al., Science (1996), Vol 274, pp 610-613).
15 In one embodiment, the array is prepared and used according to the methods described in PCT application W095/11995 (Chee et al.); Lockhart, D. J. et al., (1996) Nat.
Biotech. 14:
1675-1680; and Schena, M. et al., (1996) Proc. Natl. Acad. Sci. 93:10614-10619).
Oligonucleotide pairs may range from two to over one million. The oligomers are synthesized at designated areas on a substrate using a light-directed chemical process. The 2o substrate may be paper, nylon or other type of membrane, filter, chip, glass slide or any other suitable solid support. In another aspect, an oligonucleotide may be synthesized on the surface of the substrate by using a chemical coupling procedure and an ink jet application apparatus, as described in PCT application W095/25116 (Baldeschweiler et al.). In another aspect, a "gridded" array analogous to a dot (or slot) blot may be used to 25 arrange and link cDNA fragments or oligonucleotides to the surface of a substrate using a vacuum system, thermal, UV, mechanical or chemical bonding procedures. An array, such as those described above, may be produced by hand or by using available devices (slot blot or dot blot apparatus), materials (any suitable solid support), and machines (including robotic instruments), and may contain 8, 24, 96, 384, 1536 or 6144 oligonucleotides, or 3o any other number between two and over one million which lends itself to the efficient use of commercially-available instrumentation.
In addition to the methods discussed above, diseases may be diagnosed by methods comprising determining, from a sample derived from a subject, an abnormally decreased or increased level of polypeptide or mRNA. Decreased or increased expression can be measured at the RNA level using any of the methods well known in the art for the quantitation of polynucleotides, such as, for example, nucleic acid amplification, for instance PCR, RT-PCR, RNase protection, Northern blotting and other hybridization methods.
Assay techniques that can be used to determine levels of a polypeptide of the present invention in a sample derived from a host are well-known to those of skill in the art and are discussed in some detail above (including radioimmunoassays, competitive-binding assays, to Western Blot analysis and ELISA assays). This aspect of the invention provides a diagnostic method which comprises the steps of: (a) contacting a ligand as described above with a biological sample under conditions suitable for the formation of a ligand-polypeptide complex; and (b) detecting said complex.
Protocols such as ELISA (as previously described), RIA, and FACS for measuring polypeptide levels may additionally provide a basis for diagnosing altered or abnormal levels of polypeptide expression. Normal or standard values for polypeptide expression are established by combining body fluids or cell extracts taken from normal mammalian subjects, preferably humans, with antibody to the polypeptide under conditions suitable for complex formation. The amount of standard complex formation may be quantified by 2o various methods, such as by photometric means.
Antibodies which specifically bind to a polypeptide of the invention may be used for the diagnosis of conditions or diseases characterised by expression of the polypeptide, or in assays to monitor patients being treated with the polypeptides, nucleic acid molecules, ligands and other compounds of the invention. Antibodies useful for diagnostic purposes may be prepared in the same manner as those described above for therapeutics.
Diagnostic assays for the polypeptide include methods that utilise the antibody and a label to detect the polypeptide in human body fluids or extracts of cells or tissues. The antibodies may be used with or without modification, and may be labelled by joining them, either covalently or non-covalently, with a reporter molecule. A wide variety of reporter molecules known 3o in the art may be used, several of which are described above.
Quantities of polypeptide expressed in subject, control and disease samples from biopsied tissues are compared with the standard values. Deviation between standard and subject values establishes the parameters for diagnosing disease. Diagnostic assays may be used to distinguish between absence, presence, and excess expression of polypeptide and to monitor regulation of polypeptide levels during therapeutic intervention. Such assays may also be used to evaluate the efficacy of a particular therapeutic treatment regimen in animal studies, in clinical trials or in monitoring the treatment of an individual patient.
A diagnostic kit of the present invention may comprise:
(a) a nucleic acid molecule of the present invention;
(b) a polypeptide of the present invention; or (c) a ligand of the present invention.
to In one aspect of the invention, a diagnostic kit may comprise a first container containing a nucleic acid probe that hybridises under stringent conditions with a nucleic acid molecule according to the invention; a second container containing primers useful for amplifying the nucleic acid molecule; and instructions for using the probe and primers for facilitating the diagnosis of disease. The kit may further comprise a third container holding an agent for digesting unhybridised RNA.
In an alternative aspect of the invention, a diagnostic kit may comprise an array of nucleic acid molecules, at least one of which may be a nucleic acid molecule according to the invention.
To detect polypeptide according to the invention, a diagnostic kit may comprise one or 2o more antibodies that bind to a polypeptide according to the invention; and a reagent useful for the detection of a binding reaction between the antibody and the polypeptide.
Such kits will be of use in diagnosing a disease or susceptibility to disease, such as cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours; myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma; autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection; cardiovascular disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia;
neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C 1 q family proteins.
Various aspects and embodiments of the present invention will now be described in more detail by way of example, with particular reference to the INSP058 polypeptide.
It will be appreciated that modification of detail may be made without departing from the scope of the invention.
Brief description of the Figures l0 Figure 1: Top ten results from BLAST against the NCBI non-redundant database using SEQ
ID N0:8 (INSP058 polypeptide sequence).
Figure 2: Alignment generated by BLAST between SEQ ID N0:8 (INSP058 polypeptide sequence) and the closest related sequence, otolin-1 from Onco~hyhchus keta..
Figure 3: Top 20 results from Genome Threader using SEQ ID NO:B (INSP058 polypeptide sequence). The PDB codes for the top three results refer to the following protein structures: 1 c28 chains A, C and B. The crystal structure of a complement-1 q family protein suggests an evolutionary link to tumor necrosis factor.
Figure 4: Structural alignment generated by Genome Threader between SEQ ID
N0:8 (INSP058 polypeptide sequence) and the top PDB structure in Figure 3 (1c28).
2o Figure SA: SignaIP-NN prediction of the signal peptide present in the polypeptide sequence (SEQ ID N0:8).
Figure SB: SignalP-HMM prediction of the signal peptide present in the INSP058 polypeptide sequence (SEQ ID N0:8).
Figure 6: Predicted nucleotide sequence of INSP058 with translation.
Figure 7: Nucleotide sequence with translation of PCR product cloned using primers INSP058-CPland INSP058-CP2.
Figure 8: Map of pCRII-TOPO-INSP058SV.
Figure 9: Alignment of cloned nucleotide sequence of INSP058 (INSP058SV) with predicted INSP058 sequence.
Figure 10: Alignment of INSP058 predicted amino acid sequence with amino acid sequence of cloned INSP058SV.
Figure 11: Map of expression vector pEAKl2d Figure 12: Map of Gateway vector pDONR20I
Figure 13: Map ofpEAKl2d-INSPOSBSV-6HIS
EXAMPLES
Example l: INSP058 SEQ ID N0:8 was used as a BLAST query against the NCBI non-xedundant Sequence to database. The closest match to the query sequence is for otolin-1 from OncorlZynchus keta (Figure 1). Figure 2 shows the alignment of the INSP058 query sequence to the sequence of otolin-1 from Oucorynchus keta. Figure 3 shows the top 20 results from Genome Threader using SEQ ID N0:8 (INSP058 polypeptide sequence). The PDB codes for the top three results refex to the following protein structuxes: 1c28 chains A, C and B. The crystal structure of a complement-1 q family protein suggests an evolutionary link to tumor necrosis factor. Figure 4 shows the structural alignment generated by Genome Threader between SEQ ID N0:8 (INSP058 polypeptide sequence) and the top PDB structure in Figure 3 (1c28).
The 1NSPOSB polypeptide sequence (SEQ ID N0:8) was subjected to analysis using SignalP
2o v2.0 (as described on the www.cbs.dtu.dk/services/SignaIP-2.0 website), a program that predicts the presence and location of signal peptide cleavage sites in amino acid sequences from different organisms. SignaIP v2.0 comprises two signal peptide prediction methods, SignaIP-NN (based on neural networks) and SignalP-HMM (based on hidden Markov models). The SignaIP results for INSP058 polypeptide sequence (SEQ ID N0:8) are shown as Figures SA and SB. Figure SA and SB show that the most likely cleavage site for INSP058 polypeptide sequence (SEQ ID N0:8) falls between positions 15 and 16.
Example 2:INSP058 splice variant 1.1 cDNA libraries Human cDNA libraries (in bacteriophage lambda (~,) vectors) were purchased from Stratagene or Clontech or prepared at the Serono Pharmaceutical Research Institute in ~, 5 ZAP or ~. GT10 vectors according to the manufacturer's protocol (Stratagene).
Bacteriophage ~, DNA was prepared from small scale cultures of infected E.coli host strain using the Wizard Lambda Preps DNA purification system according to the manufacturer's instructions (Promega, Corporation, Madison WL) The list of libraries and host strains used is shown in Table 1. Seven pools representing 26 different libraries (100 ng/~l phage to DNA) or phage DNA from individual libraries were used in subsequent PCR
reactions.
Library Tissue/cell source Vector Host strainSupplierCat.
no.
human substantia nigra GT10 LE392 in house human fetal brain GT10 LE392 in house human cortex brain GT10 LE392 in house human colon GT10 LE392 ClontechHL1034a human fetal lung GT10 LE392 ClontechHL1072a ~2 human fetal kidney GT10 LE392 ClontechHL1071a 14 human bone marrow GT10 LE392 ClontechHL1058a human U373 cell line GT10 LE392 in house human CFPoc-1 cell line Uni Zap XL1-Blue Stratagene936206 MRF' 2o human retina GT10 LE392 ClontechHL1132a 21 human urinary bladder GT10 LE392 in house 22 human platelets Uni Zap XL1-Blue in house MRF' 23 human neuroblastoma ICanGT10 LE392 in house + TS
24 human bronchial smooth GT10 LE392 in house muscle 25 human bronchial smooth GT10 LE392 in house muscle 26 human Thymus GT10 LE392 ClontechHL1127a 27 human spleen 5' stretch GT11 LE392 ClontechHL1134b 2$ human peripheral blood GT10 LE392 ClontechHL1050a monocytes 29 human tesfis GT10 LE392 ClontechHL1065a 3o human fetal brain GT10 LE392 ClontechHL1065a 3~ human substantia nigra GT10 LE392 ClontechHL1093a 32 human placenta#11 GT11 LE392 ClontechHL1075b 33 human Fetal brain GT10 LE392 Clontechcustom 34 human placenta #59 GT10 LE392 ClontechHL5014a 35 human pituitary GT10 LE392 ClontechHL1097a 36 human pancreas #63 Uni Zap XL1-Blue Stratagene937208 XR MRF' Table 1 Hufnafz cDNA libraries 1. 2 PCR of virtual cDNAs frofn phage libraf y DNA
Gene-specific PCR amplification primers (INSP058-CPl and INSP058-CP2, Figure 6 and Table 2) were designed to amplify a 990 by product expected to contain almost the full predicted coding sequence of INSP058. These were used in PCR on the phage eDNA
library pools shown in Table 1. The PCR was performed in a final volume of 50 ~.1 containing 1X AmpliTaqTM buffer, 200 ~,M dNTPs, 50 pmoles each of cloning primers, 2.5 units of AmpliTaq~M (Perkin Elmer) and 100 ng of each phage library pool DNA
using an MJ Research DNA Engine, programmed as follows: 40 cycles at 94 °C for 1 min and 72 °C for 1 min; followed by 1 cycle at 72 °C for 7 min and a holding cycle at 4 °C.
Primer Sequence (5'-3') GCP Forward G
GGG
ACA
AGT
TTG
TAC
AAA
AAA
GCA
GGC
TTC
_GCC
ACC
GCP Reverse GGGGAC CACTTTGTA CAAGAA AGC TGG GTT TCA
GTGATG GTGATGGTG ATG
CTTGCC ATT CTG
CCTGAA CA ACA
pEAKl2-F GCCAGC TTGGCACTT GATGT
pEAKl2-R GATGGA GGTGGACGT GTCAG
Sp6 ATTTAG GTGACACTA TAG
TAC
Table 2 lN~f USc~ cloning and sequencing prirnef-s unaernnea sequence - riUGaX
~GHuG114G, Bold = Stop codon and Italic sequence= HIS tag The amplification products were visualized on 0.8 % agarose gels in 1 X TAE
buffer (Invitrogen) and were purified from the gel using the Wizard PCR Preps DNA
Purification System (Promega). PCR products eluted in 50 ~l of sterile water were either subcloned directly or stored at 20 C.
1.3 Gene specific cloning primers fog PCR
A pair of PCR primers having a length of between 18 and 25 bases were designed for amplifying a partial sequence of TNSP058 cDNA using Primer Designer Software (Scientific ~ Educational Software, PO Box 72045, Durham, NC 27722-2045, USA).
PCR
primers were optimized to have a Tm close to 55 + 10 °C and a GC
content of 40-60%.
2o Primers were selected which had high selectivity for the target sequence INSP058 (little or no none specific priming). INSP058-CP1 lacks the first 8 by of the INSP058 predicted coding sequence due to optimization of the PCR primer design.
1.4 Subcloning ofPCR Py~oducts PCR products were subcloned into the topoisomerase I modified cloning vector (pCRII
TOPO) using the TA cloning kit purchased from the Invitrogen Corporation using the conditions specified by the manufacturer. Briefly, 4 ~l of gel purified PCR
product from the human library pool P amplification was incubated for 15 min at room temperature with 1 ~l of TOPO vector and 1 ~.~1 salt solution. The reaction mixture was then transformed into E. coli strain TOP10 (Invitrogen) as follows: a 50 p,l aliquot of One Shot TOPIO cells was thawed on ice and 2 ~,l of TOPO reaction was added. The mixture was incubated for 15 min on ice and then heat shocked by incubation at 42 °C for exactly 30 s. Samples were to returned to ice and 250 ~,1 of warm SOC media (room temperature) was added.
Samples were incubated with shaking (220 rpm) for 1 h at 37 °C. The transformation mixture was then plated on L-broth (LB) plates containing ampicillin (100 ~.g/ml) and incubated overnight at 37 °C.
1.5 Selection of an~plicillih resistant colonies A number of ampicillin resistant colonies were selected and the cells stabbed into individual wells of a 96 well plate each containing L-broth containing ampicillin (100 pg/ml).
1. 6 Plasrnid DNA preparation and Sequev~cing Miniprep plasmid DNA was prepared from the stab culture's and subjected to DNA
2o sequencing with T7 primer at GATC Biotech AG (Jakob-Stadler-Platz 7, D-Konstanz). The sequence of the cloned cDNA fragment is shown in figure 7.
2. Idefztificatiou of cDNA librar~iesltenzplates co~ctai~cirzg INSPOS8Sv PCR products obtained with INSP058-CPl and INSP058-CP2 and migrating at 453 bp, a smaller size than expected, were identified in ~, cDNA library Pool P (human thymus, spleen, peripherial blood monocytes, and testis). The plasmid map of the cloned PCR
product (pCRII-TOPO-INSP058) (plasmid ID number 12917) is shown in Figure 8.
The cloned sequence lacks the first 8 by of the INSP058 predicted coding sequence but is otherwise identical to the predicted INSP058 sequence up to nucleotide position 267 where it diverges from the prediction due to a 538 by deletion (Figure 9).
Translation of the longest ORF (including the 8 by missing at the 5' end) yields a protein of 99 amino acids of which amino acids 1-89 are identical to the INSP058 prediction (Figure 11).
The cloned sequence therefore corresponds to a short splice variant of INSP058 (called INSP058SV).
3. Cofzstructiou ofplasryzids for expression of INSP058SV ih HEK293/EBNA
cells.
A pCRII-TOPO clone containing the coding sequence (ORF) of INSP058SV
identified by DNA sequencing (Figure 7) was then used to subclone the insert into the mammalian cell expression vector pEAKl2d (figure 11) using the GatewayTM cloning methodology (Invitrogen).
3.1 Gene~atiofz of Gateway compatible INSP058SV ORF fused to afz i~ frame 6HIS
tag sequence to The first stage of the Gateway cloning process involves a two step PCR
reaction which generates the ORF of INSP058SV flanked at the 5' end by an attBl recombination site and Kozak sequence, and flanked at the 3' end by a sequence encoding an in frame 6 histidine (6HIS) tag, a stop codon and the attB2 recombination site (Gateway compatible cDNA).
The first PCR reaction (in a final volume of 50 ~,l) contains: 1.5 ~,1 (approx. 25 ng) of pCR
II TOPO-INSP058SV (plasmid 12917 and Figure 8), 1.5 ~l dNTPs (10 mM), 5~1 of lOX
Pfx polymerase buffer, 1 ~l MgS04 (50 mM), 0.5 ~l each of gene specific primer (100 ~,M) (INSP058-EXl forward and INSP058-EX2 reverse) and 0.5 ~,l Platinum Pfx DNA
polymerase (Invitrogen). The PCR reaction was performed using an initial denaturing step of 95°C for 1 min, followed by 10 cycles of 94 °C for 15 s; 55 °C for 30 s and 68°C for 2 2o min; and a holding cycle of 4 °C. PCR products were purified directly from the reaction mixture using the Wizard PCR prep DNA purification system (Promega) according to the manufacturer's instructions. The second PCR reaction (in a final volume of 50 ~.l) contained 10 ~.l purified PCR product, 1.5 ~,l dNTPs (10 mM), 5 ~,l of lOX Pfx polymerase buffer, 1 ~,l MgS04 (50 mM), 0.5 yl of each Gateway conversion primer (100 ~.M) (GCP
forward and GCP reverse) and 0.5 ~,l of Platinum Pfx DNA polymerase. The conditions for the 2nd PCR reaction were: 95 °C for 1 min; 4 cycles of 94 °C, 15 sec; 50 °C, 30 sec and 68 °C for 2 min; 25 cycles of 94 °C, 15 sec; 55 °C , 30 sec and 68 °C, 2 min; followed by a holding cycle of 4 °C. PCR products were purified as described above.
3.2 Subclofzihg of Gateway compatible INSP058ST1 ORF into Gateway erztyy vector 3o pDONR201 and expression vector pEAI~l2d The second stage of the Gateway cloning process involves subcloning of the Gateway modified PCR product into the Gateway entry vector pDONR20I (Invitrogen, figure I2) as follows: 5 pl of purified PCR product is incubated with 1.5 ~l pDONR201 vector (0.1 q,g/~.1), 2 ~1 BP buffer and 1.5 ~l of BP clonase enzyme mix (Invitrogen) at RT for 1 h.
The reaction was stopped by addition of proteinase K (2 p,g) and incubated at 37°C for a further 10 min. An aliquot of this reaction (2 ~.1) was transformed into E.
coli DH10B
cells by electroporation using a Biorad Gene Pulser. Transformants were plated on LB-kanamycin plates. Plasmid mini-prep DNA was prepared from 1-4 of the resultant colonies using Wizard Plus SV Minipreps kit (Promega), and 1.5 p.l of the plasmid eluate to was then used in a recombination reaction containing 1.5 ~,l pEAKl2d vector (figure 9) (0.1 ~g / ~,I), 2 ~.1 LR buffer and 1.5 ~.l of LR clonase (Invitrogen) in a final volume of 10 p.l. The mixture was incubated at RT for 1 h, stopped by addition of proteinase K (2 fig) and incubated at 37°C for a further 10 min. An aliquot of this reaction (1 ~.1) was used to transform E. coli DHlOB cells by electroporation.
Clones containing the correct insert were identified by performing colony PCR
as described above except that pEAKl2d primers (pEAKl2d F and pEAKl2d R) were used for the PCR. Plasmid mini prep DNA was isolated from clones containing the correct insert using a Qiaprep Turbo 9600 robotic system (Qiagen) or manually using a Wizard Plus SV minipreps kit (Promega) and sequence verified using the pEAKl2d F and 2o pEAKl2d R primers.
CsC1 gradient purified maxi-prep DNA of plasmid pEAKl2d-INSP058SV-6HIS
(plasmid ID number 13081, Figure 13) was prepared from a 500 ml culture of sequence verified clones (Sambrook J. et al., in Molecular Cloning, a Laboratory Manual, 2nd edition, 1989, Cold Spring Harbor Laboratory Press), resuspended at a concentration of 1 ~,g/~,l in sterile water and stored at -20 C.
In addition, further experiments may now be performed using the pEAKl2d-6HIS expression vector. Transfection of mammalian cell lines with this vector may enable the high level expression of the INSP058SV protein and thus enable the continued investigation of the functional characteristics of the INSP058SV polypeptides.
The 3o following material and methods are an example of those suitable in such experiments:
Cell Culture Human Embryonic Kidney 293 cells expressing the Epstein-Barr virus Nuclear Antigen (HEK293-EBNA, Invitrogen) are maintained in suspension in Ex-cell VPRO serum-free medium (seed stock, maintenance medium, JRH). Sixteen to 20 hours prior to transfection (Day-1), cells are seeded in 2x T225 flasks (50 ml per flask in DMEM / F12 (l:l) 5 containing 2% FBS seeding medium (JRH) at a density of 2x105 cells/ ml). The next day (transfection day 0) transfection takes place using the JetPEITM reagent (2p1/~g of plasmid DNA, PolyPlus-transfection). For each flask, plasmid DNA is co-transfected with GFP
(fluorescent reporter gene) DNA. The transfection mix is then added to the 2xT225 flasks and incubated at 37°C (5%C02) for 6 days. Confirmation of positive transfection may be to carried out by qualitative fluorescence examination at day 1 and day 6 (Axiovert 10 Zeiss).
On day 6 (harvest day), supernatants from the two flasks are pooled and centrifuged (e.g.
4°C, 400g) and placed into a pot bearing a unique identifier. One aliquot (500 pl) is kept for QC of the 6His-tagged protein (internal bioprocessing QC).
Scale-up batches may be produced by following the protocol called "PEI
transfection of 15 suspension cells", referenced BP/PEI/HH/02/04, with PolyEthyleneImine from Polysciences as transfection agent.
Purification process The culture medium sample containing the recombinant protein with a C-terminal 6His tag is diluted with cold buffer A (50 mM NaH2P04; 600 mM NaCl; 8.7 % (wlv) glycerol, pH
20 7.5). The sample is filtered then through a sterile filter (Millipore) and kept at 4°C in a sterile square media bottle (Nalgene).
The purification is performed at 4°C on the VISION workstation (Applied Biosystems) connected to an automatic sample loader (Labomatic). The purification procedure is composed of two sequential steps, metal affinity chromatography on a Poros 20 MC
25 (Applied Biosystems) column charged with Ni ions (4.6 x 50 mm, 0.83 ml), followed by gel filtration on a Sephadex G-25 medium (Amersham Pharmacia) column (1,0 x 10 cm).
For the first chromatography step the metal affinity column is regenerated with 30 column volumes of EDTA solution (100 mM EDTA; 1 M NaCI; pH 8.0), recharged with Ni ions through washing with 15 column volumes of a 100 mM NiS04 solution, washed with 3o column volumes of buffer A, followed by 7 column volumes of buffer B (50 mM
NaH2P04; 600 mM NaCl; 8.7 % (w/v) glycerol, 400 mM; imidazole, pH 7.5), and finally equilibrated with 15 column volumes of buffer A containing 15 mM imidazole.
The sample is transferred, by the Labomatic sample loader, into a 200 ml sample loop and subsequently charged onto the Ni metal affinity column at a flow rate of 10 ml/min. The column is washed with 12 column volumes of buffer A, followed by 28 column volumes of buffer A containing 20 mM imidazole. During the 20 mM imidazole wash loosely attached contaminating proteins are eluted from the column. The recombinant His-tagged protein is finally eluted with 10 column volumes of buffer B at a flow rate of 2 ml/min, and the eluted protein is collected.
For the second chromatography step, the Sephadex G-25 gel-filtration column is 1o regenerated with 2 ml of buffer D (1.137 M NaCI; 2.7 mM KCI; 1.5 mM KH2P04;
8 mM
NaZHP04; pH 7.2), and subsequently equilibrated with 4 column volumes of buffer C (137 mM NaCI; 2.7 mM KCI; 1.5 mM KH2P04; 8 mM Na2HP04; 20 % (w/v) glycerol; pH
7.4).
The peak fraction eluted from the Ni-column is automatically loaded onto the Sephadex G-25 column through the integrated sample loader on the VISION and the protein is eluted with buffer C at a flow rate of 2 ml/min. The fraction was filtered through a sterile centrifugation filter (Millipore), frozen and stored at -80°C. An aliquot of the sample is analyzed on SDS-PAGE (4-12% NuPAGE gel; Novex) Western blot with anti-His antibodies. The NuPAGE gel may be stained in a 0.1 % coomassie blue 8250 staining solution (30 % methanol, 10 % acetic acid) at room temperature for 1 h and subsequently 2o destained in 20 % methanol, 7.5 % acetic acid until the background is clear and the protein bands clearly visible.
Following the electrophoresis the proteins are electrotransferred from the gel to a nitrocellulose membrane. The membrane is blocked with 5 % milk powder in buffer E
(137 mM NaCI; 2.7 mM KCI; 1.5 mM KHZPO4; 8 mM Na2HP04; 0.1 % Tween 20, pH
7.4) for 1 h at room temperature, and subsequently incubated with a mixture of 2 rabbit polyclonal anti-His antibodies (G-18 and H-15, 0.2ug/ml each; Santa Cruz) in 2.5 % milk powder in buffer E overnight at 4°C. After a further 1 hour incubation at room temperature, the membrane is washed with buffer E (3 x 10 min), and then incubated with a secondary HRP-conjugated anti-rabbit antibody (DAKO, HRP 0399) diluted 1/3000 in 3o buffer E containing 2.5 % milk powder for 2 hours at room temperature.
After washing with buffer E (3 x 10 minutes), the membrane is developed with the ECL kit (Amersham Pharmacia) for 1 min. The membrane is subsequently exposed to a Hyperfilm (Amersham Pharmacia), the film developed and the western blot image visually analysed.
For samples that showed detectable protein bands by Coomassie staining, the protein concentration may be determined using the BCA protein assay kit (Pierce) with bovine serum albumin as standard.
Furthermore, overexpression or knock-down of the expression of INSP058SV
polypeptides in cell lines may be used to determine the effect on transcriptional activation of the host cell genome. Dimerisation partners, co-activators and co-repressors of the INSP058SV polypeptides may be identified by immunoprecipitation combined with Western blotting and immunoprecipitation combined with mass spectroscopy.
SEQUENCE LISTING:
SEQ ID NO: 1 (INSP058 nucleotide sequence exon 1) IO
SEQ ID N0: 2 (INSP058 protein sequence exon 1) SEQ ID NO: 3 (INSP058 nucleotide sequence exon 2) SEQ ID NO: 4 (INSP058 protein sequence exon 2) 1 EPGRPGSPGK DGTSGEF<GER G
SEQ ID NO:
5 (INSP058 nucleotide sequence exon 3) SEQ ID N0: 6 (INSP058 protein sequence exon 3) SEQ ID N0: nucleotidesequence) 7 (INSP058 full SEQ ID N0: 8 (1NSP058 full protein sequence) SEQ ID NO: 9 (INSP058SV full nucleotide sequence) ATGAGGATCTGGTGGCTTCTGCTTGCCATTGAAATCTGCACAGGGAACATAAACTCACAGGACACCTGCAGGC
AAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGCCTGGAAGAGATGGACGAGACGGAGCGAA
GGGTGACAAAGGCGATGCAGGAGAACCAGGATGTCCTGGCAGCCCGGGGAAGGATGGGACGAGTGGAGAGAAG
GGAGAACGAGGAGCAGATGGAAAAGTTGAAGCAAAAGGCATCAAAGGAATGTTCAGGTGTCTTTGGTCAAAAA
CGGAGTAA
SEQ ID N0: 10 (INSP058SV full protein sequence) GERGADGKVEAKGIKGMFRCLWSKTE
SEQ ID N0: 11 (mature INSP058 and INSP058SV nucleotide sequence exon 1) AACATAAACTCACAGGACACCTGCAGGCAAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGC
CTGGAAGAGATGGACGAGACGGAGCGAAGGGTGACAAAGGCGATGCAG
SEQ ID N0: 12 (mature INSP058 and INSP058SV protein sequence exon 1) NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAG
SEQ ID N0: 13 (mature INSP058 nucleotide sequence) AACATAAACTCACAGGACACCTGCAGGCAAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGC
CTGGAAGAGATGGACGAGACGGAGCGAAGGGTGACAAAGGCGATGCAGGAGAACCAGGACGTCCTGGCAGCCC
GGGGAAGGATGGGACGAGTGGAGAGAAGGGAGAACGAGGAGCAGATGGAAAAGTTGAAGCAAAAGGCATCAAA
GGTGATCAAGGCTCAAGAGGATCCCCAGGAAAACATGGCCCCAAGGGGCTTGCAGGGCCCATGGGAGAGAAGG
GCCTCCGAGGAGAGACTGGGCCTCAGGGGCAGAAGGGGAATAAGGGTGACGTGGGTCCCACTGGTCCTGAGGG
GCCAAGGGGCAACATTGGGCCTTTGGGCCCAACTGGTTTACCGGGCCCCATGGGCCCTATTGGAAAGCCTGGT
CCCAAAGGAGAAGCTGGACCCACGGGGCCCCAGGGTGAGCCAGGAGTCCGGGGAATAAGAGGCTGGAAAGGAG
ATCGAGGAGAGAAAGGGAAAATCGGTGAGACTCTAGTCTTGCCAAAAAGTGCTTTCACTGTGGGGCTCACGGT
GCTGAGCAAGTTTCCTTCTTCAGATATGCCCATTAAATTTGATAAGATCCTGTATAACGAATTCAACCATTAT
GATACAGCAGCGGGGAAATTCACGTGCCACATTGCTGGGGTCTATTACTTCACCTACCACATCACTGTTTTCT
CCAGAAATGTTCAGGTGTCTTTGGTCAAAAATGGAGTAAAAATACTGCACACCAAAGATGCTTACATGAGCTC
TGAGGACCAGGCCTCTGGCGGCATTGTCCTGCAGCTGAAGCTCGGGGATGAGGTGTGGCTGCAGGTGACAGGA
GGAGAGAGGTTCAATGGCTTGTTTGCTGATGAGGACGATGACACAACTTTCACAGGGTTCCTTCTGTTCAGCA
GCCCG
SEQ ID NO: 14 (mature INSP058 protein sequence) NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIK
GDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPG
PKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHY
DTAAGKFTCHIAGVYYFTYHTTVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTG
GERFNGLFADEDDDTTFTGFLLFSSP
SEQ ID NO: 15 (mature INSP058SV nucleotide sequence) AACATAAACTCACAGGACACCTGCAGGCAAGGGCACCCTGGAATCCCTGGGAACCCCGGTCACAATGGTCTGC
CTGGAAGAGATGGACGAGACGGAGCGAAGGGTGACAAAGGCGATGCAGGAGAACCAGGATGTCCTGGCAGCCC
GGGGAAGGATGGGACGAGTGGAGAGAAGGGAGAACGAGGAGCAGATGGAAAAGTTGAAGCAAAAGGCATCAAA
GGAATGTTCAGGTGTCTTTGGTCAAAAACGGAGTAA
SEQ ID N0: l6 (mature INSP058SV protein sequence) NINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGCPGSPGKDGTSGEKGERGADGKVEAKGIK
GMFRCLWSKTE
Claims (43)
1. A polypeptide, which polypeptide:
(i) comprises the amino acid sequence as recited in SEQ ID NO: 8 and/or SEQ ID
NO:14;
(ii) is a fragment thereof having the function of a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptide of (i); or (iii) is a functional equivalent of (i) or (ii).
(i) comprises the amino acid sequence as recited in SEQ ID NO: 8 and/or SEQ ID
NO:14;
(ii) is a fragment thereof having the function of a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptide of (i); or (iii) is a functional equivalent of (i) or (ii).
2. A polypeptide according to claim 1 which:
(i) consists of the amino acid sequence as recited in SEQ ID NO: 8 and/or SEQ
ID
NO:14;
(ii) is a fragment thereof having the function of a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptide of (i); or (iii) is a functional equivalent of (i) or (ii).
(i) consists of the amino acid sequence as recited in SEQ ID NO: 8 and/or SEQ
ID
NO:14;
(ii) is a fragment thereof having the function of a TNF-like secreted protein, or having an antigenic determinant in common with the polypeptide of (i); or (iii) is a functional equivalent of (i) or (ii).
3. A polypeptide which is a functional equivalent according to part (iii) of claims 1 or 2, and which is homologous to the amino acid sequence as recited in SEQ ID NO:8.
4. A polypeptide which is a fragment or a functional equivalent as recited to any one of claims 1 to 3, which has greater than 80% sequence identity with the amino acid sequence recited in SEQ ID NO:8, or with an active fragment thereof, preferably greater than 85%, 90%, 95%, 98% or 99% sequence identity.
5. A polypeptide which is a functional equivalent as recited in any one of claims 1 to 4, which exhibits significant structural homology with a polypeptide having the amino acid sequence recited in SEQ ID NO:8.
6. A polypeptide which is a fragment as recited in claims 1-2 or claim 4 having an antigenic determinant in common with the polypeptide of part (i) of any one of claims 1-4 which consists of 7 or more amino acid residues from the amino acid sequence recited SEQ ID NO:8.
7. The polypeptide of claims 1 or 2 which consists of the amino acid sequence as recited in SEQ ID NO: 10 and/or SEQ ID NO:16.
8. A purified nucleic acid molecule which encodes a polypeptide according to any one of the preceding claims.
9. A purified nucleic acid molecule according to claim 8, which comprises the nucleic acid sequence as recited in SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:13, SEQ ID NO:15, or is a redundant equivalent or fragment thereof.
10. A purified nucleic acid molecule which hybridizes under high stringency conditions with a nucleic acid molecule according to claim 8 or claim 9.
11. A vector comprising a nucleic acid molecule as recited in any one of claims 8 to 10.
12. A host cell transformed with a vector according to claim 11.
13. A ligand which binds specifically to the polypeptide according to any one of claims 1 to 7.
14. A ligand according to claim 13, which is an antibody.
15. A compound that either increases or decreases the level of expression or activity of a polypeptide according to any one of claims 1 to 7.
16. A compound according to claim 15 that binds to a polypeptide according to any one of claims 1 to 7 without inducing any of the biological effects of the polypeptide.
17. A compound according to claim 15 or 16, which is a natural or modified substrate, ligand, enzyme, receptor or structural or functional mimetic.
18. A polypeptide according to any one of claims 1 to 7, a nucleic acid molecule according to any one of claims 8 to 10, a vector according to claim 11, a host cell according to claim 12, a ligand according to claim 13 or claim 14, or a compound according to any one of claims 15 to 17, for use in therapy or diagnosis of disease.
19. A method of diagnosing a disease in a patient, comprising assessing the level of expression of a natural gene encoding a polypeptide according to any one of claims 1 to 7, or assessing the activity of a polypeptide according to any one of claims 1 to 7 in tissue from said patient and comparing said level of expression or activity to a control level, wherein a level that is different to said control level is indicative of disease.
20. A method according to claim 19 that is carried out in vitro.
21. A method according to claim 19 or claim 20, which comprises the steps of:
(a) contacting a ligand according to claim 13 or claim 14 with a biological sample under conditions suitable for the formation of a ligand-polypeptide complex; and (b) detecting said complex.
(a) contacting a ligand according to claim 13 or claim 14 with a biological sample under conditions suitable for the formation of a ligand-polypeptide complex; and (b) detecting said complex.
22. A method according to claim 19 or claim 20, comprising the steps of:
a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule according to any one of claims 7 to 9 and the probe;
b) contacting a control sample with said probe under the same conditions used in step a);
and c) detecting the presence of hybrid complexes in said samples; wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease.
a) contacting a sample of tissue from the patient with a nucleic acid probe under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule according to any one of claims 7 to 9 and the probe;
b) contacting a control sample with said probe under the same conditions used in step a);
and c) detecting the presence of hybrid complexes in said samples; wherein detection of levels of the hybrid complex in the patient sample that differ from levels of the hybrid complex in the control sample is indicative of disease.
23. A method according to claim 19 or claim 20, comprising:
a) contacting a sample of nucleic acid from tissue of the patient with a nucleic acid primer under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule according to any one of claims 8 to 10and the primer;
b) contacting a control sample with said primer under the same conditions used in step a);
and c) amplifying the sampled nucleic acid; and d) detecting the level of amplified nucleic acid from both patient and control samples;
wherein detection of levels of the amplified nucleic acid in the patient sample that differ significantly from levels of the amplified nucleic acid in the control sample is indicative of disease.
a) contacting a sample of nucleic acid from tissue of the patient with a nucleic acid primer under stringent conditions that allow the formation of a hybrid complex between a nucleic acid molecule according to any one of claims 8 to 10and the primer;
b) contacting a control sample with said primer under the same conditions used in step a);
and c) amplifying the sampled nucleic acid; and d) detecting the level of amplified nucleic acid from both patient and control samples;
wherein detection of levels of the amplified nucleic acid in the patient sample that differ significantly from levels of the amplified nucleic acid in the control sample is indicative of disease.
24. A method according to claim 19 or claim 20 comprising:
a) obtaining a tissue sample from a patient being tested for disease;
b) isolating a nucleic acid molecule according to any one of claims 8 to 10 from said tissue sample; and c) diagnosing the patient for disease by detecting the presence of a mutation which is associated with disease in the nucleic acid molecule as an indication of the disease.
a) obtaining a tissue sample from a patient being tested for disease;
b) isolating a nucleic acid molecule according to any one of claims 8 to 10 from said tissue sample; and c) diagnosing the patient for disease by detecting the presence of a mutation which is associated with disease in the nucleic acid molecule as an indication of the disease.
25. The method of claim 24, further comprising amplifying the nucleic acid molecule to form an amplified product and detecting the presence or absence of a mutation in the amplified product.
26. The method of claim 24 or claim 25, wherein the presence or absence of the mutation in the patient is detected by contacting said nucleic acid molecule with a nucleic acid probe that hybridises to said nucleic acid molecule under stringent conditions to form a hybrid double-stranded molecule, the hybrid double-stranded molecule having an unhybridised portion of the nucleic acid probe strand at any portion corresponding to a mutation associated with disease; and detecting the presence or absence of an unhybridised portion of the probe strand as an indication of the presence or absence of a disease-associated mutation.
27. A method according to any one of claims 19 to 26, wherein said disease includes, but is not limited to cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours;
myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma; autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection; cardiovascular disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia; neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C1q family proteins.
myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma; autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection; cardiovascular disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia; neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders; metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C1q family proteins.
28. Use of a polypeptide according to either any one of claims 1 to 7 as a TNF-like secreted protein.
29. A pharmaceutical composition comprising a polypeptide according to any one of claims 1 to 7, a nucleic acid molecule according to any one of claims 8 to 10, a vector according to claim 11, a host cell according to claim 12, a ligand according to claim 13 or claim 14, or a compound according to any one of claims 15 to 17.
30. A vaccine composition comprising a polypeptide according to any one of claims 1 to 7 or a nucleic acid molecule according to any one of claims 8 to 10.
31. A polypeptide according to any one of claim 1 to 7, a nucleic acid molecule according to any one of claim 8 to 10, a vector according to claim 11, a host cell according to claim 12, a ligand according to claim 13 or claim 14, a compound according to any one of claims 15 to 17, or a pharmaceutical composition according to claim 29, for use in the manufacture of a medicament for the treatment of disease such as cell proliferative disorders, including neoplasm, melanoma, lung, colorectal, breast, pancreas, head and neck and other solid tumours; myeloproliferative disorders, such as leukemia, non-Hodgkin lymphoma, leukopenia, thrombocytopenia, angiogenesis disorder, Kaposis' sarcoma; autoimmune/inflammatory disorders, including allergy, inflammatory bowel disease, arthritis, psoriasis and respiratory tract inflammation, asthma, and organ transplant rejection; cardiovascular disorders, including hypertension, oedema, angina, atherosclerosis, thrombosis, sepsis, shock, reperfusion injury, and ischemia;
neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders;
metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C1q family proteins.
neurological disorders including central nervous system disease, Alzheimer's disease, brain injury, amyotrophic lateral sclerosis, and pain; developmental disorders;
metabolic disorders including diabetes mellitus, osteoporosis, and obesity, AIDS and renal disease; infections including viral infection, bacterial infection, fungal infection and parasitic infection; and other disorders mediated by TNF-like secreted proteins, particularly those mediated by C1q family proteins.
32. A method of treating a disease in a patient, comprising administering to the patient a polypeptide according to any one of claims 1 to 7, a nucleic acid molecule according to any one of claims 8 to 10, a vector according to claim 11, a host cell according to claim 12, a ligand according to claim 13 or claim 14, a compound according to any one of claims 15 to 17, or a pharmaceutical composition according to claim 29.
33. A method according to claim 32, wherein, for diseases in which the expression of the natural gene or the activity of the polypeptide is lower in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, ligand, compound or composition administered to the patient is an agonist.
34. A method according to claim 32, wherein, for diseases in which the expression of the natural gene or activity of the polypeptide is higher in a diseased patient when compared to the level of expression or activity in a healthy patient, the polypeptide, nucleic acid molecule, vector, ligand, compound or composition administered to the patient is an antagonist.
35. A method of monitoring the therapeutic treatment of disease in a patient, comprising monitoring over a period of time the level of expression or activity of a polypeptide according to any one of claims 1 to 7, or the level of expression of a nucleic acid molecule according to any one of claims 8 to 10 in tissue from said patient, wherein altering said level of expression or activity over the period of time towards a control level is indicative of regression of said disease.
36. A method for the identification of a compound that is effective in the treatment and/or diagnosis of disease, comprising contacting a polypeptide according to any one of claims 1 to 7, or a nucleic acid molecule according to any one of claims 8 to 10 with one or more compounds suspected of possessing binding affinity for said polypeptide or nucleic acid molecule, and selecting a compound that binds specifically to said nucleic acid molecule or polypeptide.
37. A kit useful for diagnosing disease comprising a first container containing a nucleic acid probe that hybridises under stringent conditions with a nucleic acid molecule according to any one of claims 8 to 10; a second container containing primers useful for amplifying said nucleic acid molecule; and instructions for using the probe and primers for facilitating the diagnosis of disease.
38. The kit of claim 37, further comprising a third container holding an agent for digesting unhybridised RNA.
39. A kit comprising an array of nucleic acid molecules, at least one of which is a nucleic acid molecule according to any one of claims 8 to 10.
40. A kit comprising one or more antibodies that bind to a polypeptide as recited in any one of claims 1 to 7; and a reagent useful for the detection of a binding reaction between said antibody and said polypeptide.
41. A transgenic or knockout non-human animal that has been transformed to express higher, lower or absent levels of a polypeptide according to any one of claims 1 to 7.
42. A method for screening for a compound effective to treat disease, by contacting a non-human transgenic animal according to claim 41 with a candidate compound and determining the effect of the compound on the disease of the animal.
43. A method according to any one of claims 32-36 or claim 42, wherein said disease is one of the diseases set forth in claim 27.
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/GB2003/002179 WO2004104040A1 (en) | 2003-05-21 | 2003-05-21 | Tnf-like secreted protein |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2525181A1 true CA2525181A1 (en) | 2004-12-02 |
Family
ID=33462624
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002525181A Abandoned CA2525181A1 (en) | 2003-05-21 | 2003-05-21 | Tnf-like secreted protein |
Country Status (11)
Country | Link |
---|---|
US (1) | US7514533B2 (en) |
EP (1) | EP1629008A1 (en) |
JP (1) | JP2007527692A (en) |
CN (1) | CN1816565A (en) |
AU (1) | AU2003241006B2 (en) |
BR (1) | BR0318307A (en) |
CA (1) | CA2525181A1 (en) |
EA (1) | EA009607B1 (en) |
IL (1) | IL171895A0 (en) |
MX (1) | MXPA05012414A (en) |
WO (1) | WO2004104040A1 (en) |
Family Cites Families (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
NZ207394A (en) | 1983-03-08 | 1987-03-06 | Commw Serum Lab Commission | Detecting or determining sequence of amino acids |
JP3046063B2 (en) | 1989-03-17 | 2000-05-29 | イー・アイ・デユポン・ドウ・ヌムール・アンド・カンパニー | External regulation of gene expression |
US5252479A (en) | 1991-11-08 | 1993-10-12 | Research Corporation Technologies, Inc. | Safe vector for gene therapy |
WO1995011995A1 (en) | 1993-10-26 | 1995-05-04 | Affymax Technologies N.V. | Arrays of nucleic acid probes on biological chips |
US5362865A (en) | 1993-09-02 | 1994-11-08 | Monsanto Company | Enhanced expression in plants using non-translated leader sequences |
US5693506A (en) | 1993-11-16 | 1997-12-02 | The Regents Of The University Of California | Process for protein production in plants |
US6015880A (en) | 1994-03-16 | 2000-01-18 | California Institute Of Technology | Method and substrate for performing multiple sequential reactions on a matrix |
US5980898A (en) | 1996-11-14 | 1999-11-09 | The United States Of America As Represented By The U.S. Army Medical Research & Material Command | Adjuvant for transcutaneous immunization |
WO1998055607A2 (en) | 1997-06-04 | 1998-12-10 | Oxford Biomedica (Uk) Limited | Tumor targeted vector |
EP2042598A1 (en) | 1998-11-18 | 2009-04-01 | Oxford Biomedica (UK) Limited | 5T4 tumour-associated antigen for use in tumour immunotherapy |
CA2372815A1 (en) * | 1999-05-11 | 2000-11-16 | Incyte Genomics, Inc. | Extracellular matrix and adhesion-associated proteins |
GB0006153D0 (en) | 2000-03-14 | 2000-05-03 | Inpharmatica Ltd | Database |
KR20030033055A (en) * | 2000-09-13 | 2003-04-26 | 스미스클라인 비참 코포레이션 | Novel Compounds |
CA2433841A1 (en) | 2001-01-16 | 2002-08-29 | Mary Ruth Erickson | Gmg-3, gmg-4, and gmg-6 polynucleotides and polypeptides and uses thereof |
-
2003
- 2003-05-21 BR BRPI0318307-6A patent/BR0318307A/en not_active IP Right Cessation
- 2003-05-21 JP JP2004572050A patent/JP2007527692A/en active Pending
- 2003-05-21 AU AU2003241006A patent/AU2003241006B2/en not_active Ceased
- 2003-05-21 CN CNA038268183A patent/CN1816565A/en active Pending
- 2003-05-21 CA CA002525181A patent/CA2525181A1/en not_active Abandoned
- 2003-05-21 EA EA200501843A patent/EA009607B1/en not_active IP Right Cessation
- 2003-05-21 US US10/557,400 patent/US7514533B2/en not_active Expired - Fee Related
- 2003-05-21 EP EP03730324A patent/EP1629008A1/en not_active Withdrawn
- 2003-05-21 WO PCT/GB2003/002179 patent/WO2004104040A1/en active Application Filing
- 2003-05-21 MX MXPA05012414A patent/MXPA05012414A/en not_active Application Discontinuation
-
2005
- 2005-11-10 IL IL171895A patent/IL171895A0/en unknown
Also Published As
Publication number | Publication date |
---|---|
CN1816565A (en) | 2006-08-09 |
EA009607B1 (en) | 2008-02-28 |
US7514533B2 (en) | 2009-04-07 |
AU2003241006A1 (en) | 2004-12-13 |
JP2007527692A (en) | 2007-10-04 |
US20070155958A1 (en) | 2007-07-05 |
EA200501843A1 (en) | 2006-06-30 |
AU2003241006B2 (en) | 2011-03-24 |
BR0318307A (en) | 2006-07-11 |
WO2004104040A1 (en) | 2004-12-02 |
IL171895A0 (en) | 2006-04-10 |
EP1629008A1 (en) | 2006-03-01 |
MXPA05012414A (en) | 2006-02-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20090324562A1 (en) | Defensin Proteins | |
EP1499640A2 (en) | Immunoglobulin-domain containing cell surface recognition molecules | |
WO2003054004A2 (en) | Secreted proteins | |
US20050042731A1 (en) | Secreted proteins | |
CA2522108A1 (en) | Secreted protein family | |
EP1569961B1 (en) | Splice variant of the human pituitary growth hormone | |
CA2516414A1 (en) | Secreted protein family | |
US7514533B2 (en) | TNF-like secreted protein | |
US20060275259A1 (en) | Il-8-like proteins | |
US20060216709A1 (en) | Midkine-like protein | |
WO2004009624A2 (en) | Three finger toxin fold protein | |
WO2004000882A2 (en) | Proteins | |
WO2004007552A1 (en) | Cytokine receptor | |
AU2003295100A1 (en) | Midkine-like protein | |
US20070148655A1 (en) | Leucine rich repeat containing protein | |
CA2471297A1 (en) | Human netrin receptor and uses thereof | |
WO2003104278A1 (en) | Tnf-like protein | |
WO2003100061A2 (en) | Three finger toxin fold proteins | |
WO2004024762A2 (en) | Il-8 like protein | |
EP1636262A1 (en) | Interferon gamma-like protein |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Discontinued |