Search Images Maps Play YouTube News Gmail Drive More »
Sign in
Screen reader users: click this link for accessible mode. Accessible mode has the same essential features but works better with your reader.

Patents

  1. Advanced Patent Search
Publication numberWO2000017327 A9
Publication typeApplication
Application numberPCT/US1999/021419
Publication dateOct 4, 2001
Filing dateSep 17, 1999
Priority dateSep 18, 1998
Also published asCA2342053A1, CA2342053C, EP1121422A2, EP2322605A2, EP2322605A3, EP2363458A2, EP2363458A3, US6468772, US6495354, US6559297, US6569656, US6645762, US6890752, US20020040488, US20020094556, US20020094557, US20030087406, US20040053386, WO2000017327A2, WO2000017327A3
Publication numberPCT/1999/21419, PCT/US/1999/021419, PCT/US/1999/21419, PCT/US/99/021419, PCT/US/99/21419, PCT/US1999/021419, PCT/US1999/21419, PCT/US1999021419, PCT/US199921419, PCT/US99/021419, PCT/US99/21419, PCT/US99021419, PCT/US9921419, WO 0017327 A9, WO 0017327A9, WO 2000/017327 A9, WO 2000017327 A9, WO 2000017327A9, WO-A9-0017327, WO-A9-2000017327, WO0017327 A9, WO0017327A9, WO2000/017327A9, WO2000017327 A9, WO2000017327A9
InventorsJoseph Chappell, Kathleen R Manna, Joseph P Noel, Courtney M Starks
ApplicantUniv Kentucky Res Dept, Salk Inst For Biological Studi
Export CitationBiBTeX, EndNote, RefMan
External Links: Patentscope, Espacenet
Terpene synthases
WO 2000017327 A9
Abstract
Novel synthases and the corresponding nucleic acids encoding such synthases are disclosed herein. Such synthases possess an active site pocket that includes key amino acid residues that are modified to generate desired terpenoid reaction intermediates and products. Synthase modifications are designed based on, e.g., the three-dimensional coordinates of tobacco 5-epi-aristolochene synthase, with or without a substrate bound in the active site.
Claims  (OCR text may contain errors)
WE CLAIM THE FOLLOWING:
1. An isolated terpene synthase having a region with 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, said synthase comprising nine α-carbons having interatomic distances in Angstroms between said α-carbons
the center point of each said α-carbon positioned within a sphere having a radius of 2.3 Angstroms, the center points of each said sphere having the following structural coordinates:
, each said α-carbon having an associated R-group, said synthase having an ordered arrangement of said R-groups other than the following ordered arrangements of R- groups:
2 The synthase of claim 1 , wherein said synthase has 25% or greater sequence identity to residues 265 to 535 of SEQ ID 2
3 The synthase of claim 2, wherein said synthase has 35% or greater sequence identity to residues 265 to 535 of SEQ ID 2.
4 The synthase of claim 1 , wherein said synthase catalyses the formation of a terpenoid product from a monoterpene substrate.
5. The synthase of claim 1 , wherein said synthase catalyses the formation of a teφenoid product from a sesquiteφene substrate.
6. The synthase of claim 1 , wherein said synthase catalyses the formation of a terpenoid product from a diteφene substrate.
7. The synthase of claims 4, 5, or 6, wherein said product is a cyclic teφenoid hydrocarbon.
8. The synthase of claim 4, 5, or 6, wherein said product is an acyclic teφenoid hydrocarbon.
9. The synthase of claim 4, 5, or 6 wherein said product is a cyclic hydroxylated teφenoid hydrocarbon.
10. The synthase of claim 4, 5, or 6 wherein said product is an acyclic hydroxylated teφenoid hydrocarbon.
11. The synthase of claim 1 , wherein said R-group associated with said α- carbon 1 is selected from the group consisting of Cys, Ser, and Thr
12. The synthase of claim 1 , wherein said R-group associated with said α- carbon 1 is selected from the group consisting of Phe, Tyr and Tφ.
13 The synthase of claim 1 wherein said R-group associated with said α- carboπ 1 is selected from the group consisting of Pro, Gly, and Ala
14 The synthase of claim 1 , wherein said R-group associated with said α- carbon 1 is selected from the group consisting of Glu and Asp.
15. The synthase of claim 1 , wherein said R-group associated with said α- carbon 1 is selected from the group consisting of Met, lie, Val and Leu.
16. The synthase of claim 1 , wherein said R-group associated with said α- carbon 1 is selected from the group consisting of Arg and Lys
17. The synthase of claim 1 , wherein said R-group associated with said α- carbon 1 is selected from the group consisting of Gin, Asn and His.
18. The synthase of claim 1 , wherein said R-group associated with said α- carbon 2 is selected from the group consisting of Cys, Ser and Thr.
19. The synthase of claim 1 , wherein said R-group associated with said α- carbon 2 is selected from the group consisting of Phe, Tyr and Tφ.
20. The synthase of claim 1 , wherein said R-group associated with said α- carbon 2 is selected from the group consisting of Pro, Gly, and Ala.
21. The synthase of claim 1 , wherein said R-group associated with said α- carbon 2 is selected from the group consisting of Glu and Asp.
22. The synthase of claim 1 , wherein said R-group associated with said α- carbon 2 is selected from the group consisting of Met, lie, Val and Leu.
23. The synthase of claim 1 , wherein said R-group associated with said α- carbon 2 is selected from the group consisting of Arg and Lys.
24. The synthase of claim 1 , wherein said R-group associated with said α- carbon 2 is selected from the group consisting of Gin, Asn and His.
25. The synthase of claim 1 , wherein said R-group associated with said α- carbon 3 is selected from the group consisting of Cys, Ser and Thr.
26. The synthase of claim 1 , wherein said R-group associated with said α- carbon 3 is selected from the group consisting of Phe, Tyr and Trp.
27. The synthase of claim 1 , wherein said R-group associated with said α- carbon 3 is selected from the group consisting of Pro, Gly, and Ala.
28. The synthase of claim 1 , wherein said R-group associated with said α- carbon 3 is selected from the group consisting of Glu and Asp.
29. The synthase of claim 1 , wherein said R-group associated with said α- carbon 3 is selected from the group consisting of Met, lie, Val and Leu.
30. The synthase of claim 1 , wherein said R-group associated with said α- carbon 3 is selected from the group consisting of Arg and Lys.
31. The synthase of claim 1 , wherein said R-group associated with said α- carbon 3 is selected from the group consisting of Gin, Asn and His.
32. The synthase of claim 1 , wherein said R-group associated with said α- carbon 4 is selected from the group consisting of Cys, Ser and Thr.
33. The synthase of claim 1 , wherein said R-group associated with said α- carbon 4 is selected from the group consisting of Phe, Tyr and Trp.
34. The synthase of claim 1 , wherein said R-group associated with said α- carbon 4 is selected from the group consisting of Pro, Gly, and Ala.
35. The synthase of claim 1 , wherein said R-group associated with said α- carbon 4 is selected from the group consisting of Glu and Asp.
36. The synthase of claim 1 , wherein said R-group associated with said α- carbon 4 is selected from the group consisting of Met, He, Val and Leu.
37 The synthase of claim 1 , wherein said R-group associated with said α- carbon 4 is selected from the group consisting of Arg and Lys.
38. The synthase of claim 1 , wherein said R-group associated with said α- carbon 4 is selected from the group consisting of Gin, Asn and His.
39. The synthase of claim 1 , wherein said R-group associated with said α- carbon 5 is selected from the group consisting of Cys, Ser and Thr.
40. The synthase of claim 1 , wherein said R-group associated with said α- carbon 5 is selected from the group consisting of Phe, Tyr and Tφ.
41. The synthase of claim 1 , wherein said R-group associated with said α- carbon 5 is selected from the group consisting of Pro, Gly, and Ala.
42. The synthase of claim 1 , wherein said R-group associated with said α- carbon 5 is selected from the group consisting of Glu and Asp.
43. The synthase of claim 1 , wherein said R-group associated with said α- carbon 5 is selected from the group consisting of Met, lie, Val and Leu.
44. The synthase of claim 1 , wherein said R-group associated with said α- carbon 5 is selected from the group consisting of Arg and Lys.
45. The synthase of claim 1 , wherein said R-group associated with said α- carbon 5 is selected from the group consisting of Gin, Asn and His.
46. The synthase of claim 1 , wherein said R-group associated with said α- carbon 6 is selected from the group consisting of Cys, Ser and Thr.
47. The synthase of claim 1 , wherein said R-group associated with said α- carbon 6 is selected from the group consisting of Phe, Tyr and Tφ.
48. The synthase of claim 1 , wherein said R-group associated with said α- carbon 6 is selected from the group consisting of Pro, Gly, and Ala.
49. The synthase of claim 1 , wherein said R-group associated with said α- carbon 6 is selected from the group consisting of Glu and Asp.
50. The synthase of claim 1 , wherein said R-group associated with said α- carbon 6 is selected from the group consisting of Met, He, Val and Leu.
51. The synthase of claim 1 , wherein said R-group associated with said α- carbon 6 is selected from the group consisting of Arg and Lys.
52. The synthase of claim 1 , wherein said R-group associated with said α- carbon 6 is selected from the group consisting of Gin, Asn and His.
53. The synthase of claim 1 , wherein said R-group associated with said α- carbon 7 is selected from the group consisting of Cys, Ser and Thr.
54. The synthase of claim 1 , wherein said R-group associated with said α- carbon 7 is selected from the group consisting of Phe, Tyr and Tφ.
55. The synthase of claim 1 , wherein said R-group associated with said α- carbon 7 is selected from the group consisting of Pro, Gly, and Ala.
56. The synthase of claim 1 , wherein said R-group associated with said α- carbon 7 is selected from the group consisting of Glu and Asp.
57. The synthase of claim 1 , wherein said R-group associated with said α- carbon 7 is selected from the group consisting of Met, lie, Val and Leu.
58. The synthase of claim 1 , wherein said R-group associated with said α- carbon 7 is selected from the group consisting of Arg and Lys.
59 The synthase of claim 1 wherein said R-group associated with said α- carbon 7 is selected from the group consisting of Gin, Asn and His
60 The synthase of claim 1 , wherein said R-group associated with said α- carbon 8 is selected from the group consisting of Cys, Ser and Thr
61. The synthase of claim 1 , wherein said R-group associated with said α- carbon 8 is selected from the group consisting of Phe, Tyr and Trp
62 The synthase of claim 1 , wherein said R-group associated with said α- carbon 8 is selected from the group consisting of Pro, Gly, and Ala.
63. The synthase of claim 1 , wherein said R-group associated with said α- carbon 8 is selected from the group consisting of Glu and Asp.
64. The synthase of claim 1 , wherein said R-group associated with said α- carbon 8 is selected from the group consisting of Met, lie, Val and Leu.
65. The synthase of claim 1 , wherein said R-group associated with said α- carbon 8 is selected from the group consisting of Arg and Lys.
66. The synthase of claim 1 , wherein said R-group associated with said α- carbon 8 is selected from the group consisting of Gin, Asn and His.
67. The synthase of claim 1 , wherein said R-group associated with said α- carbon 9 is selected from the group consisting of Cys, Ser and Thr.
68. The synthase of claim 1 , wherein said R-group associated with said α- carbon 9 is selected from the group consisting of Phe, Tyr and Tφ.
69. The synthase of claim 1 , wherein said R-group associated with said α- carbon 9 is selected from the group consisting of Pro, Gly, and Ala.
70. The synthase of claim 1 , wherein said R-group associated with said α- carbon 9 is selected from the group consisting of Glu and Asp.
71. The synthase of claim 1 , wherein said R-group associated with said α- carbon 9 is selected from the group consisting of Met, He, Val and Leu.
72. The synthase of claim 1 , wherein said R-group associated with said α- carbon 9 is selected from the group consisting of Arg and Lys.
73. The synthase of claim 1 , wherein said R-group associated with said α- carbon 9 is selected from the group consisting of Gin, Asn and His.
74. The synthase of claim 1 , wherein said ordered arrangement of R- groups in said synthase associated with said α-carbons 1 to 9 is Trp, lie, Thr, Thr, Tyr, Leu, Cys, Thr and Phe, respectively.
75. The synthase of claim 1 , wherein said ordered arrangement of R- groups in said synthase associated with said α-carbons 1 to 9 is Ser, lie, Thr, Thr, Tyr, Leu, Cys, Thr and Tyr, respectively.
76. The synthase of claim 1 , wherein said ordered arrangement of R- groups in said synthase associated with said α-carbons 1 to 9 is Tφ, lie, Thr, Thr,
Tyr, Leu, Trp, Thr and Tyr, respectively.
77. The synthase of claim 1 , wherein said ordered arrangement of R- groups in said synthase associated with said α-carbons 1 to 9 is Ser, lie, Thr, Thr, Tyr, Leu, Tφ, Thr and Tyr, respectively.
78. The synthase of claim 1 , wherein said ordered arrangement of R- groups in said synthase associated with said α-carbons 1 to 9 is Glu, He, Thr, Thr, Tyr, Leu, Cys, Thr and Tyr, respectively.
79. A teφene synthase made by aligning a primary amino acid sequence of a teφene synthase polypeptide to the amino acid sequence of residues 265 to 535 of SEQ ID NO: 2, mutating a nucleic acid encoding said polypeptide at one or more codons of nine amino acid residues in a region of said polypeptide having 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, said nine residues in said polypeptide aligning with residues 273, 294, 402, 403, 404, 407, 440, 519 and 520 of SEQ ID NO: 2; and expressing said mutated nucleic acid so that a mutated terpene synthase is made.
80. An isolated terpene synthase having a region with 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, said synthase comprising sixteen α-carbons, said α-carbons having interatomic distances in Angstroms between said α-carbons that are 2.3 Angstroms of the following interatomic distances:
the center point of each said α-carbon positioned within a sphere having a radius of 2.3 Angstroms, the center points of each said sphere having the following structural coordinates: α-Carbon X Position Y Position Z Position
Number
1 119.144 43.487 44.133
2 120.203 38.695 43.506
3 114.058 43.884 41.015
4 109.327 46.145 41.743
5 110.682 46.410 45.284
6 106.807 36.336 45.151
7 107.629 38.010 41.804
8 109.375 34.842 40.617
9 111.944 37.854 37.602
10 110.233 31.098 47.361
11 115.915 32.218 48.369
12 118.846 34.443 51.796 |
13 116.461 32.848 54.290
14 114.100 38.006 55.620 '
15 116.617 41.285 51.702
16 114.855 43.486 54.238
, each said α-carbon having an associated R-group, said synthase having an ordered arrangement of said R-groups other than the following ordered arrangements of R- groups:
H
I
00
lHZ/66Sfl/IDd LZUl/00 OΛV
81 The synthase of claim 80, wherein said synthase has 25% or greater sequence identity to residues 265 to 535 of SEQ ID NO 2
82 The synthase of claim 81 , wherein said synthase has 35% or greater sequence identity to residues 265 to 535 of SEQ ID NO 2
83 The synthase of claim 81 , wherein said synthase catalyses the formation of a terpenoid product from a monoterpeπe substrate
84 The synthase of claim 81 , wherein said synthase catalyses the formation of a terpenoid product from a sesquiterpene substrate
85. The synthase of claim 81 , wherein said synthase catalyses the formation of a teφenoid product from a diteφene substrate
86. The synthase of claims 83, 84, or 85, wherein said product is a cyclic teφenoid hydrocarbon.
87. The synthase of claim 81 , wherein said ordered arrangement of R-groups in said synthase associated with said α-carbons 1 to 16 is Cys, Trp, He, He, Ser, Thr, Thr, Tyr, Leu, Cys, Val, Thr, Tyr, Asp, Phe and Thr, respectively
88. An isolated teφene synthase having a region with 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO. 2, said synthase compπsing nineteen α-carbons having interatomic distances in Angstroms between said α-carbons that are 2.3 Angstroms of the following interatomic distances-
the center point of each said α-carbon positioned within a sphere having a radius of 2.3 Angstroms, the center points of each said sphere having the following structural coordinates: α-Carbon Number X Position Y Position Z Position
1 119.144 43.487 44.133
2 120.203 38.695 43.506
3 114.058 43.884 41.015
4 109.327 46.145 41.743
5 110.682 46.410 45.284
6 99.381 42.920 45.148
7 103.445 38.054 44.605
8 106.807 36.336 45.151
9 107.629 38.010 41.804
10 109.375 34.842 40.617
11 111.944 37.854 37.602
12 110.233 31.098 47.361
13 109.178 j 33.314 52.875
14 115.915 I 32.218 48.369
15 118.846 34.443 51.796
16 116.461 I 32.848 54.290
17 114.100 j 38.006 55.620
18 116.617 j 41.285 51.702
19 114.855 I 43.486 54.238
, each said α-carbon having an associated R-group, said synthase having an ordered arrangement of said R-groups other than the following ordered arrangements of R- groups:
r- Φ
2
89. The synthase of claim 88, wherein said synthase has 25% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2.
90. The synthase of claim 88, wherein said synthase has 35% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2.
91. The synthase of claim 88, wherein said synthase catalyses the formation of a terpenoid product from a monoterpene substrate.
92. The synthase of claim 88, wherein said synthase catalyses the formation of a teφenoid product from a sesquiterpene substrate.
93. The synthase of claim 88, wherein said synthase catalyses the formation of a terpenoid product from a diteφene substrate.
94. The synthase of claims 91 , 92, or 93, wherein said product is a cyclic teφenoid hydrocarbon.
95. A isolated protein comprising: a first domain having an amino terminal end and a carboxyl terminal end; said first domain comprising amino acids that align structurally in three-dimensional space with a glycosyl hydrolase catalytic core, said glycosyl hydrolase catalytic core selected from the group consisting of amino acids 36 to 230 of glucoamylase PDB code 3GLY of Aspergillus awamori and amino acids 36 to 230 of endoglucanase CelD PDB code lCLC; a second domain having an amino terminal end and carboxyl terminal end, said second domain comprising amino acids that align structurally in three-dimensional space with avian FPP synthase, said carboxyl terminal end of said first domain linked to said amino terminal end of said second domain; wherein a region of said second domain has 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, and wherein said second domain comprises nine α-carbons having interatomic distances in Angstroms between said α-carbons that are 2.3 Angstroms of the following interatomic distances: the center point of each said α-carbon positioned within a sphere having a radius of 2.3 Angstroms, the center point of each said sphere having the following structural coordinates:
, each said α-carbon having an associated R-group, said synthase having an ordered arrangement of R-groups other than the following ordered arrangements of R-groups:
96. The protein of claim 95, wherein said synthase has 25% or greater sequence identity to SEQ ID NO: 2.
97. The protein of claim 96, wherein said synthase has 35% or greater sequence identity to SEQ ID NO: 2.
98. The synthase of claim 95, wherein said synthase catalyses the formation of a terpenoid product from a monoteφene substrate.
99. The synthase of claim 95, wherein said synthase catalyses the formation of a terpenoid product from a sesquiterpene substrate.
100. The synthase of claim 95, wherein said synthase catalyses the formation of a teφenoid product from a diteφene substrate.
101. The synthase of claims 98, 99, or 100, wherein said product is a cyclic teφenoid hydrocarbon.
102. An isolated synthase having a region with 40% or greater sequence identity to residues 343 to 612 of SEQ ID NO: 20, wherein one or more amino acid residues of said synthase that align with amino acids at positions 348, 351 , 372, 375, 376, 454, 479, 480, 481 , 482, 485, 519, 523, 597, 600, 601 , 605, 607 and 608 of SEQ ID NO: 20 are residues other than the following ordered arrangements of residues:
103. An isolated synthase having a region with 40% or greater sequence identity to residues 316 to 586 of SEQ ID NO: 22, wherein one or more amino acid residues of said synthase that align with amino acids at positions 321 , 324, 345, 348, 349, 427, 452, 453, 454, 455, 458, 492, 496, 569, 572, 573, 577, 579 and 580 of SEQ ID NO: 22 are residues other than the following ordered arrangements of residues:
104. An isolated synthase having a region with 40% or greater sequence identity to residues 352 to 622 of SEQ ID NO: 58, wherein one or more ammo acid residues of said synthase that align with ammo acids at positions 357, 360, 381, 384, 385, 463, 487, 488, 489, 490, 493, 528, 532, 606, 609, 610, 614, 616 and 617 of SEQ ID NO: 58 are residues other than the following ordered arrangements of residues:
E 3 _
105. An isolated synthase having a region with 40% or greater sequence identity to amino acid residues 272 to 540 encoded by SEQ ID NO: 33, wherein one or more amino acid residues of said synthase that align with am o acids at positions 277, 280, 301 , 304, 305, 383, 408, 409, 410, 411 , 414, 448, 452, 524, 527, 528, 532, 534 and 535 encoded by SEQ ID NO: 33 are residues other than the following ordered arrangements of residues:
106 An isolated synthase having a region with 40% or greater sequence identity to residues 319 to 571 of SEQ ID NO: 42, wherein one or more ammo acid residues of said synthase that align with am o acids at positions 324, 327, 348, 351 , 352, 430, 455, 456, 457, 458, 461 , 495, 499, 571 , 574, 575, 579, 581 and 582 of SEQ ID NO: 42 are residues other than the following ordered arrangements of residues:
107. An isolated synthase having a region with 40% or greater sequence identity to residues 579 to 847 of SEQ ID NO: 44, wherein one or more amino acid residues of said synthase that align with amino acids at positions 584, 587, 606, 609, 610, 688, 713, 714, 715, 716, 719, 753, 757, 831 , 834, 835, 839, 841 and 842 of SEQ ID NO: 44 are residues other than the following ordered arrangements of residues:
108. An isolated synthase having a region with 40% or greater sequence identity to residues 495 to 767 of SEQ ID NO: 46, wherein one or more am o acid residues of said synthase that align with am o acids at positions 500, 503, 524, 527, 528, 606, 631 , 632, 633, 634, 637, 674, 678, 751 , 754, 755, 759, 761 and 762 of SEQ ID NO: 46 are residues other than the following ordered arrangements of residues-
109. An isolated synthase having a region with 40% or greater sequence identity to residues 295 to 564 of SEQ ID NO: 48, wherein one or more amino acid residues of said synthase that align with amino acids at positions 300, 303, 324, 327, 328, 406, 431 , 432, 433, 434, 437, 471 , 475, 548, 551 , 552, 556, 558 and 559 of SEQ ID NO: 48 are residues other than the following ordered arrangements of residues:
110. An isolated synthase having a region with 40% or greater sequence identity to residues 307 to 578 of SEQ ID NO: 50, wherein one or more amino acid residues of said synthase that align with amino acids at positions 312, 315, 336, 339, 340, 419, 444, 445, 446, 447, 450, 484, 488, 562, 565, 566, 570, 572 and 573 of SEQ ID NO: 50 are residues other than the following ordered arrangements of residues:
ε
_
111. An isolated synthase having a region with 40% or greater sequence identity to residues 264 to 533 of SEQ ID NO: 52, wherein one or more amino acid residues of said synthase that align with amino acids at positions 269, 272, 293, 296, 297, 375, 401 , 402, 403, 404, 407, 441 , 445, 517, 520, 521 , 525, 527 and 528 of SEQ ID NO: 52 are residues other than the following ordered arrangements of residues:
112. An isolated synthase having a region with 40% or greater sequence identity to residues 585 to 853 of SEQ ID NO: 56, wherein one or more ammo acid residues of said synthase that align with ammo acids at positions 590, 593, 614, 617, 618, 696, 721 , 722, 723, 724, 727, 761 , 765, 837, 840, 841 , 845, 847 and 848 of SEQ ID NO: 56 are residues other than the following ordered arrangements of residues:
113. An isolated synthase having a region with 40% or greater sequence identity to residues 307 to 574 of SEQ ID NO: 54, wherein one or more amino acid residues of said synthase that align with amino acids at positions 312, 315, 336, 339, 340, 418, 443, 444, 445, 446, 449, 483, 487, 560, 563, 564, 566, 568 and 569 of SEQ ID NO: 54 are residues other than the following ordered arrangements of residues:
114. An isolated synthase having a region with 40% or greater sequence identity to residues 309 to 577 of SEQ ID NO: 24, wherein one or more amino acid residues of said synthase that align with amino acids at positions 314, 317, 338, 341 , 342, 420, 446, 447, 448, 449, 452, 485, 489, 560, 563, 564, 569, 571 and 572 of SEQ ID NO: 24 are residues other than the following ordered arrangements of residues:
1 15. An isolated synthase having a region with 40% or greater sequence identity to residues 315 to 584 of SEQ ID NO: 26, wherein one or more amino acid residues of said synthase that align with amino acids at positions 320, 323, 344, 347, 348, 426, 451 , 452, 453, 454, 457, 492, 496, 568, 571 , 572, 576, 578 and 579 of SEQ ID NO: 26 are residues other than the following ordered arrangements of residues:
[J- H H H H H H <O H H C H O H H H O O O H CO - Z CO C H O H H H H > H I- 000
* m >- >- >- >- LL > > l_. X U. U- X I_. - Q X U. X U. _l X _l >- U. U- >- U. LL - _l - >- X U. LL
S in Q Q Q Q Q Q Q Q Q Q UI Q Q UJ Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q Q
^ >- >- >- > - > >- >- - >- >- >- >- LL > >- > > - > > >- >- >- LL >- m
Γ H- H -I -I -I > -l -J O CO H S — CO S — H S ~ - 0 > - -I -I S > LL 1L LL LL C0 — H H S m
> - . _ < < < > < U - < > - < < - < X ffl l- J U. < J J J - l_ > J J > μ > - < r- <
S Q O Q Q Z Q Z Q Q Z Z Q O Z Q Q Z Q Z Q Z Q Z O Z Q S O Q O Z Z Z Z Z Q Q Q Q Q Q
O O O O < O < LL CO O O -J O O -I -I O -I -I -I LL CO O - — oυ-ico-iδ oo — ooo-ico — _ι _j _ι _j — -J ι_ι S H S -i -J-i-il l> C — _J H > -J — υ > > _ι _ι _ι S -i — >- >-x Z0-<0 <-.-S<> cocoσ-ιχ>sco -so-ιo-ι-ι-ιs oσco
H H O O > 00 < O H CO CO -J O O H (0 (O < CO O < COO H < O CO O -I < < H H CO O <
h WUW < - >HW W WCD > W> OC W -I CO h- > < -_- U- |-COCO - >
K h r-- ι-- l- (0 W r- llJ Ϊ CO < < W C O tOW ϋ3 W03 tΛ < tO Z > W LL W W I- W μ i- ϋ3 CO W
>->->>>- ->->>_<>->z >u. -- v>->->-_ z> u.>-∑__>->>->->- >- a W COCOCO COCOCOHQ HH >H H H H > H H H > HHHH H H H > H H H C HCOC H H H
g — <<H-iHH>υ-ι — -i-i — >-ι — <_ισι O _ > S > O H H I — o σ< jξ — I — I — I > lL Z > LL Z Z -l - LL - Z < C0 O - < Z O < O O O O O > < z < -
3δδδδδδδδδ "-δδu-δδ δ -Jco-co5<-Jδ2 ococo<sδδδδ<<
CM O O O O O O O -i Q.<zocozυooυcocoz — — > O > < LL LL >- > O O O — >-υ LLu.
V M < 1 U Q UJ - O I - _. _i S Z
< CQ O Q UJ U. X > _- -J 2 Z O α. σ _ CO H 3 > δ X ' N < _ U Q UI U.(3 I - _- -J 2 Z
116. An isolated synthase having a region with 40% or greater sequence identity to residues 265 to 536 of SEQ ID NO: 28, wherein one or more amino acid residues of said synthase that align with amino acids at positions 270, 273, 294, 297, 298, 376, 401 , 402, 403, 404, 407, 440, 444, 518, 521 , 522, 528, 530 and 531 of SEQ ID NO: 28 are residues other than the following ordered arrangements of residues:
H H H H H H tO H H C H O H H C) O I- O O O H t C3 Z tO tO H H H H H > l- CD O O
> > > U- - ll. X _. _. X I LL -I >- X _J >- _. _. >- _. l_. >- _J >- I U.
QQO QQQQQQQLUQQ-JQαQ QQQQQQQQ QQQQQQQQQQQQQ Q Q Q
CM > -> ->- >>>>>> >->- >-lL - - > >- >->• ->> - -_.>-
CMHH_l _l_l >-J_ICJCOHS-l CO 5 5-ι CD > — J J S > IL U- IL IL CO — _•
_>~22 < < < > < 0 — < > -! < < — < > < CΛ H 2 lL < _l _l _l — U. > _I _I > H -I > —
^QααQZQzααzzQθzααzQzαzαzozQS (-θzzzzzc-Qα_.Qo
υuυ<o<iLcooo — oo-i — o-i- -i iLcoes-i-ioo — co-igoo - o υ_ι co-i
_ι — _ι — - -i S H S — — — — H — — -J > CO — _i H > _ι — CJ > > -i _ι _ι 2 _ι —
0.
"S
| 3 > > > X Z O — < 0 < — - 2 < > cθ co σ -i X > 3 <0 >- S C3 — O -J -i -i S > C30 co ε S H H O O > O O < U H C0 (0 -i C3 CD H C0 0 < C0 O < C3 C0 O H < C- C0 O _ < < O H H (0 C3 < o 1
Q H CO ϋ CO < H < > H C (O H CO O > — CO > O CO C0 -1 C H CO > < IL U- H CQ CO H >
O H H H H CO CO CO CO CO H — CO CQ < < CO eO C CO eO CO CO CO tO < CO Z > CO U. CO C H CO H H C CO CO
fS > >- >. lL < > Z > >- -. lL > >- >- lL > Z > - lL S 22 - > >-
W CO O> (O CO CO ( H Q O O H H > H H H H > H H H > H H H H H H H > H H H C H CO CO H H H
< < H _I H H > 0 -l — -I _J - > -l < J θ l 0 -l > 5 > O H H I O O <
> -I -1 -1 > _ Z > - 2 Z J - - - 2 < !0 ϋ - < Z ϋ < ϋ (3 O O O > < Z < -
555δ555ϊ5δu.5- nδ5 δϊ55-'β-i'δ<-'?2J"<- ?Sϊ<<
<aθQ__OI--5JC-i2ZO-.σ_l-3>$X >-N|g D_-U _- = ^ _- -|I? s? z o5
117. An isolated synthase having a region with 40% or greater sequence identity to residues 342 to 612 of SEQ ID NO: 30, wherein one or more amino acid residues of said synthase that align with amino acids at positions 347, 350, 371 , 374, 375, 453, 478, 479, 480, 481 , 483, 518, 522, 596, 599, 600, 604, 606 and 607 of SEQ ID NO: 30 are residues other than the following ordered arrangements of residues:
118. An isolated synthase having a region with about 40% or greater sequence identity to residues 307 to 541 of SEQ ID NO: 32, wherein one or more amino acid residues of said synthase that align with amino acids at positions 278, 281 , 302, 305, 306, 384, 409, 410, 411 , 412, 415, 448, 452, 524, 527, 528, 533, 535 and 536 of SEQ ID NO: 32 are residues other than the following ordered arrangements of residues:
E _
1 19. A method for making a terpene synthase, comprising: a) identifying, in a preselected polypeptide having a region with 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, nine amino acid residues whose α-carbons have interatomic distances in Angstroms between said α-carbons that are 2.3 Angstroms of the following interatomic distances:
the center point of each said α-carbon positioned within a sphere having a radius of 2.3 Angstroms, the center point of each said sphere having the following structural coordinates:
; and b) synthesizing a polypeptide that is modified from said preselected polypeptide, said modified polypeptide having one or more R-groups associated with said α-carbons other than the R-groups associated with said α-carbons in said preselected polypeptide, wherein said modified polypeptide has teφene synthase activity.
120. The method of claim 1 19, wherein said synthesizing step comprises the formation of a nucleic acid encoding said preselected polypeptide in which the coding sequence for one or more amino acids corresponding to said nine α-carbons is replaced by a coding sequence that codes for an amino acid different from the amino acid present in said preselected polypeptide.
121. The method of claim 119, wherein said preselected polypeptide is a pinene synthase.
122. The method of claim 121 , wherein said preselected polypeptide is SEQ ID NO: 20.
123. The method of claim 119, wherein said preselected polypeptide is a taxadiene synthase.
124. The method of claim 123, wherein said preselected polypeptide is SEQ ID NO: 44.
125. A method of using a terpene synthase, comprising: a) identifying, in a preselected polypeptide having a region with 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, amino acid residues at nine positions that align with amino acid residues at positions 273, 294, 402, 403, 404, 407, 440, 519 and 520 of SEQ ID NO: 2; and b) synthesizing a polypeptide that is modified from said preselected polypeptide, said modified polypeptide having amino acid residues at one or more of said nine positions other than the amino acid residues present in said preselected polypeptide.
126. The method of claim 125, wherein said identifying step comprises identifying sixteen amino acid residues in said preselected polypeptide that align with amino acid residues at positions 270, 273, 294, 297, 298, 402, 403, 404, 407, 440, 516, 519, 520, 525, 527 and 528 of SEQ ID NO: 2, and said synthesizing step comprises synthesizing a polypeptide that is modified from said preselected polypeptide, said modified polypeptide having amino acid residues at one or more of said sixteen positions other than the amino acid residues present in said preselected polypeptide.
127. The method of claim 125, wherein said identifying step comprises identifying nineteen amino acid residues in said preselected polypeptide that align with amino acid residues at positions 270, 273, 294, 297, 298, 376, 401 , 402, 403, 404, 407, 440, 444, 516, 519, 520, 525, 527 and 528 of SEQ ID NO: 2, and said synthesizing step comprises synthesizing a polypeptide that is modified from said preselected polypeptide, said modified polypeptide having amino acid residues at one or more of said nineteen positions other than the amino acid residues present in said preselected polypeptide.
128. The method of claim 125, wherein said synthesizing step comprises the formation of a nucleic acid encoding said preselected polypeptide in which the coding sequence in said nucleic acid coding for one or more of said nine amino acid residues is replaced by a coding sequence that codes for an amino acid different from the amino acid present in said preselected polypeptide.
129. The method of claim 125, wherein said preselected polypeptide is a pinene synthase.
130. The method of claim 129, wherein said preselected polypeptide is SEQ ID NO: 20.
131. The method of claim 125, wherein said preselected polypeptide is a taxadiene synthase.
132. The method of claim 131 , wherein said preselected polypeptide is SEQ ID NO: 44.
133. The method of claim 125, further comprising: c) contacting said modified polypeptide with a isoprenoid substrate under conditions effective for said substrate to bind said synthase; and d) measuring the ability of said modified polypeptide to catalyze the formation of a reaction product from said substrate.
134. The method of claim 133, wherein said isoprenoid substrate is a geranyl diphosphate.
135 The method of claim 133, wherein said isoprenoid substrate is a famesyl diphosphate.
136. The method of claim 133, wherein said isoprenoid substrate is a geranyl genanyl diphosphate.
137. A method of making a terpene synthase, comprising: creating a population of nucleic acid molecules that encode polypeptides, said population having members that differ from one another at one or more of nine codons specifying amino acids in a region of a preselected terpene synthase polypeptide having 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, α-carbons of said nine amino acids having interatomic distances in Angstroms between said α- carbons that are 2.3 Angstroms of the following interatomic distances:
the center point of each said α-carbon positioned within a sphere having a radius of 2.3 Angstroms, the center point of each said sphere having the following structural coordinates:
; and b) expressing at least a portion of said nucleic acid population so that a population of polypeptides is made, wherein at least one member of said population of polypeptides is a mutant teφene synthase.
138. The method of claim 137, wherein said expressing step comprises in vitro transcription and in vitro translation of said nucleic acid populations.
139. The method of claim 137, wherein said expressing step comprises: cloning said members of said nucleic acid population into an expression vector; introducing, into host cells, said cloned nucleic acid population members in said expression vector; and iii) expressing said cloned nucleic acid population members in said host cells so that said population of polypeptides is made.
140. The method of claim 139, wherein said host cells are prokaryotic cells.
141. The method of claim 137, wherein said preselected teφene synthase polypeptide is a monoteφene synthase.
142. The method of claim 137, wherein said preselected teφene synthase polypeptide is a sesquiteφene synthase.
143. The method of claim 137, wherein said preselected terpene synthase polypeptide is a diterpene synthase.
144. An isolated nucleic acid encoding the synthase of claim 1.
145. An isolated nucleic acid encoding the synthase of claim 2.
146. An isolated nucleic acid encoding the synthase of claim 3.
147. An isolated nucleic acid encoding the synthase of claim 7.
148. An isolated nucleic acid encoding a synthase selected from the group consisting of the synthase of claims 11 through 73.
149. An isolated nucleic acid encoding the synthase of claim 80.
150. An isolated nucleic acid encoding the synthase of claim 88.
151. An isolated nucleic acid encoding the synthase of claim 95.
152. An isolated nucleic acid encoding a synthase selected from the group consisting of the synthase of claims 102 through 118.
153. A host cell containing a nucleic acid encoding the synthase of claim 1.
154. The host cell of claim 153, wherein said cell is a prokaryotic cell.
155. The host cell of claim 153, wherein said cell is a eukaryotic cell.
156. The host cell of claim 155, wherein said cell is an insect cell.
157. The host cell of claim 155, wherein said cell is a plant cell.
158. The host cell of claim 157, wherein said host cell is an Angiosperm cell.
159. The host cell of claim 157, wherein said host cell is an Gymnosperm cell.
160. The host cell of claim 157, wherein said host cell is selected from the group consisting of: a cell from a Graminaceae plant, a cell from a Legumineae plant, a cell from a Solanaceae plant, a cell from a Brassicaeae plant and a cell from a Conifereae plant.
161. A transgenic plant containing a nucleic acid encoding the synthase of claim 1.
162. A transgenic animal cell culture containing a nucleic acid encoding the synthase of claim 1.
Description  (OCR text may contain errors)

TERPENE SYNTHASES

Cross Reference to Related Application This application claims the benefit of provisional application 60/100,993 filed September 18, 1998; provisional application 60/130,628 filed April 22,1999; and provisional application 60/150,262 filed August 23,1999.

This work was supported, in part, with funding from Federal agencies. Therefore, the United States Federal Government may have certain rights in the invention.

Background of the Invention Isoprenoid compounds are organic molecules produced by a wide range of organisms (e.g., plants, bacteria, fungi, etc). To date, over 23,000 individual isoprenoid molecules have been characterized with tens to hundreds of new structures identified each year. These molecules can fulfill a variety of roles. For example, monoterpenes can be used as fragrances and flavors. Sesquiterpenes and diterpenes can serve as pheromones, defensive agents, visual pigments, antitumor drugs, and components of signal transduction pathways. Triterpenes can serve important functions as membrane constituents and precursors of steroid hormones and bile acids. Polyprenols function as photoreceptive agents and cofactor side chains, and can also exist as natural polymers.

The diverse molecular compounds produced by the isoprenoid pathway are created from diphosphate esters of monounsaturated isoprene units. Isoprenes are added together in multiples of 2, 3, or 4 by prenyl transferases to make C10, C15, and C20 units, respectively. The C10, C15, and C20 molecules, named geranyl diphosphate (GPP), famesyl diphosphate (FPP), and geranylgeranyl diphosphate (GGPP), respectively, serve as substrates for terpene synthases.

Terpene synthases catalyze the production of isoprenoid compounds via one of the most complex reactions known in chemistry or biology. In general, terpene synthases are moderately sized enzymes having molecular weights of about 40 to 100 kD. As an enzyme, terpene synthases can be classified as having low to moderate turnover rates coupled with exquisite reaction specificity and preservation of chirality. Turnover comprises binding of substrate to the enzyme, establishment of substrate conformation, conversion of substrate to product and product release. Reactions can be performed in vitro in aqueous solvents, typically require magnesium ions as cofactors, and the resulting products, which are often highly hydrophobic, can be recovered by partitioning into an organic solvent.

Terpene synthase genes are found in a variety of organisms including bacteria, fungi and plants. Swapping regions approximating exons between different terpene synthases has identified functional domains responsible for terminal enzymatic steps. For example, work performed on 5-epi-aristolochene synthase (TEAS) from Nicotiana tabacum (tobacco) and Hyoscyamus muticus vetispiradiene synthase (HVS) from henbane revealed that exon 4 and exon 6, respectively, were responsible for reaction product specificity. Combining functional domains resulted in novel enzymes capable of synthesizing new reaction products (U.S. Patent 5,824,774). Studies have led to proposed reaction mechanisms for isoprenoid production; see, e.g., Cane et al., 1985, Bioorg. Chem., 13:246-265; Wheeler and Croteau, 1987, Proc. Natl. Acad. Sci. USA, 84:4856-4859; and Pyun et al., 1994, Arch. Biochem. Biophys., 308:488-496. The studies used substrate analogs and suicide inhibitors (Croteau, 1994, Arch. Biochem. Biophys., 251:777-782; Cane et al., 1995, Biochemistry, 34:2471-2479; and Croteau et al., 1993, Arch. Biochem.

Biophys., 307:397-404), as well as chemical-modifying reagents and site-directed mutagenesis in efforts to identify amino acids essential for catalysis (Cane et al., 1995, Biochemistry, 34:2480-2488; Rajaonarivony et al., 1992, Arch. Biochem. Biophys., 296:49-57; and Rajaonarivony et al., 1992, Arch. Biochem. Biophys., 299:77-82). However, these studies have resulted in limited success in defining the active site due to inherent limitations with these techniques.

Summary of the Invention The invention describes a method of identifying alpha-carbon atoms found in the active site of a terpene synthase and describes these atoms in three- dimensional space as well as the spatial relationships among them. The present invention also describes R-groups associated with such alpha-carbons and methods of altering these R-groups in order to create novel terpene synthases capable of generating novel reaction products. Until the invention taught in this present application, the active site of synthase proteins, the amino acid residues located therein, the amino acid residues involved in catalysis, and the configuration of α-carbons and R-groups within the active site have not been known. The current invention now teaches the structure of synthases, as well as provides the means of making and using the information obtained therefrom to develop and produce new and novel synthases having new and novel synthetic capabilities. The data generated using the methods described herein are useful for creation and production of synthase mutants that can use a variety of isoprenoid substrates and produce a variety of isoprenoid products. In one embodiment, the invention features an isolated terpene synthase having about 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2. Such a synthase comprises nine α-carbons having interatomic distances in Angstroms between the α-carbons that are 2.3 Angstroms of the interatomic distances shown in Table 6. The center point of each α-carbon is positioned within a sphere having a radius of 2.3 Angstroms. The center point of each such sphere has the structural coordinates given in Table 5. Each α-carbon has an associated R-group, and the synthase has an ordered arrangement of R- groups associated with each alpha-carbon other than the ordered arrangements of R-groups shown in Table 9. The synthase can have about 25% or greater sequence identity to residues 265 to 535 of SEQ ID 2, or about 35% or greater sequence identity to residues 265 to 535 of SEQ ID 2. Such a synthase can catalyse the formation of a terpenoid product from a monoterpene substrate, a sesquiterpene substrate, or a diterpene substrate. The product can be a cyclic terpenoid hydrocarbon or an acyclic terpenoid hydrocarbon. Either type of product can be hydroxylated or non-hydroxylated. The R-group associated with α-carbon 1 can be selected from one of the following groups: the group consisting of Cys, Ser, and Thr, the group consisting of Phe, Tyr and Tφ, the group consisting of Pro, Gly, and Ala, the group consisting of Glu and Asp, the group consisting of Met, He, Val and Leu, the group consisting of Arg and Lys, and the group consisting of Gin, Asn and His. R-groups associated with α-carbons 2 to 9 can be any amino acid except those having the ordered arrangements of Table 9. Similarly, the R-group associated with each of α-carbons 2-9 can be selected independently from the group consisting of Cys, Ser and Thr, the group consisting of Phe, Tyr and Tφ, the group consisting of Pro, Gly, and Ala, the group consisting of Glu and Asp, the group consisting of Met, lie, Val and Leu, the group consisting of Arg and Lys, and the group consisting of Gin, Asn and His. In these embodiments, R-groups associated with the remaining eight α-carbons except those having the ordered arrangements of Table 9. In some embodiments, the ordered arrangement of R-groups associated with α-carbons 1 to 9 is Tφ, lie, Thr, Thr, Tyr, Leu, Cys, Thr and Phe, respectively, Ser, lie, Thr, Thr, Tyr, Leu, Cys, Thr and Tyr, respectively, Trp, lie, Thr, Thr, Tyr, Leu, Trp, Thr and Tyr, respectively, Ser, lie, Thr, Thr, Tyr, Leu, Trp, Thr and Tyr, respectively, or Glu, lie, Thr, Thr, Tyr, Leu, Cys, Thr and Tyr, respectively.

The invention also features a terpene synthase made by aligning the primary amino acid sequence of a preselected teφene synthase polypeptide to the amino acid sequence of residues 265 to 535 of SEQ ID NO: 2, mutating a nucleic acid encoding the preselected polypeptide at one or more codons for nine amino acid residues in a region of the polypeptide primary amino acid sequence having about 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, the nine residues in the polypeptide aligning with residues 273, 294, 402, 403, 404, 407, 440, 519 and 520 of SEQ ID NO: 2; and expressing the mutated nucleic acid so that a mutated teφene synthase is made.

The invention also features an isolated teφene synthase having about 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, the synthase comprising sixteen α-carbons having interatomic distances in Angstroms between the α-carbons that are 2.3 Angstroms of the interatomic distances given in Table 4. The center point of each α-carbon is positioned within a sphere having a radius of 2.3 Angstroms. The center point of each of the spheres has the structural coordinates given in Table 3. Each α-carbon has an associated R-group, and the synthase has an ordered arrangement of R-groups other than the ordered arrangements of R-groups given in Table 8. The synthase can have about 25% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, or about 35% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2. The synthase can catalyse the formation of a teφenoid product from a monoteφene substrate, a sesquiteφene substrate, or a diteφene substrate. The product can be, for example, a cyclic teφenoid hydrocarbon. The ordered arrangement of R-groups in the synthase associated with α-carbons 1 to 16 can be Cys, Tφ, lie, lie, Ser, Thr, Thr, Tyr, Leu, Cys, Val, Thr, Tyr, Asp, Phe and Thr, respectively.

The invention also features an isolated teφene synthase having about 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, the synthase comprising nineteen α-carbons having interatomic distances in Angstroms between the α-carbons that are 2.3 Angstroms of the interatomic distances given in Table 2. The center point of each α-carbon is positioned within a sphere having a radius of 2.3 Angstroms. The center points of each sphere have the structural coordinates given in Table 1. Each α-carbon has an associated R-group, and the synthase has an ordered arrangement of the R-groups other than the ordered arrangements of R-groups given in Table 7. The synthase can have about 25% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, or about 35% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2. The synthase can catalyse the formation of a teφenoid product from a monoterpene substrate, a sesquiteφene substrate, or a diteφene substrate. The product can be, for example, a cyclic terpenoid hydrocarbon. The invention also features an isolated protein comprising a first domain having an amino terminal end and a carboxyl terminal end. The first domain comprises amino acids that align structurally in three-dimensional space with a glycosyl hydrolase catalytic core, the glycosyl hydrolase catalytic core selected from the group consisting of amino acids 36 to 230 of glucoamylase protein databank (PDB) code 3GLY of Aspergillus awamori and amino acids 36 to 230 of endoglucanase CelD PDB code 1CLC. The isolated protein also comprises a second domain having an amino terminal end and carboxyl terminal end. The second domain comprises amino acids that align structurally in three-dimensional space with avian FPP synthase. The carboxyl terminal end of the first domain is linked to the amino terminal end of the second domain. The second domain has about 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, and comprises nine α-carbons having interatomic distances in Angstroms between the α- carbons that are 2.3 Angstroms of the interatomic distances given in Table 6. The center point of each α-carbon is positioned within a sphere having a radius of 2.3 Angstroms, the center point of each sphere having the structural coordinates given in Table 5. Each α-carbon has an associated R-group, and the synthase has an ordered arrangement of R-groups other than the ordered arrangements of R-groups given in Table 9. The protein can have about 25% or greater sequence identity to SEQ ID NO: 2, or about 35% or greater sequence identity to SEQ ID NO: 2. The synthase can catalyse the formation of a teφenoid product from a monoteφene substrate, a sesquiteφene substrate, or a diteφene substrate. The product can be, for example, a cyclic teφeπoid hydrocarbon.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 343 to 606 of SEQ ID NO: 20, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 348, 351, 372, 375, 376, 454, 479, 480, 481 , 482, 485, 519, 523, 597, 600, 601, 605, 607 and 608 of SEQ ID NO: 20 are residues other than amino acids Y, L, C, I, T, Y, S, C, G, H, S, L, G, F, G, Y, D, Y and S, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 316 to 586 of SEQ ID NO: 22, wherein one or more ammo acid residues of the synthase that align with ammo acid residues at positions 321 , 324, 345, 348, 349, 427, 452, 453, 454, 455, 458, 492, 496, 569, 572, 573, 577, 579 and 580 of SEQ ID NO: 22 are residues other than ammo acids C, W, N, I, T, Y, S, I, S, G, M, L, D, A, M, Y, D, H and G, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 352 to 622 of SEQ ID NO: 58, wherein one or more ammo acid residues of the synthase that align with am o acid residues at positions 357, 360, 381 , 384, 385, 463, 487, 488, 489, 490, 493, 528, 532, 606, 609, 610, 614, 616 and 617 of SEQ ID NO: 58 are residues other than ammo acids Y, M, C, V, T, F, V, S, S, G, I, L, G, F, V, Y, D, Y and T, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to amino acid residues 272 to 540 encoded by SEQ ID NO: 33, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 277, 280, 301, 304, 305, 383, 408, 409, 410, 411 , 414, 448, 452, 524, 527, 528, 532, 534 and 535 encoded by SEQ ID NOS: 33 are residues other than amino acids G, W, I, A, S, Y, T, S, G, Y, L, C, D, M, L, Y, D, Y and T, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 319 to 571 of SEQ ID NO: 42, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 324, 327, 348, 351 , 352, 430, 455, 456, 457, 458, 461, 495, 499, 571, 574, 575, 579, 581 and 582 of SEQ ID NO: 42 are residues other than ammo acids I, W, V, I, S, Y, T, T, G, L, V, I, N, T, S, Y, D, Y, and T, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 579 to 847 of SEQ ID NO: 44, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 584, 587, 606, 609, 610, 688, 713, 714, 715, 716, 719, 753, 757, 831 , 834, 835, 839, 841 and 842 of SEQ ID NO: 44 are residues other than amino acids V, S, G, Q, V, Y, S, V, G, L, C, W, N, V, F, Y, D, Y and G, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 495 to 767 of SEQ ID NO: 46, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 500, 503, 524, 527, 528, 606, 631 , 632, 633, 634, 637, 674, 678, 751 , 754, 755, 759, 761 and 762 of SEQ ID NO: 46 are residues other than amino acids F, L, A, Q, T, Y, S, I, G, Q, L, S, D, T, I, F, D, F and G, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 295 to 564 of SEQ ID NO: 48, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 300, 303, 324, 327, 328, 406, 431, 432, 433, 434, 437, 471, 475, 548, 551 , 552, 556, 558 and 559 of SEQ ID NO: 48 are residues other than amino acids Y, W, A, C, T, Y, S, S, G, M, L, G, D, L, I, Y, D, L and Y, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 307 to 578 of SEQ ID NO: 50, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 312, 315, 336, 339, 340, 419, 444, 445, 446, 447, 450, 484, 488, 562, 565, 566, 570, 572 and 573 of SEQ ID NO: 50 are residues other than amino acids F, W, A, M, T, Y, N, T, G, M, L, S, D, I, M, Y, D, F and S, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 264 to 533 of SEQ ID NO: 52, wherein one or more am o acid residues of the synthase that align with ammo acid residues at positions 269, 272, 293, 296, 297, 375, 401 , 402, 403, 404, 407, 441, 445, 517, 520, 521, 525, 527 and 528 of SEQ ID NO: 52 are residues other than ammo acids C, W, L, T, S, Y, S, A, G, Y, I, A, N, A, L, Y, D, Y and S, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 585 to 853 of SEQ ID NO: 56, wherein one or more ammo acid residues of the synthase that align with ammo acid residues at positions 590, 593, 614, 617, 618, 696, 721, 722, 723, 724, 727, 761, 765, 837, 840, 841 , 845, 847 and 848 of SEQ ID NO: 56 are residues other than ammo acids I, S, S, T, V, Y, S, I, A, L, V, G, N, M, F, Y, D, L and T, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 307 to 574 of SEQ ID NO: 54, wherein one or more amino acid residues of the synthase that align with ammo acid residues at positions 312, 315, 336, 339, 340, 418, 443, 444, 445, 446, 449, 483, 487, 560, 563, 564, 566, 568 and 569 of SEQ ID NO: 54 are residues other than ammo acids C, W, I, I, T, Y, S, I, S, A, I, L, D, A, I, Y, D, D and G, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 309 to 577 of SEQ ID NO: 24, wherein one or more amino acid residues of the synthase that align with ammo acid residues at positions 314, 317, 338, 341, 342, 420, 446, 447, 448, 449, 452, 485, 489, 560, 563, 564, 569, 571 and 572 of SEQ ID NO: 24 are residues other than ammo acids C, W, N, V, T, Y, I, G, G, I, L, L, D, A, I, Y, D, F and G, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 315 to 584 of SEQ ID NO: 26, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 320, 323, 344, 347, 348, 426, 451 , 452, 453, 454, 457, 492, 496, 568, 571 , 572, 576, 578 and 579 of SEQ ID NO: 26 are residues other than amino acids S, W, I, A, T, Y, S, V, A, S, I, L, D, A, I, Y, D, F, and G, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 265 to 536 of SEQ ID NO: 28, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 270, 273, 294, 297, 298, 376, 401, 402, 403, 404, 407, 440, 444, 518, 521, 522, 528, 530 and 531 of SEQ ID NO: 28 are residues other than amino acids A, W, V, C, G, F, T, S, C, I, M, G, N, C, S, Y, D, Y and S, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 342 to 612 of SEQ ID NO: 30, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 347, 350, 371, 374, 375, 453, 478, 479, 480, 481 , 483, 518, 522, 596, 599, 600, 604, 606 and 607 of SEQ ID NO: 30 are residues other than amino acids F, L, C, V, T, Y, S, S, A, Y, V, L, G, L, L, Y, D, F and S, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more of the ordered arrangements of residues as given in Table 7 are not found in such a synthase.

The invention also features an isolated synthase having a region with about 40% or greater sequence identity to residues 273 to 541 of SEQ ID NO: 32, wherein one or more amino acid residues of the synthase that align with amino acid residues at positions 278, 281, 302, 305, 306, 384, 409, 410, 411, 412, 415, 448, 452, 524, 527, 528, 533, 535 and 536 of SEQ ID NO: 32 are residues other than amino acids C, W, I, I, S, Y, T, S, T, Y, L, C, D, I, T, Y, D, Y and T, respectively. In some embodiments, the sequence identity can be about 20% or greater, 25% or greater, or 35% or greater. In some embodiments, one or more ordered arrangements of residues as given in Table 7 are not found in such a synthase. The invention also features a method for making a teφene synthase, compπsing identifying, in a preselected polypeptide having a region with 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO. 2, nine ammo acid residues whose α-carbons have interatomic distances in Angstroms between the α- carbons that are 2.3 Angstroms of the interatomic distances given in Table 6. The center point of each α-carbon is positioned within a sphere having a radius of 2.3 Angstroms. The center point of each sphere has the structural coordinates given in Table 5. The method then compπses synthesizing a polypeptide that is modified from the preselected polypeptide. The modified polypeptide has one or more R- groups associated with the nine α-carbons other than the R-groups associated with the α-carbons in the preselected polypeptide. The synthesizing step can comprise the formation of a nucleic acid encoding the preselected polypeptide in which the coding sequence for one or more ammo acids corresponding to the nine α-carbons is replaced by a coding sequence that codes for an ammo acid different from the ammo acid present in the preselected polypeptide. The preselected polypeptide can be, for example, any one of the polypeptides given in SEQ ID NOS: 2, 4, 6, 8, 10, 12, 20, 22, 24, 26, 28, 30, 32, 34-40, 42, 44, 46, 48, 50, 52, 54, 56, or 58.

The invention also features a method of using a teφene synthase, comprising identifying, in a preselected polypeptide having a region with 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, ammo acid residues at nine positions that align with am o acid residues 273, 294, 402, 403, 404, 407, 440, 519 and 520 of SEQ ID NO: 2; and synthesizing a polypeptide that is modified from the preselected polypeptide. The novel polypeptide is modified by having ammo acid residues at one or more of the nine positions other than the ammo acid residues present in the preselected polypeptide. In some embodiments, the identifying step can comprise identifying sixteen ammo acid residues in the preselected polypeptide that align with ammo acid residues 270, 273, 294, 297, 298, 402, 403, 404, 407, 440, 516, 519, 520, 525, 527 and 528 of SEQ ID NO: 2, and the synthesizing step can compnse synthesizing a polypeptide that is modified from the preselected polypeptide, the modified polypeptide having ammo acid residues at one or more of the sixteen positions other than the ammo acid residues present in the preselected polypeptide. In some embodiments, the identifying step can comprise identifying nineteen ammo acid residues in the preselected polypeptide that align with ammo acid residues 270, 273, 294, 297, 298, 376, 401 , 402, 403, 404, 407, 440, 444, 516, 519, 520, 525, 527 and 528 of SEQ ID NO: 2, and the synthesizing step can compnse synthesizing a polypeptide that is modified from the preselected polypeptide, the modified polypeptide having ammo acid residues at one or more of the nineteen positions other than the ammo acid residues present in the preselected polypeptide. The synthesizing step can compnse the formation of a nucleic acid encoding the preselected polypeptide in which the coding sequence in the nucleic acid coding for one or more of the identified ammo acid residues is replaced by a coding sequence that encodes an am o acid different from the ammo acid present in the preselected polypeptide. The preselected polypeptide can be, for example, any one of the polypeptides given in SEQ ID NOS: 2, 4, 6, 8, 10, 12, 20, 22, 24, 26, 28, 30, 32, 34-40, 42, 44, 46, 48, 50, 52, 54, 56, or 58. The method can further compnse: contacting the modified polypeptide with an isoprenoid substrate under conditions effective for the compound to bind the polypeptide; and measuπng the ability of the modified polypeptide to catalyze the formation of a reaction product from the isoprenoid substrate. The isoprenoid substrate can be a monoteφene, a sesquiteφene, or a diteφene.

The invention also features a method of making a teφene synthase, compπsing creating a population of nucleic acid molecules that encode polypeptides, the population having members that differ from one another at one or more of nine codons specifying am o acids of a preselected teφene synthase having a region with about 20% or greater sequence identity to residues 265 to 535 of SEQ ID NO: 2, α-carbons of the nine amino acids having interatomic distances in Angstroms between the α-carbons that are 2.3 Angstroms of the interatomic distances given in Table 6. The center point of each α-carbon is positioned within a sphere having a radius of 2.3 Angstroms, and the center point of each sphere has the structural coordinates given in Table 5. In some embodiments, the codons specify amino acids as descπbed in Tables 1-2 or 3-4 of a preselected teφene synthase. A portion, or all, of the nucleic acid population is expressed so that a population of polypeptides is made. At least one member of the population of polypeptides is a mutant teφene synthase. The expressing step can comprise in vitro transcription and in vitro translation of the nucleic acid population. In some embodiments, the expressing step comprises cloning members of the nucleic acid population into an expression vector; introducing the expression vector into host cells and expressing the cloned nucleic acid population members in the host cells so that the population of polypeptides is made. The preselected teφene synthase polypeptide can be a monoteφene synthase, a sesquiteφene synthase, or a diteφene synthase. The host cells can be prokaryotic ceils or eukaryotic cells, including, without limitation, bacteπal cells, fungal cells, and animal cells, e.g., mammalian cells or insect cells. The host cells can also be plant cells, e.g., a cell from a Graminaceae plant, a cell from a Legummeae plant, a cell from a Solanaceae plant, a cell from a Brassicaeae plant or a cell from a Conifereae plant.

The invention also features a nucleic acid encoding a synthase as described herein, and a host cell containing such a nucleic acid. The invention also features a transgenic plant containing such a nucleic acid, or a transgeπic animal cell culture containing such a nucleic acid.

In some embodiments, a synthase polypeptide of the invention comprises a domain that contains an active site comprised of nine α-carbon atoms having the coordinates of Table 5, and interatomic distances between the α-carbons 2.3 angstroms of the distances given in Table 6. The α-carbon atoms align structurally in three dimensional space in the presence or absence of bound substrate or substrate analogue, with avian FPP synthase In another embodiment, a synthase of this invention compπses the following: (i) a first domain containing ammo acid residues that align in three-dimensional space (in solution or crystal form, and either having a bound or unbound substrate) with a glycosyl hydrolase catalytic core selected from the group consisting of (a) ammo acids 36-230 of glycosyl hydrolase (PDB code 3GLY) of Aspergillus awaπmoπ, and (b) ammo acids 36-230 of endogluconase CellB (PDB code 1 CLC), and (ii) a second domain that aligns structurally in three dimensional space with or without substrate or substrate analogues bound in the active site with avian FPP synthase. The second domain contains an active site compπsed of nine, sixteen or nineteen α-carbon atoms having the structural coordinates and interatomic distances of Tables 1-2, 3-4 or 5-6. These α-carbon atoms have R-groups attached thereto that can interact, either directly or indirectly, with an isoprenoid substrate. The invention also features a method for generating mutant teφene synthases possessing catalytic activity. The method compπses the steps of (a) providing a crystallographic model of a preselected cataiytically active teφene synthase having an active site, and (b) using the model to design a teφene synthase having at least one altered R-group in the active site relative to the preselected synthase. The invention also features teφene synthases having altered substrate specificity, methods of making the same, and procedures for generating three- dimensional structures thereof.

Although methods and mateπals similar or equivalent to those descπbed herein can be used to practice the invention, suitable methods and mateπals are descπbed below. All publications, patent applications, patents and other references mentioned herein are mcoφorated by reference in their entirety. Other aspects, embodiments, advantages, and features of the present invention will become apparent from the specification.

Brief Description of Drawings Figure 1. Schematic representation of tobacco 5-epi-aristolochene synthase (TEAS) with bound farnesyl hydroxyphosphonate (FHP), prepared using the RIBBONS software program of Carson, M. and Bugg, C, J. Mol. Graphics 4:121 (1986).

Figure 2. Structure of twenty natural amino acids showing α-carbons and associated R-groups.

Figure 3. Autoradiogram of an argentation thin-layer chromatogram of teφenoid hydrocarbon products made by TEAS and mutant TEAS enzymes using GGPP as a substrate. DM: W273S/C440W mutant TEAS enzyme.

Figure 4. Autoradiogram of an argentation thin-layer chromatogram of teφenoid hydrocarbon products made by TEAS and mutant TEAS enzymes using FPP as a substrate.

Brief Description of Tables Table 1. X-ray crystallographic structural coordinates for 19 α- carbons found in the active site of a teφene synthase.

Table 2. Interatomic distances in Angstroms between each α-carbon of Table 1. Each α-carbon occupies a sphere having a radius of 2.3 Angstroms. Interatomic distances are calculated from the center point of each sphere.

Table 3. X-ray crystallographic structural coordinates for 16 α- carbons found in the active site of a teφene synthase.

Table 4. Interatomic distances in Angstroms between each α-carbon of Table 3. Each α-carbon occupies a sphere having a radius of 2.3 Angstroms. Interatomic distances are calculated from the center point of each sphere.

Table 5. X-ray crystallographic structural coordinates for nine α- carbons found in the active site of a teφene synthase.

Table 6. Interatomic distances in Angstroms between each α-carbon of Table 5. Each α-carbon occupies a sphere having a radius of 2.3 Angstroms. Interatomic distances are calculated from the center point of each sphere.

Table 7. Ordered arrangement of R-groups not found associated with the α-carbons of Table 1. Table 8. Ordered arrangement of R-groups not found associated with the α-carbons of Table 3.

Table 9. Ordered arrangement of R-groups not found associated with the α-carbons of Table 5. Table 10. X-ray structural coordinates for TEAS having the substrate analog FHP bound in the active site.

Table 11. X-ray structural coordinates for TEAS in the absence of substrate.

Table 12. Alignment of residues 265-535 of TEAS with a limonene synthase, SEQ ID NO: 22, using the BLASTp alignment program.

Table 13. Alignment of residues 579 to 847 of SEQ ID NO:44 with SEQ ID NO:26, using the BLASTp program.

Table 14. Alignment of residues 265 to 535 of TEAS with SEQ ID NO:48, using the BLASTp program. Table 15. Alignment of residues 307 to 593 of SEQ ID NO:50 with

SEQ ID NO:56 using the BLASTp program.

Brief Description of the Seguence Listing SEQ ID NO:1 is the DNA coding sequence for a tobacco 5-epi- aristolochene synthase (TEAS) protein. Genbank No: Q40577.

SEQ ID NO:2 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:1.

SEQ ID NO:3 is the DNA coding sequence for a TEAS protein in which the codon for Tφ273 has been changed to a codon for Glu. SEQ ID NO:4 is the amino acid sequence for the W273E protein encoded by the TEAS DNA of SEQ ID NO:3.

SEQ ID NO:5 is the DNA coding sequence for a TEAS protein in which the codon for Tyr520 has been changed to a codon for Phe.

SEQ ID NO:6 is the amino acid sequence for the Y520F protein encoded by the TEAS DNA of SEQ ID NO:5.

SEQ ID NO:7 is the DNA coding sequence for a TEAS protein in which the codon for Tyr527 has been changed to a codon for Phe.

SEQ ID NO:8 is the amino acid sequence for the Y527F protein encoded by the TEAS DNA of SEQ ID NO:7. SEQ ID NO:9 is the DNA coding sequence for a TEAS protein in which the codon for Tφ273 has been changed to a codon for Ser and the codon for Cys440 has been changed to a codon for Tφ. SEQ ID NO: 10 is the amino acid sequence for the W273S/C440W protein encoded by the TEAS DNA of SEQ ID NO:9.

SEQ ID NO:11 is the DNA coding sequence for TEAS proteins in which the codons for Tyr406 and Leu407 have each been changed to the nucleotides NNS.

SEQ ID NO: 12 is the amino acid sequence for the population of Y406X/L407X proteins encoded by the TEAS DNA of SEQ ID NO:11, where X is any naturally occurring amino acid.

SEQ ID NO: 13 is a DNA primer sequence. SEQ ID NO: 14 is a DNA primer sequence.

SEQ ID NO: 15 is a DNA primer sequence.

SEQ ID NO: 16 is a DNA primer sequence.

SEQ ID NO: 17 is a DNA primer sequence.

SEQ ID NO: 18 is a DNA primer sequence. SEQ ID NO: 19 is the DNA coding sequence for a grand fir pinene synthase. Genbank Accession No: U87909.

SEQ ID NO:20 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO: 19.

SEQ ID NO:21 is the DNA coding sequence for a spearmint limonene synthase. Genbank Accession No: L13459.

SEQ ID NO:22 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:21.

SEQ ID NO:23 is the DNA coding sequence for a sage 1 , 8 cineole synthase. Genbank Accession No: AF051899. SEQ ID NO:24 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:23.

SEQ ID NO:25 is the DNA coding sequence for a sage bornyl diphosphate synthase. Genbank Accession No: AF051900.

SEQ ID NO:26 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:25.

SEQ ID NO:27 is the DNA coding sequence for a mint E-b-famesene synthase. Genbank Accession No: AF024615.

SEQ ID NO:28 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:27. SEQ ID NO:29 is the DNA coding sequence for a grand fir myrcene synthase. Genbank Accession No: U87908. SEQ ID NO:30 is the ammo acid sequence for the protein encoded by the DNA of SEQ ID NO:29.

SEQ ID NO:31 is the DNA coding sequence for a potato vetaspiradiene synthase. Genbank Accession No: AB022598. SEQ ID NO:32 is the ammo acid sequence for the protein encoded by the DNA of SEQ ID NO:31.

SEQ ID NO:33 is the geπomic DNA coding sequence for a cotton delta-cadinene synthase. Genbank Accession No: Y18484.

SEQ ID NOS:34-40 are the ammo acid sequences for the exoπs encoded by the DNA of SEQ ID NO:33.

SEQ ID NO:41 is the DNA coding sequence for a castor bean casbene synthase. Genbank Accession No: L32134.

SEQ ID NO:42 is the ammo acid sequence for the protein encoded by the DNA of SEQ ID NO:41. SEQ ID NO:43 is the DNA coding sequence for a yew taxadiene synthase. Genbank Accession No: U48796.

SEQ ID NO:44 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:43.

SEQ ID NO:45 is the DNA coding sequence for a grand fir E-alpha- bisabolene synthase. Genbank Accession No: AF006194.

SEQ ID NO:46 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:45.

SEQ ID NO:47 is the DNA coding sequence for a grand fir delta- seiinene synthase. Genbank Accession No: U92266. SEQ ID NO:48 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:47.

SEQ ID NO:49 is the DNA coding sequence for a grand fir gamma- humulene synthase. Genbank Accession No: U92267.

SEQ ID NO:50 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:49.

SEQ ID NO:51 is the DNA coding sequence for a tomato germacrene C synthase. Genbank Accession No: AF035631.

SEQ ID NO:52 is the amino acid sequence for the protein encoded by the DNA of SEQ ID NO:51. SEQ ID NO:53 is the DNA coding sequence for a sage +sabinene synthase. Genbank Accession No: AF051901. SEQ ID NO-54 is the ammo acid sequence for the protein encoded by the DNA of SEQ ID NO:53

SEQ ID NO-55 is the DNA coding sequence for a grand fir abietadiene synthase Genbank Accession No U50768 SEQ ID NO 56 is the ammo acid sequence for the protein encoded by the DNA of SEQ ID NO-55.

SEQ ID NO 57 is the DNA coding sequence for a grand fir limonene synthase. Genbank Accession No- AF006193.

SEQ ID NO 58 is the ammo acid sequence for the protein encoded by the DNA of SEQ ID NO:57.

Detailed Description The following terms are used herein:

"α-carbon" refers to the chiral carbon atom found in an ammo acid residue. Four substituents are covalentiy bound to the α-carbon, including an ammo group, a carboxyl group, a hydrogen atom, and an R-group.

"R-group" refers to a substituent attached to the α-carbon of an ammo acid residue that is not involved in peptide bond formation in a protein. An R-group is an important determinant of the overall chemical character of an ammo acid. The twenty naturally occumng ammo acids found in proteins and the R-groups associated with the α-carbon of each ammo acid are listed in Figure 2. The three-letter and one- letter abbreviations for naturally occumng ammo acids are sometimes used herein to refer to the R-group associated with a particular ammo acid.

"Naturally occumng ammo acid" includes L-isomers of the twenty ammo acids naturally occumng in proteins. Naturally occumng ammo acids are glycine, alanme, valine, leuαne, isoieucine, seπne, methionme, threonme, phenylalanine, tyrosme, tryptophan, cysteine, prolme, histidme, aspartic acid, asparagine, glutamic acid, glutamine, arginme, and lysme. Unless specially indicated, all amino acids referred to in this application are in the L-form. Three-letter and one-letter abbreviations are sometimes used herein to refer to naturally occumng ammo acids. These abbreviations are known in the art.

"Unnatural ammo acid" includes ammo acids that are not naturally found in proteins. Examples of unnatural ammo acids included herein are racemic mixtures of selenocysteiπe and selenomethionme. In addition, unnatural ammo acids include the D or L forms of norleucme, para-nitrophenylalanine, homophenylalanine, para-fluorophenylalanine, 3-amino-2-benzylpropionic acid, homoarginine, D- phenylalanine, and the like.

"Positively charged amino acid" includes any naturally occurring or unnatural amino acid having an R-group that carries a positive charge under normal physiological conditions. Examples of positively charged, naturally occurring amino acids include arginine and lysine.

"Negatively charged amino acid" includes any naturally occurring or unnatural amino acid having an R-group that carries a negative charge under normal physiological conditions. Examples of negatively charged, naturally occurring amino acids include aspartic acid and glutamic acid.

"Hydrophobic amino acid" includes any naturally occurring or unnatural amino acid having an uncharged, nonpolar side chain under normal physiological conditions. Examples of naturally occurring hydrophobic amino acids are leucine, isoleucine, valine and methionine. "Hydrophilic amino acid" includes any naturally occurring or unnatural amino acid having a charged polar side chain. Examples of naturally occurring hydrophilic amino acids include serine, threonine and cysteine.

"Mutant teφene synthase" or "mutated teφene synthase" refers to a synthase polypeptide having a primary amino acid sequence. The center point of the α-carbon of nine residues of the polypeptide is positioned within a sphere having a radius of 2.3 Angstroms; the center points of the nine spheres have the structural coordinates of Table 5 or coordinates which can be rotated and/or translated to coincide with the coordinates of Table 5. The relative interatomic distances between the nine α-carbons is 2.3 angstroms of the interatomic distances given in Table 6. Each α-carbon has an associated R-group. A mutant synthase differs from a non- mutant synthase in the ordered arrangement of R-groups associated with the nine α- carbons. A mutant synthase has an ordered arrangement of R-groups on the nine α- carbons other than the ordered arrangements of R-groups listed in Table 9. R- groups associated with other α-carbons of the synthase primary amino acid sequence may or may not be the same as in a non-mutated synthase.

In some embodiments, a mutant synthase refers to a synthase in which the center point of the α-carbon of sixteen residues of the polypeptide is positioned within a sphere having a radius of 2.3 Angstroms; the center points of the sixteen spheres have the structural coordinates of Table 3 or coordinates which can be rotated and/or translated to coincide with the coordinates of Table 3. The relative interatomic distances between the nine α-carbons is 2.3 angstroms of the interatomic distances given in Table 4. Each α-carbon has an associated R-group. A mutant synthase differs from a non-mutant synthase in the ordered arrangement of R-groups associated with the sixteen α-carbons. A mutant synthase has an ordered arrangement of R-groups on the sixteen α-carbons other than the ordered arrangements of R-groups listed in Table 8. R-groups associated with other α- carbons of the synthase primary amino acid sequence may or may not be the same as in a non-mutated synthase.

In some embodiments, a mutant synthase refers to a synthase in which the center point of the α-carbon of nineteen residues of the polypeptide is positioned within a sphere having a radius of 2.3 Angstroms; the center points of the nineteen spheres have the three dimensional coordinates of Table 1 or coordinates which can be rotated and/or translated to coincide with the coordinates of Table 1. The relative interatomic distances between the nineteen α-carbons is 2.3 angstroms of the interatomic distances given in Table 2. Each α-carbon has an associated R- group. A mutant synthase differs from a non-mutant synthase in the ordered arrangement of R-groups associated with the nineteen α-carbons. A mutant synthase has an ordered arrangement of R-groups on the nineteen α-carbons other than the ordered arrangements of R-groups listed in Table 7. R-groups associated with other α-carbons of the synthase primary amino acid sequence may or may not be the same as in a non-mutated synthase. "Nonmutated synthase" or "non-mutant synthase" includes a synthase having a primary amino acid sequence comprising nine, sixteen, or nineteen amino acid residues. The center point of each α-carbon of these residues is positioned within a sphere having a radius of 2.3 Angstroms; the center points of the spheres have the three dimensional coordinates of Tables 5, 3, or 1 , respectively, or coordinates which can be rotated and/or translated to coincide with the coordinates of Tables 5, 3, or 1. The relative interatomic distances between the nine, sixteen, or nineteen α-carbons is 2.3 angstroms of the interatomic distances given in Tables 6, 4, or 2, respectively. Each α-carbon has an associated R-group. A non-mutant synthase has an ordered arrangement of R-groups on the nine, sixteen, or nineteen α-carbons as listed in Tables 9, 8, or 7, respectively.

"Degenerate variations thereof" refers to variants of a gene coding sequence by which the same polypeptide is encoded by different nucleotide sequences, due to the degeneracy of the genetic code. For example, synthases of the present invention have a primary amino acid sequence. Degenerate synthase variations are different nucleic acid coding sequences that nevertheless encode the same primary amino acid sequence due to the degeneracy of the genetic code. "Expression" refers to transcription of a gene or nucleic acid molecule and the translation of that nucleic acid into a polypeptide. Expression of genes also involves processing of RNA into mRNA in eukaryotic systems. It is not necessary for the genes to integrate into the genome of a cell in order to achieve expression. This definition is not limited to expression in a particular system or a particular cell type and includes, without limitation, stable, transient, in vitro, and in vivo expression.

"Promoter" and "promoter regulatory element", refers to a nucleic acid that is involved in controlling expression of a gene. Promoter regulatory elements, and the like, from a variety of sources can be used efficiently to promote gene expression. Promoter regulatory elements include constitutive, tissue-specific, developmental-specific, inducible, subgenomic promoters, and the like. Promoter regulatory elements may also include certain enhancer elements or silencing elements that improve or regulate transcriptional efficiency.

"Active Site" refers to a site in a teφene synthase that binds the hydrophobic portion of a teφene substrate, GPP, FPP, and/or GGPP. The active site can, under certain conditions, catalyze a biosynthetic reaction that allows one or more reaction products to be produced.

"Altered enzymatic specificity" includes an alteration in the ability of a mutant synthase to use a particular teφene substrate or a change in the profile of reaction product(s) from a mutant synthase, compared to the substrate specificity of and the reaction products made by a corresponding non-mutated synthase. Altered specificity may include the ability of a synthase to exhibit different enzymatic parameters relative to a non-mutated synthase (Km, Vmax, etc), and/or to produce products that are different from those that are produced by a corresponding non- mutant synthase.

"Structure coordinates" or "structural coordinates" refers to Cartesian coordinates (x, y, and z positions) derived from mathematical equations involving Fourier synthesis as determined from patterns obtained via diffraction of a monochromatic beam of X-rays by the atoms (scattering centers) of a synthase molecule in crystal form. Diffraction data are used to calculate electron density maps of repeating protein units in the crystal (unit cell). Electron density maps are used to establish the positions of individual atoms within a crystal's unit cell. The absolute values for structural coordinates listed herein convey relative spatial relationships between atoms because the absolute values ascribed to structural coordinates can be changed by rotational and/or translational movement along the x, y and/or z axes, together or separately, while maintaining the same relative spatial relationships among atoms. Thus, a teφene synthase whose absolute values for a set of structural coordinates can be rotationally or translationally adjusted to coincide with the particular values listed in Tables 1 , 3, or 5 is considered to have the same structural coordinates as those of Tables 1 , 3 or 5. An example of structural coordinates that coincide with the absolute values listed herein after rotation and/or translation are the coordinates of Table 11.

"Heavy atom derivatization" refers to a method of producing a chemically modified form of a synthase crystal. In practice, a crystal is soaked in a solution containing heavy atom salts or organometallic compounds, e. g., lead chloride, gold thiomalate, thimerosal, uranyl acetate and the like, which can diffuse through the crystal and bind to the protein's surface. Locations of the bound heavy atoms can be determined by X-ray diffraction analysis of the soaked crystal. The information is then used to construct phase information which can then be used to construct three-dimensional structures of the enzyme as described in Blundel, T. L., and Johnson, N. L., Protein Crystallography, Academic Press (1976). "Unit cell" refers to a basic parallelepiped shaped block. Regular assembly of such blocks may construct the entire volume of a crystal. Each unit cell comprises a complete representation of the unit pattern, the repetition of which builds up the crystal.

"Mutagenesis" refers to the substitution of a different amino acid residue at a particular position in the primary amino acid sequence of a protein, thereby changing the R-group present at that position. Mutagenesis can be most easily performed by changing the coding sequence of a nucleic acid encoding the protein so that the coding sequence in the nucleic acid specifies an amino acid residue different from the residue initially present at that position. "Space Group" refers to the arrangement of symmetry elements within a crystal.

"Molecular replacement" refers to the generation of a preliminary model of a synthase whose structural coordinates are unknown, by orienting and positioning a molecule whose structural coordinates are known within the unit cell of the unknown crystal so as best to account for the observed diffraction pattern of the unknown crystal. Phases can then be calculated from this model and combined with the observed amplitudes to give an approximate Fourier synthesis of the structure whose coordinates are unknown. This in turn can be subject to any of the several forms of refinement to provide a final, accurate structure of the unknown crystal (Lattman, E., 1985, in Methods in Enzymology, 115:55-77; Rossmann, MG., ed., "The Molecular Replacement Method" 1972, Int. Sci. Rev. Ser., No. 13, Gordon & Breach, New York). Using structure coordinates and interatomic distance matrices, molecular replacement may be used to determine the structural coordinates of a crystalline mutant, homologue, or a different crystal form of terpene synthase.

"Recombinant protein" includes a protein that is chemically synthesized or derived biosynthetically from an isolated gene. "Gene" includes naturally deπved or genetically manipulated nucleic acids that contain the information needed to produce a polypeptide.

"Nucleic acid" includes any genetic material compnsed of the nucleotides guanme, adenme, thymine, cytosme, uracil, inosme and the like. Nucleic acids may be single-, double-, or triple stranded. Nucleic acids may be deoxyπbonucleic acid or πbonucleic acid.

"Genetically manipulated" includes genes that have been modified to contain a different nucleotide sequence from that present in a preselected nulceic acid. Genes can be manipulated by synthetically or via traditional cloning, PCR, chemical gene synthesis, direct or random mutagenesis, and gene shuffling. Genetically manipulated also includes the process of making genes that are degenerate variations of nucleic acids encoding preselected proteins.

"First domain" includes polypeptides having a first and second end wherein the first end can have an ammo terminal amino acid with a free amino group and can be linked by a peptide bond to a second ammo acid. The first end may also be modified through acetylation and the like. The second end of the first domain may or may not have a free carboxyl terminal group.

"Second domain" includes polypeptides having a first and second end wherein the first end can have an amino terminal amino acid and can be linked by a peptide bond to a second amino acid. The second end of the second domain may or may not have a carboxyl terminal group. Typically, the first end of the second domain is linked to the second end of the first domain via a peptide bond.

"Isoprenoid substrate" refers to the C10, C15, and C20 molecules, named geranyl diphosphate (GPP), famesyl diphosphate (FPP), and geranylgeranyl diphosphate (GGPP), respectively. "Sequence identity" or "percent sequence identity" refers to the percentage of amino acids or nucleotides that occupy the same relative position when two protein sequences or nucleic acid sequences, a query sequence and a subject sequence, are aligned. The number of ammo acid or nucleotide residues that are identical between both the subject and query sequences are counted, divided by the number of residues in the query sequence, and multiplied by 100. The process is repeated until the alignment resulting in the highest percent sequence identity is found. Percent sequence identity can be determined by visual inspection and/or by using various computer programs, e.g., MegAlign (DNASTAR, Inc., Madison, Wisconsin) or BLAST programs available on the world wide web from the National Center for Biotechnology Information (NCBI). Gaps of one or more residues may sometimes be inserted to maximize sequence alignments to structurally conserved domains of the query sequence, i.e., α-helices, β-sheets and loops.

"Monoterpene product" refers to linear, cyclized, and/or hydroxylated reaction products made from the substrate GPP. "Sesquiteφene product" refers to linear, cyclized, and/or hydroxylated reaction products made from the substrate FPP. "Diteφene product" refers to linear, cyclized, and/or hydroxylated reaction products made from the substrate GGPP.

The present invention relates to teφene synthases and mutants thereof from which the position of specific α-carbon atoms and R-groups associated therewith comprising the active site can be determined in three-dimensional space. The invention also relates to structural coordinates of the synthases, use of the structural coordinates to develop structural information related to synthase homologues, mutants, and the like, and to crystal forms of such synthases. Furthermore, the invention provides a method whereby α-carbon structural coordinates for atoms comprising the active site of a preselected teφene synthase can be used to develop synthases in which R-groups associated with active site α- carbon atoms are different from the R-groups found in the preselected teφene synthase. In addition, the present invention provides for the production of novel teφene synthases based on the structural information provided herein and for the use of such synthases to make a variety of isoprenoid compounds.

The present invention further provides, for the first time, crystals of a synthase, as exemplified by tobacco 5-epi-aristolochene synthase (TEAS), which are grown in the presence or absence of substrate and substrate analogues, thus allowing definition of the structural coordinates associated therewith. The structural coordinates allow determination of the α-carbon atoms comprising the active site and R-groups associated therewith. The crystals of the present invention belong to the tetragonal space group P4i2i2; the unit cell dimensions vary by a few angstroms between crystals but on average a = 126 angstroms, c = 122 angstroms, a=b, α = 90, β = 90, and γ = 90.

Structural coordinates are preferably obtained at a resolution of about 2.2 to about 2.8 angstroms for a synthase in the presence and in the absence of bound substrate or substrate analog. Coordinates for a synthase with a substrate analog bound in the active site are given in Table 10. Coordinates for a synthase in the absence of a substrate analog bound in the active site are given in Table 11. Those skilled in the art understand that a set of structure coordinates determined by X-ray crystallography is not without standard error. Therefore, for the puφose of this invention, any set of structure coordinates wherein the active site α-carbons of a synthase, synthase homologue, or mutants thereof, have a root mean square deviation less than 2.3 angstroms when superimposed using the structural coordinates listed in Table 1 , 3, or 5, are considered identical.

A schematic representation of the three-dimensional shape of a synthase is shown in Figure 1 which was prepared by RIBBONS (Carson and Bugg, 1986, J. Mol. Graphics, 4:121). The synthase shown in Figure 1 consists entirely of α-helices and short connecting loops and turns, organized into first and second structural domains.

In one embodiment, an isolated synthase of the invention comprises sixteen active site α-carbons having the structural coordinates of Table 3 and the relative distances 2.3 angstroms of the distances given in Table 4. The active site α-carbons of Table 3 generally are not all contiguous, i.e., are not adjacent to one another in the primary amino acid sequence of a synthase, due to intervening amino acid residues between various active site α-carbons. On the other hand, it should be appreciated that some of the active site α-carbons can be adjacent to one another in some instances. In the embodiment depicted in the TEAS Y527F protein (SEQ ID NO:8), for example, active site α-carbons are adjacent to one another in the primary amino acid sequence at positions 402, 403 and 404, respectively, whereas active site α-carbons at residues 273 and 294 are separated and thus are not adjacent. Thus, the numbering of active site α-carbons given in Tables 1 , 2, 3, 4, 5, or 6 is merely for convenience and such α-carbons may reside at any position in the primary amino acid sequence that achieves the structural coordinates given in Tables 1 , 3, or 5 and the relative interatomic distances 2.3 angstroms given in Tables 2, 4, or 6.

An appropriate combination of R-groups, linked to active site α- carbons, can facilitate the formation of one or more desired reaction products. The combination of R-groups selected for use in a teφene synthase of the invention can be any combination other than the ordered arrangements of R-groups and corresponding active site α-carbons shown in Tables 7, 8, or 9. An illustrative example of a suitable arrangement of R-groups and α-carbons is Cys, Tφ, He, He, Ser, Thr, Thr, Tyr, Leu, Cys, Val, Thr, Phe, Asp, Tyr and Thr, associated with active site α-carbons 1 to 16, respectively, of Table 3. Another example of a suitable arrangement of R-groups and α-carbons is Cys, Tφ, lie. He, Ser, Thr, Thr, Tyr, Leu, Cys, Val, Thr, Tyr, Asp, Phe, and Thr at active site alpha-carbons 1 to 16, respectively, of Table 3. In some embodiments, a synthase of the invention may have primary amino acid sequences as listed in SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, and SEQ ID NO: 10, DNA molecules encoding the same, which are listed in SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, and SEQ ID NO:9, respectively, and degenerate variations thereof. Typically, R-groups found on active site α-carbons are those found in naturally occurring amino acids. See, e.g., Figure 2. In some embodiments, however, R-groups other than naturally occurring amino acids can be used. Some arrangements of R-groups and active site α-carbons result in mutant teφene synthases that form reaction products. Such enzymatically active synthases and their co esponding genes are useful to make known terpenoid hydrocarbons, e.g., monoterpenes such as pinene, sesquiteφenes such as delta- cadinene and diteφenes such as abietadiene. Other enzymatically active synthases can be used to make novel teφenoid products.

Some arrangements of R-groups and active site α-carbons may result in mutant teφene synthases that do not form reaction product(s) at a desired rate. Such synthases and their genes are useful as controls in analyses of product formation by enzymatically active mutant synthases. Such synthases and their genes can also be useful in analyses of translation of enzymatically active mutant synthase genes, or as nutritional supplements. Such synthases can be attached to Sepharose beads and used for affinity purification of isoprenoid compounds from crude preparations. In addition, such synthases and their genes can also be useful to develop reagents for various puφoses, e.g., immunolσgical reagents to monitor expression of a teφene synthase protein or nucleic acid probes or primers to monitor inheritance of a teφene synthase gene in a plant breeding program.

In some embodiments, the α-carbon backbone of a synthase first domain aligns structurally with the catalytic core of glycosyl hydrolases, as exemplified by glucoamylase (Brookhaven Protein Database (PDB) code 3GLY) from Aspergillus awamori (Aleshin et al., 1994, J. Mol. Biol., 238:575) and endoglucanase CelD (PDB code ICLC) from Clostridium theπnocelum (Juy et al., 1992, Nature, 357:89), and the α-carbon backbone of a synthase second domain, which contains the active site, aligns structurally with avian famesyl diphosphate synthase (FPS), wherein the active site is comprised of 9, 16, or 19 amino acid residues with α-carbon structural coordinates as listed in Tables 1 , 3, or 5 and interatomic distances as described in Tables 2, 4, or 6. Such α-carbons have an ordered arrangement of R- groups different from that observed in a non-mutated synthase.

In the present invention, the first domain forms a twisted α-barrel made up of eight short (10 to 15 amino acid residues) helices surrounding a surface cavity filled by ordered water molecules when hydrated. The second domain comprises a two-layered barrel of α-helices surrounding a hydrophobic and aromatic- rich active site pocket. Typically, the second domain contains a substrate binding site. As exemplified in Figure 1, helix H is disrupted between segments H1 and H2 by an amino acid such as proline, but its interhelical packing with helix G is accommodated by a corresponding kink in helix G between G1 and G2. Within this kink, hydrogen bonds between a hydroxyl group, such as that found on a threonine, and the carbonyl oxygen of other amino acids disrupt the main chain intrahelical hydrogen bonding of helix G thus assisting in producing the structure as determined. As exemplified by TEAS, teφene synthases of the present invention can have a first domain segment comprising helices A, B, and C (an A-C loop), and a second domain comprising helices J and K (a J-K loop) (Figure 1 ). The ordering of these loops upon substrate binding results in a closed, solvent-inaccessible active site pocket. As the J-K loop becomes ordered, a lid-type structure is formed that clamps down over the active site entrance in the presence of substrate and an extended aromatic patch deep within the active site pocket is formed. As the A-C loop becomes ordered, it translates inward toward the active site, positioning certain R groups in this loop at or near the active site. Thus, substrate binding to the active site results in a change in protein conformation.

To identify or create mutant teφene synthases, sequence alignments can be performed to locate specific residues and α-carbons in a preselected polypeptide that have the structural coordinates and interatomic distances of Tables 1-2, 3-4 or 5-6. The preselected polypeptide is used as the subject sequence in the alignment, e.g., the full-length primary amino acid sequence, a region 190 residues in length, a region 220 residues in length, or a region 300 residues in length. The alignment can use residues 265 to 535 of TEAS (SEQ ID NO: 2), which includes the α-carbons of Tables 1 , 3 or 5, as the query sequence to align with the preselected polypeptide. The preselected polypeptide and the query sequence can be aligned using the BLASTp 2.0.9 computer program with a BLOSUM 62 scoring matrix, an expect value of 10, a gap open value of 11 , an x_dropoff value of 50, a gap extension value of 1 , a wordsize of 3 and no filtering of low complexity sequences. As an alternative, the BLASTp 2.0.9 program can be used with a BLOSUM 50 scoring matrix, an expect value of 10, a gap open value 13, an x_dropoff value of 50, a gap extension value of 2, a wordsize of 3 and no filteπng of low complexity sequences Other parameter values can also be used, e g , a gap extension value from 0 to 4 See Altschul, et al., Nucl. Acids Res 25 3389-3402

Regions of the preselected polypeptide with significant sequence identity to residues 265-535 of TEAS, e.g., 20% or greater sequence identity, 25% or greater sequence identity, 35% or greater sequence identity, 40% or greater sequence identity, 50% or greater sequence identity, 60% or greater sequence identity, 70% or greater sequence identity, or 80% or greater sequence identity are examined for specific residues that align with the TEAS residues corresponding to those listed in Tables 1 , 3, or 5. In some cases, the output of the computer program alignment identifies a specific residue in the preselected polypeptide for each of the nine, sixteen, or nineteen residues in the query sequence having the structural coordinates and interatomic distances of Tables 1-2, 3-4 or 5-6, with or without gaps introduced by the alignment program. In other cases, a gap is introduced by the alignment program in either the query sequence or the subject sequence such that no direct alignment or a misalignment occurs between one or more of the nine, sixteen, or nineteen residues in the query sequence that are of interest. In either case, the output can be visually inspected, and specific residues can be chosen in the subject sequence after adjusting the alignment so that alpha-helices and beta- sheet regions in the query sequence are maintained and that gaps or insertions in the subject sequence align with loop regions of the query sentence.

Sequence alignments suggest that other teφene synthases have regions with 20% or greater sequence identity to residues 265-535 of TEAS. Therefore, a region of a teφene synthase other than TEAS can be used as the query sequence, e.g., regions of terpene synthases given in SEQ ID NOS: 4, 6, 8, 10, 12, 20, 22, 24, 26, 28, 30, 32, 34-40, 42, 44, 46, 48, 50, 52, 54, 56, or 58, that have significant sequence identity to residues 265-535 of SEQ ID NO: 2. For example, large sequence insertions are present at the ammo terminus in taxadiene synthase (SEQ ID NO: 44) with respect to TEAS, or are within solvent-exposed loops in the ammo-terminal domain. Thus, regions of taxadiene synthase with greater than 20% sequence identity to SEQ ID NO: 2 are closer to the carboxy-terminal end, e.g., from residue 579 to residue 847 of SEQ ID NO: 44.

Useful regions of other teφene synthases that can be used as the query sequence include, without limitation, residues 343 to 606 of SEQ ID NO: 20, 316 to 586 of SEQ ID NO: 22, residues 352 to 622 of SEQ ID NO: 58, residues 272 to 540 encoded by SEQ ID NO: 33, residues 319 to 571 of SEQ ID NO: 42, residues 579 to 847 of SEQ ID NO: 44, residues 495 to 767 of SEQ ID NO: 46, residues 295 to 564 of SEQ ID NO" 48, residues 307 to 578 of SEQ ID NO 50, residues 264 to 533 of SEQ ID NO: 52, residues 585 to 853 of SEQ ID NO 56, residues 307 to 574 of SEQ ID NO: 54, residues 309 to 577 of SEQ ID NO 24, residues 315 to 584 of SEQ ID NO: 26, residues 265 to 536 of SEQ ID NO: 28, residues 342 to 612 of SEQ ID NO: 30 and residues 273 to 541 of SEQ ID NO. 32.

One or more of the specific residues in the subject sequence that align with residues in the query sequence are mutated in the preselected polypeptide, e.g, by making mutations in a nucleic acid encoding the polypeptide. The mutant terpene synthase thus created can then be expressed in a host cell and the protein evaluated for enzymatic activity, if desired.

Mutant proteins of the present invention may be prepared in a number of ways including but not limited to oligonucleotide-directed mutagenesis, deletion, chemical mutagenesis, and the like. One or more R-groups associated with the active site α-carbon atoms in a teφene synthase are changed by alteππg the nucleotide sequence of the corresponding gene. For example, a mutation can be introduced into SEQ ID NO:1 , the nucleotide sequence for TEAS, at codons encoding one or more of the following sixteen α-carbons: α-carbon 1 = Cys 270; α- carbon 2 = Tφ 273; α-carbon 3 = He 294; α-carbon 4 = He 297; α-carbon 5 = Ser298; α-carbon 6 = Thr 402; α-carbon 7 = Thr 403; α-carbon 8 = Tyr 404; α-carbon 9 = Leu 407; α-carbon 10 = Cys 440; α-carbon 11 = Val 516; α-carbon 12 = Thr 519; α-carbon 13 = Tyr 520; α-carbon 14 = Asp 525; α-carbon 15 = Tyr 527; or α-carbon 16 = Thr 528. The protein encoded by the mutant gene is then produced by expressing the gene in, for example, a bacteπal or plant expression system. Alternatively, synthase mutants may be generated by site specific replacement of a particular am o acid with an unnaturally occumng am o acid. As such, synthase mutants may be generated through replacement of an ammo acid residue or a particular cysteine or methionine residue with selenocysteine or selenomethionme. This may be achieved by growing a host organism capable of expressing either the wild-type or mutant polypeptide on a growth medium depleted of natural cysteine or methionine or both and growing on medium ennched with either selenocysteme, selenomethionme, or both. These and similar techniques are descπbed in Sambrook et al., (Molecular Cloning, A Laboratory Manual, 2nd Ed. (1989) Cold Spπng Harbor Laboratory Press). Another suitable method of creating mutant synthases of the present invention is based on a procedure descπbed in Noel and Tsal (1989) J. Cell. Biochem., 40:309-320. In so doing, the nucleic acid encoding the synthase can be synthetically produced using oligonucleotides having overlapping regions, the oligonucleotides being degenerate at specific bases so that mutations are induced. According to the present invention, nucleic acid sequences encoding a mutated synthase can be produced by the methods described herein, or any alternative methods available to the skilled artisan. In designing the nucleic acid sequence (gene) of interest, it may be desirable to reengineer the gene for improved expression in a particular expression system. For example, it has been shown that many bacterially derived genes do not express well in plant systems. In some cases, plant-derived genes do not express well in bacteria. This phenomenon may be due to the non-optimal G+C content or A+T content of the gene relative to the expression system being used. For example, the very low G+C content of many bacterial genes results in the generation of sequences mimicking or duplicating plant gene control sequences that are highly A+T rich. The presence of A+T rich sequences within the genes introduced into plants (e.g., TATA box regions normally found in gene promoters) may result in aberrant transcription of the gene(s). In addition, the presence of other regulatory sequences residing in the transcribed mRNA (e.g. polyadenylation signal sequences (AAUAAA) or sequences complementary to small nuclear RNAs involved in pre-mRNA splicing) may lead to RNA instability. Therefore, one goal in the design of genes is to generate nucleic acid sequences that have a G+C content that affords mRNA stability and translation accuracy for a particular expression system. Due to the plasticity afforded by the redundancy of the genetic code

(i.e., some amino acids are specified by more than one codon), evolution of the genomes of different organisms or classes of organisms has resulted in differential usage of redundant codons. This "codon bias" is reflected in the mean base composition of protein coding regions. For example, organisms with relatively low G+C contents utilize codons having A or T in the third position of redundant codons, whereas those having higher G+C contents utilize codons having G or C in the third position. Therefore, in reeπgineering genes for expression, one may wish to determine the codon bias of the organism in which the gene is to be expressed. Looking at the usage of the codons as determined for genes of a particular organism deposited in GenBank can provide this information. After determining the bias thereof, the new gene sequence can be analyzed for restriction enzyme sites as well as other sites that could affect transcription such as exon:intron junctions, polyA addition signals, or RNA polymerase termination signals.

Genes encoding synthases can be placed in an appropriate vector, depending on the artisan's interest, and can be expressed using a suitable expression system. An expression vector, as is well known in the art, typically includes elements that permit replication of said vector within the host ceil and may contain one or more phenotypic markers for selection of cells containing said gene. The expression vector will typically contain sequences that control expression such as promoter sequences, ribosome binding sites, and translational initiation and termination sequences. Expression vectors may also contain elements such as subgenomic promoters, a repressor gene or various activator genes. The artisan may also choose to include nucleic acid sequences that result in secretion of the gene product, movement of said product to a particular organelle such as a plant plastid (see U.S. Patent Nos. 4,762,785; 5,451 ,513 and 5,545,817), or other sequences that increase the ease of peptide purification, such as an affinity tag. A wide variety of expression control sequences are useful in expressing mutated synthases when operably linked thereto. Such expression control sequences include, for example, the early and late promoters of SV40 for animal cells, the lac system, the tφ system, major operator and promoter systems of phage λ, and the control regions of coat proteins, particularly those from RNA viruses in plants. In E. coii, a useful transcriptionai control sequence is the T7 RNA polymerase binding promoter, which can be incoφorated into a pET vector as described by Studier et al., (1990) Methods Enzymology, 185:60-89.

For expression, a desired gene should be operably linked to the expression control sequence and maintain the appropriate reading frame to permit production of the desired synthase. Any of a wide variety of well-known expression vectors are of use in the present invention. These include, for example, vectors consisting of segments of chromosomal, non-chromosomal and synthetic DNA sequences such as those derived from SV40, bacterial plasmids (including those from E. coii such as col E1, pCR1, pBR322 and derivatives thereof, pMB9), wider host range plasmids such as RP4, phage DNA such as phage λ, NM989, M13, and other such systems as described by Sambrook et al., (Molecular Cloning, A Laboratory Manual, 2nd Ed. (1989) Cold Spring Harbor Laboratory Press).

A wide variety of host cells are available for expressing synthase mutants of the present invention. Such host ceils include, without limitation, bacteria such as E. coii, Bacillus and Streptomyces, fungi, yeast, animal ceils, plant cells, insect cells, and the like. Preferred embodiments of the present invention include teφene synthase mutants that are expressed in E. coii or in plant cells. Said plant cells can either be in suspension culture or a culture on a solid support such as an agar-based medium. Genes encoding synthases of the present invention can also be expressed in transgenic plant cells. In order to produce transgenic plants, vectors containing a nucleic acid construct encoding a mutant teφene synthase are inserted into the plant genome. Preferably, these recombinaπt vectors are capable of stable integration into the plant genome. One variable in making a transgenic plant is the choice of a selectable marker gene. A selectable marker gene is used to identify transformed cells against a high background of untransformed cells. Such selectable marker genes include but are not limited to aminoglycoside phosphotransferase gene of transposon Tn5 (Aph II) which encodes resistance to the antibiotics kanamycin, neomycin, and G418, as well as those genes which encode for resistance or tolerance to glyphosate, hygromycin, methotrexate, phosphinothricin, imidazolinones, sulfonylureas, and triazolophyrimidine herbicides, such as chiorosulfuron, bromoxynil, dalapon and the like. In addition to a selectable marker gene, it may be desirable to use a reporter gene. In some instances a reporter gene may be used with a selectable marker. Reporter genes allow the detection of transformed cell and may be used at the discretion of the artisan. A list of these reporter genes is provided in K. Weising et al., 1988, Ann. Rev. Genetics, 22:421. The genes are expressed either by promoters expressing in all tissues at all times (constitutive promoters), by promoters expressing in specific tissues (tissue-specific promoters), promoters expressing at specific stages of development (developmental promoters), and/or promoter expression in response to a stimulus or stimuli (inducible promoters). The choice of these is at the discretion of the artisan. Several techniques exist for introducing foreign genes into plant cells, and for obtaining plants that stably maintain and express the introduced gene. Such techniques include acceleration of genetic material coated directly into cells (U.S. Patent 4,945,050). Plant may also be transformed using Agrobacterium technology (U.S. Patents 5,177,010, 5,104,310, 5.149,645, 5,469,976, 5,464,763, 4,940,838, 4,693,976, 5,591,616, 5,231,019, 5,463,174, 4,762,785, 5,004,863, and 5,159,135; European Patent Applications 116718, 290799, 320500, 604662, 627752, 0267159, and 0292435. Other transformation technologies include whiskers technology, see U. S. Patents 5,302,523 and 5,464,765. Electroporation technology has also been used to transform plants, see WO 87/06614, WO 92/09696 and WO 93/21335 and U.S. Patents 5,472,869 and 5,384,253. Viral vector expression systems can also be used such as those described in U.S. Patent 5,316,931, 5,589,367, 5,811,653, and 5,866,785.

In addition to numerous technologies for transforming plants, the type of tissue that is contacted with the genes of interest may vary as well. Suitable tissue includes, but is not limited to, embryogenic tissue, callus tissue, hypocotyl, meristem and the like. Almost all plant tissues may be transformed during dedifferentiation using the appropriate techniques described herein. Regardless of the transformation system used, a gene encoding a mutant synthase is preferably incorporated into a gene transfer vector adapted to express said gene in a plant cell by including in the vector an expression control sequence (plant promoter regulatory element). In addition to piant promoter regulatory elements, promoter regulatory elements from a variety of sources can be used efficiently in plant cells to express foreign genes. For example, promoter regulatory elements of bacterial origin, such as the octopine synthase promoter, the nopaline synthase promoter, the mannopine synthase promoter may be used. Promoters of viral origin, such as the cauliflower mosaic virus (35S and 19S) are also desirable. Plant promoter regulatory elements also include, but are not limited to, ribulose-1 ,6-bisphosphate carboxylase small subunit promoter, beta-conglycinin promoter, phaseolin promoter, ADH promoter, heat-shock promoters, and tissue specific promoters and the like. Numerous promoters are available to skilled artisans for use at their discretion. It should be understood that not all expression vectors and expression systems function in the same way to express the mutated gene sequences of the present invention. Neither do all host cells function equally well with the same expression system. However, one skilled in the art may make a selection among these vectors, expression control sequences, and host without undue experimentation and without departing from the scope of this invention.

Once a synthase of the present invention is expressed, the protein obtained therefrom can be purified so that structural analysis, modeling, and/or biochemical analysis can be performed, as exemplified herein. The nature of the protein obtained can be dependent on the expression system used. For example, genes, when expressed in mammalian or other eukaryotic cells, may contain latent signal sequences that may result in giycosylation, phosphorylation, or other post- translational modifications, which may or may not alter function. Once the proteins are expressed, they can be easily isolated and purified using techniques common to the person having ordinary skill in the art of protein biochemistry and as described in Colligan et al., (1997) Current Protocols in Protein Science, Chanda, V.B., Ed., John Wiley & Sons, Inc. Such techniques often include the use of cation-exchange or anion-exchange chromatography, gel filtration-size exclusion chromatography, and the like. Another technique that may be commonly used is affinity chromatography. Affinity chromatography can include the use of antibodies, substrate analogs, or histidine residues (His-tag technology).

Once purified, mutants of the present invention may be characterized by any of several different properties. For example, such mutants may have altered active site surface charges of one or more charge units. In addition, the mutants may have an altered substrate specificity or spectrum of reaction product relative to a non- mutated synthase.

The present invention allows for the characterization of mutant teφeπe synthase by crystallization followed by X-ray diffraction. Polypeptide crystallization occurs in solutions where the polypeptide concentration exceeds it solubility maximum (i.e., the polypeptide solution is supersaturated). Such solutions may be restored to equilibrium by reducing the polypeptide concentration, preferably through precipitation of the polypeptide crystals. Often polypeptides may be induced to crystallize from supersaturated solutions by adding agents that alter the polypeptide surface charges or perturb the interaction between the polypeptide and bulk water to promote associations that lead to crystallization.

Compounds known as "precipitants" are often used to decrease the solubility of the polypeptide in a concentrated solution by forming an energetically unfavorable precipitating depleted layer around the polypeptide molecules (Weber, 1991, Advances in Protein Chemistry, 41:1-36). In addition to precipitants, other materials are sometimes added to the polypeptide crystallization solution. These include buffers to adjust the pH of the solution and salts to reduce the solubility of the polypeptide. Various precipitants are known in the art and include the following: ethanol, 3-ethyl-2-4 pentanediol, and many of the polyglycols, such as polyethylene glycol.

Commonly used polypeptide crystallization methods include the following techniques: batch, hanging drop, seed initiation, and dialysis. In each of these methods, it is important to promote continued crystallization after nucleation by maintaining a supersaturated solution. In the batch method, polypeptide is mixed with precipitants to achieve supersaturation, the vessel is sealed and set aside until crystals appear. In the dialysis method, polypeptide is retained in a sealed dialysis membrane that is placed into a solution containing precipitant. Equilibration across the membrane increases the polypeptide and precipitant concentrations thereby causing the polypeptide to reach supersaturation levels.

In the preferred hanging drop technique (McPherson, 1976, J. Biol. Chem., 6300-6306), an initial polypeptide mixture is created by adding a precipitant to a concentrated polypeptide solution. The concentrations of the polypeptide and precipitants are such that in this initial form, the polypeptide does not crystallize. A small drop of this mixture is placed on a glass slide that is inverted and suspended over a reservoir of a second solution. The system is then sealed. Typically, the second solution contains a higher concentration of precipitant or other dehydrating agent. The difference in the precipitant concentrations causes the protein solution to have a higher vapor pressure than the solution. Since the system containing the two solutions is sealed, an equilibrium is established, and water from the polypeptide mixture transfers to the second solution. This equilibrium increases the polypeptide and precipitant concentration in the polypeptide solution. At the critical concentration of polypeptide and precipitant, a crystal of the polypeptide may form.

Another method of crystallization introduces a nucleation site into a concentrated polypeptide solution. Generally, a concentrated polypeptide solution is prepared and a seed crystal of the polypeptide is introduced into this solution. If the concentration of the polypeptide and any precipitants are correct, the seed crystal will provide a nucleation site around which larger crystal forms. In preferred embodiments, the crystals of the present invention are formed in hanging drops with 15% PEG 8000; 200 mM magnesium acetate or magnesium chloride, 100 mM 3-(N- moφholino)-2-hydroxypropaπesulfoπic acid (pH 7.0), 1 mM dithiothreitol as precipitant.

Some proteins may be recalcitrant to crystallization. However, several techniques are available to the skilled artisan to induce crystallization. The removal of polypeptide segments at the amino or carboxyl terminal end of the protein may facilitate production of crystalline protein samples. Removal of such segments can be done using molecular biology techniques or treatment of the protein with proteases such as trypsin, chymotrypsin, subtilisiπ. Such procedures can result in the removal of flexible polypeptide segments that may negatively affect crystallization.

The crystals so produced have a wide range of uses. For example, high quality crystals are suitable for X-ray or neutron diffraction analysis to determine the three-dimensional structure of a mutant synthase and to design additional mutants thereof. In addition, crystallization can serve as a further purification method, in some instances, a polypeptide or protein will crystallize from a heterogeneous mixture into crystals. Isolation of such crystals by filtration, centrifugation, etc., followed by redissoiving the polypeptide affords a purified solution suitable for use in growing the high-quality crystals needed for diffraction studies. The high-quality crystals may also be dissolved in water and then formulated to provide an aqueous solution having other uses as desired.

Because synthases may crystallize in more than one crystal form, the structural coordinates of α-carbons of an active site determined from a synthase or portions thereof, as provided by this invention, are particularly useful to solve the structure of other crystal forms of synthases. The structural coordinates, as provided herein, may also be used to solve the structure of synthases having α-carbons position within the active sites in a manner similar to the wild-type yet having R- groups that may or may not be identical Furthermore, the structural coordinates disclosed herein may be used to determine the structure of the crystalline form of other proteins with significant ammo acid or structural homology to any functional domain of a synthase. One method that may be employed for such purpose is molecular replacement. In this method, the unknown crystal structure, whether it is another crystal form of a synthase, a synthase having a mutated active site, or the crystal of some other protein with significant sequence identity and/or structural homology of a synthase may be determined using the coordinates given in Tables 10 and/or 11 This method provides sufficient structural form for the unknown crystal more efficiently than attempting to determine such information ab mitio. In addition, this method can be used to determine whether or not a given synthase in question falls within the scope of this invention. As further disclosed herein, synthases and mutants thereof may be crystallized in the presence or absence of substrates and substrate analogs. The crystal structures of a seπes of complexes may then be solved by molecular replacement and compared to that of the wild-type to assist in determination of suitable replacements for R-groups within the active site, thus making synthase mutants according to the present invention.

All mutants of the present inventions may be modeled using the information disclosed herein without necessaπly having to crystallize and solve the structure for each and every mutant. For example, one skilled in the art may use one of several specialized computer programs to assist in the process of designing synthases having mutated active sites. Examples of such programs can be as follows: GRID (Goodford, 1985, J. Med. Chem., 28:849-857); MCSS (Miranker and Kaφlus, 1991, Proteins: Structure, Function and Genetics, 11:29-34); AUTODOCK (Goodsell and Olsen, 1990, Proteins: Structure, Function, and Genetics, 8:195-202); and DOCK (Kuntz et al., 1982, J. Mol. Biol., 161 :269-288). In addition, specific computer programs are also available to evaluate specific substrate-active site interactions and the deformation energies and electrostatic interactions resulting therefrom. MODELLER is a computer program often used for homology or comparative modeling of the three-dimensional structure of a protein. A. Sali & T.L. Blundell. J.Mol.Biol. 234, 779-815, 1993. A preselected polypeptide sequence to be modeled is aligned with one or more teφene synthases whose crystal structures are known and the MODELLER program is used to calculate a full-atom model, based on optimum satisfaction of spatial restraints. Such restraints can include, inter alia, homologous structures, fluorescence spectroscopy, NMR experiments, or atom-atom potentials of mean force.

The present invention enables synthase mutants to be made and crystal structures thereof to be solved. Moreover, by virtue of the present invention, the location of the active site and the interface of substrate therewith permit the identification of desirable R-groups for mutagenesis. The particular embodiments of this invention are further exemplified in the Examples. However, those skilled in the art will readily appreciate that the specific experiments detailed are only illustrative of the invention as described more fully in the claims, which follow thereafter.

EXAMPLE 1 GENERATION OF MUTANT TEAS GENES

Construct generation and expression.

All mutant enzymes were constructed by the QuickChaπge method (Stratagene). Manufacturer's instructions were followed, except as noted. Mutations were confirmed by DNA sequencing, and plasmids containing the desired mutation were used to transform BL-21(DE3) expression cells. Protein was expressed, purified, and stored at -80C.

TEAS W273S. The TEAS W273S mutant was generated from a TEAS-pET28b(+) template using the following primers:

GTTG TGCTACTTTTCGGCATTAGGAGTTTAT (sense) (SEQ ID NO: 13) and ATAAACTCCTAATGCCGAAAAGTAGCATTCAAC (antisense) (SEQ ID NO: 14). Mutagenesis was carried out according to the manufacturer's instructions, except that sense and antisense strands were generated in separate reactions. For each, 30 plasmid-copying cycles of one minute, annealing at 55C and 16 minutes extension at 68C were carried out. The two reaction mixtures were then combined, heated to 95C for 2.5 minutes, and cooled to room temperature before Dpnl treatment. TEAS C440W. The TEAS C440W mutant was generated from the

TEAS-pET28b(+) template using the following primers: GCTAGTGTAATTATATGGCGAGTTATCGATGAC

(sense) (SEQ ID NO: 15) and GTCATCGATAACTCGCCATATAATTACACTAGC (antisense) (SEQ ID NO: 16). TEAS W273S/C440W. The TEAS C440W/W273S mutant was constructed from a TEAS W273S-pET28b(+) template using the primers described for generation of TEAS C440W. TEAS 406/407 random library. For generation of a library of TEAS mutants with random amino acids at positions 406 and 407, two 50 microliter QuickChange reactions were carried out with the TEAS-pET28b(+) template and the primers GCACTAGCAACTACCACATATTACNNSNNSGCGACAACATCGTATTTGGGCATG (sense) (SEQ ID NO: 17) and

CATGCCCAAATACGATGTTGTCGCSNNSNNGTAATATGTGGTAGTTGCTAGTGC (antisense) (SEQ ID NO: 18), in which N denotes A, C, G, or T and S denotes C or G. By this choice of nucleotides, the reaction included primers which coded for all possible amino acid combinations at positions 406 and 407. No adjustment was made for differing numbers of codons among amino acids. In order to ensure efficient reactions, and to minimize the preference for hybridization of wild-type primers to the template, the primers were designed to be longer than those used to generate the mutations described above. In addition, they were HPLC purified prior to use. After 18 cycles of plasmid copying, the reaction was incubated for two hours with Dpnl, ethanol precipitated, and redissolved in 5 microliters water. Each of four 40 microliter aliquots of E. coii NovaBiue (Novagen) cells were electroporated with 1.5 microliters of the redissolved DNA. After a recovery period, the ceils were plated on kanamycin-LB-agar plates. In order to transfer the newly constructed plasmids to expression cells, the colonies were scraped from all four plates, and used to start an 8 mL culture grown in liquid LB medium at 37C for 8 hours. Plasmid purified from this culture was used to transform 20 microliters of competent BL-21(DE3) cells. For storage of the constructs, each individual colony was used to inoculate 100 microliters of LB medium containing kanamycin (50 micrograms/mL) in 96-well culture plates. The ceils were grown at 37C until the A∞o reached approximately one; 100 microliters of 30% glycerol in LB were then added, and the plates were frozen at -80C. A set of randomly selected colonies were grown from individual glycerol stocks of some colonies, and plasmids were extracted for sequencing. Approximately 30 percent of the colonies were found to be wild-type. Nucleotide and amino acid sequences for TEAS 406/407 mutant genes and proteins are shown in SEQ ID NOS.H and 12.

TEAS Y520F The tyrosine residue at position 520 of SEQ1D No:2 was changed to a pheπylalanine residue by site-directed mutagenesis with primers, in a manner similar to that described above. For Y520F the TAT codon was changed to TTC. The nucleotide sequence of the mutant gene is shown in SEQ ID No:5. TEAS Y527F The tyrosine residue at position 527 of SEQ ID No:2 was changed to a phenylalanine residue by site-directed mutagenesis with primers, in a manner similar to that described above. For Y527F, the TAC codon at position 527 of the TEAS amino acid sequence was changed to TTC. The nucleotide sequence of the mutant TEAS Y527F gene is shown in SEQ ID No: 7.

TEAS W273E The tryptophan residue at position 273 of SEQ ID No:2 was changed to a phenylalanine residue by site-directed mutagenesis with primers, in a manner similar to that described above. For W273E, the TGG codon at position 273 of the TEAS amino acid sequence was changed to GAG. The nucleotide sequence of the mutant gene is shown in SEQ ID No.:3.

EXAMPLE 2 EXPRESSION AND ISOLATION OF SYNTHASE POLYPEPTIDES

Unless otherwise noted, mutated and non-mutated TEAS proteins were expressed in Escherichia coii, purified by metal chelation, anion exchange, and gel filtration chromatography.

Constructs of TEAS and mutant TEAS proteins in the vector pET- 28b(+) (Novagen) were expressed in E. coii cells. For a typical protein preparation of any of these enzymes, E. coii strain BL21(DE3) cells containing the plasmid construct were grown at 37C in 4 X 1 L terrific broth to an Aβoo = 1.0. The temperature was dropped to 22C, and protein expression was induced by adding IPTG to a final concentration of 0.1 mM. After 15-20 h, the cells were harvested by centrifugation, resuspended in 5mL buffer A (20 mM Tris , 500 mM NaCI, 20 mM imidazole, pH 7.9) per 1g cells (wet weight), and stirred for 0.5 h at 4C. The cells were then lysed by sonication, and the resulting iysate was centrifuged for 0.7 h at 82,000 xg. The supernatant, containing the protein, was loaded over a 2-3 mL Ni2+ chelating histidine affinity column (Qiagen) equilibrated in buffer A, and the column was washed with additional buffer A until the A280 of the eluent returned to baseline. The protein was then eluted with a 20-200 mM imidazoie gradient in buffer A. Protein-containing fractions were pooled and diaiyzed against buffer B (50 mM

HEPES, 5mM MgCI2, 1mM DTT), then loaded onto an 8 mL MonoQ cation-exchange column (Pharmacia). The column was washed with 20 column volumes buffer B, and the protein was eluted with a 0-500 mM NaCI gradient in buffer B. The resulting protein was further purified by gel filtration on a Superdex-200 column (Pharmacia) in 50 mM Tris, 100 mM NaCI, 5mM MgCI2, 1mM DTT, pH 8.0. Purified protein was then diaiyzed against 5mM Tris, 5mM NaCI, 1mM DTT, pH 8.0, concentrated to 18- 22 mg/mL, and stored at -80C in 100 L aliquots until needed. EXAMPLE 3 CRYSTALLIZATION AND STRUCTURAL ANALYSIS OF SYNTHASE

POLYPEPTIDES

Crystal Growth and Microseeding: All crystallization attempts were carried out by the hanging-drop vapor diffusion method. Concentrated protein was mixed with an equal volume (2-5 uL each) of reservoir solution on a plastic cover slip. The cover slip was then inverted over a well of a plastic 24-well tissue culture plate, containing 0.5-1.0 mL of reservoir solution, and sealed by a layer of vacuum grease between the well and cover slip. The plates were incubated at 4C while the protein concentration in the hanging drop slowly increased by vapor diffusion. Approximately 300 different reservoir solutions, ranging pH 4.5-9 with a variety of precipitants and added salts, were assayed for crystallization of TEAS (SEQ ID NO:2). TEAS crystallized with a reservoir solution of 15% PEG 8000, 100 mM MOPSO (3-[N- moφholino]-2-hydroxypropanesulfonic acid), 200 mM magnesium acetate, 1 mM DTT, pH 6.9-7.3. For microseeding, an existing crystal was crushed in a few uL of precipitant solution, then diluted to 50 microliters. After initial ceπtrifugation to remove large particles, the suspension was serially diluted with additional precipitant solution, and a small volume of a diluted seed stock was added to each new crystallization drop. For macroseeding, crystals which were no longer rapidly growing (usually 2 weeks after drops were set up), were "rinsed" by serially transferring them through two to three drops of reservoir solution. The crystal was then transferred to a fresh drop containing protein and reservoir solution, and equilibrated against a reservoir solution as in the initial growth. Individual crystals varied in their degree of internal order. In some cases, several crystals were screened to identify a well-diffracting crystal with low mosaicity.

Data collection: Prior to data collection, crystals were transferred to a drop of reservoir solution, or reservoir solution containing a compound to be soaked into the crystal. A small volume of cryoprotectant solution (15% PEG8000, 100 mM MOPSO, 200 mM Mg acetate, 20% ethylene glycol, 1mM DTT, pH 7) was then added to the drop. After a short equilibration time (1-5 minutes), the crystal was transferred to a drop of cryoprotectant, or cryoprotectant with soaking compound added. After another short equilibration time, the crystal was picked up on a nylon loop, and quickly mounted for data collection in a stream of cold nitrogen gas (90- 11 OK). The TEAS crystals belonged to the tetragonal space group P4ι2i2; the unit cell dimensions varied by a few angstroms between crystals, but on average a = 126A, c = 122 A. The uncomplexed TEAS structure was initially refined to 2.8 A (Table 11 ) against data collected from a crystal grown in the presence of 2 mM FHP (Table 10). Electron density at the active site allowed unambiguous modeling of FHP, the A-C and J-K loops, and nine additional residues at the NH terminus. The refined TEAS-FHP model consisted of residues 17 to 548, three Mg2 + ions, 150 water molecules, and one FHP molecule. The three-dimensional coordinates for TEAS in the presence of bound substrate is shown in Table 10. The three- dimensional coordinates for TEAS in the absence of FHP is shown in Table 11.

Crystals of TEAS complexed with trifluoro-famesyl diphosphate (F3- FPP) were also prepared. In these crystals, a well-ordered diphosphate binding pocket was also observed. The A-C loop and the NH2-terminai segment exhibited well-defined electron density, the A-C loop was translated toward the active site, and there was strong electron density for the diphosphate moiety of F3-FPP. The hydrophobic pocket, however, remained flexible; the J-K loop and the famesyl moiety of F3-FPP were disordered.

Homology models were created and energy-minimized using the Swiss PDB viewer interface of the SwissModel program (Peitsch MC (1996), Biochem. Soc. Trans., 24:274-279 and Guex N. and Peitsch MC, 1997,

Electrophoresis., 18:2714-2723). Active site volumes were calculated with VOIDOO (Kleywegt, G.J., and Jones, T.A., CCP4/ESF-EACBM Newsletter on Protein Crystallography., 29, 26-28, 1993). To make closed active site cavities, the energy- minimized diphosphate moiety from the modeled TEAS cyclase reaction was appended to the residue equivalent to TEAS D301.

TEAS W273S crystal structures. Two TEAS W273S structures, in the presence of FHP, were determined from different crystals; both crystals appeared to be well ordered, as clear main-chain and side-chain density were apparent for residues throughout the protein, including the frequently mobile helices D1 , D2, and E. Initial difference electron density maps from both crystals immediately revealed the W273S mutations. The two crystals were designated W273S-1 and W273S-2.

In each structure, the loops surrounding the active site were ordered, resulting in a closed active site pocket. The A/C loop in each structure was translated toward the active site, forming part of its outer rim, as observed in the wiid- type TEAS/FHP complex. However, while the J/K loop of W273S-1 adopted the same conformation observed in the wild-type TEAS/FHP complex, the same loop in W273S-2 adopted a different conformation. In this conformation of the J/K loop, Tyr527 moved away from the side chain of residue 273. In addition, Tyr520 and Asp525 were placed distal to the side chain of Asp444. Hydrogen bonds previously observed between the J/K loop, Arg266, and the N-terminal loop were also missing in the W273S-2 structure. The W273S-2 conformation does not appear to be an effect of the

W273S mutation, as it was also observed in a wild-type TEAS crystal soaked with the epi-aristolochene mimic deoxycapsidiol, despite the fact that no electron density was readily apparent for the deoxycapsidiol molecule in that structure. Further, the TEAS active site loops were distant from crystal contacts, and their conformations were not likely to be artifacts of crystal packing. It is possible that at different stages of the TEAS reaction, the enzyme's J/K loop exists in different, defined conformations, and that each of these crystal structures has captured an image of a different conformation. In both W273S structures, residues other than Arg266 and those on the J/K loop did not undergo significant rearrangement from the conformations observed in wild-type TEAS.

In each W273S crystal structure, electron density in the active site suggested that the substrate mimic FHP binds in multiple conformations. Some regions of this density possibly represented bound water molecules in the mutant active site. The presence of water molecules in the mutant active site is consistent with the observation that TEAS W273S gives rise to multiple hydroxylated teφenoid reaction products.

The FHP electron density in each W273S crystal structure was sufficient to suggest that FHP existed in a more extended conformation in the W273S structure, compared to the more tightly folded conformation of FHP in the wild-type TEAS/FHP complex. The observation that the active site of W273S binds multiple conformations of FHP is consistent with the fact that W273S converts FPP to multiple teφenoid hydrocarbon products.

TEAS C440W / W273S: TEAS C440W / W273S crystallized under conditions identical to wild-type TEAS. A 0.3 mm crystal was soaked for 20 minutes in reservoir solution saturated in famesyl hydroxy phosphate (FHP). After cryoprotection and flash freezing as described for wild-type TEAS, data were collected on a laboratory source with Cu-Kα radiation (MacScience Coφ., Japan). A starting model of uncomplexed TEAS (Table 11 ) (Brookhaven Protein Database Code 5EAT (PDB 5EAT), with waters and magnesiums removed, was positioned against the mutant data with the rigid body module of the software program X-PLOR (AT. Brunge, X-PLOR Version 3.1 - A System for X-Ray Crystallography and NMR Yale University Press, New Haven, 1992, pp. 187-207). Rounds of positional and restrained b-factor refinement with buik solvent modeling were also carried out in X- PLOR, with manual model building and adjustment carried out in the software program O (Jones, TA, Zou, JY, Cowan, SW, and Kjeldgaard, M., Acta Cryst. D., 49:148-157, 1993). Additional rounds of refinement and map calculation using the CNS program suite resulted in significantly improved maps; this improvement was likely due to improved bulk solvent modeling.

TEAS C440W: TEAS C440W crystallized under conditions identical to wild-type TEAS, except that crystals nucleated less readily and were generally smaller. A mutant crystal was soaked for 6 hours in reservoir solution saturated in FHP before flash-freezing and data collection at SSRL beamline 7-1 (Stanford Synchrotoon Radiation Laboratory, Menlo Park, California). A starting model of TEAS-FHP (Table 10), with water molecules, ligands, and residues 523-532 of SEQ ID NO:2 removed, was positioned against the data with the rigid body module of X- PLOR. Rounds of positional and restrained b-factor refinement with bulk solvent and overall anisotropic temperature factor modeling were also carried out in X-PLOR, and manual model building and adjustment were carried out in the software program O. As with the double mutant, electron density maps were noticeably improved after refinement and map calculation in CNS.

EXAMPLE 4 TERPENE SYNTHASE ENZYME ASSAYS

Synthase activity assays were carried out based on the assay described in Vogeli and Chappell, Plant Physiol. 94:1860 (1990) and Vogeli, et al., Plant Physiol. 93:182 (1990). In general, radio-labeled (3H or 14C) substrate was incubated with enzyme at room temperature in a buffered magnesium salt solution (200 mM Tris, pH 8, 50 mM Mg chloride, 1 mM DTT, unless otherwise noted); hydrocarbon products were then selectively extracted into an organic solvent such as hexane. The hexane extract generally was treated with silica gel to remove prenyl alcohols and other oxygenated compounds generated by non-enzymatic hydrolysis of substrate, which partition inefficiently into hexane. Hydrocarbon products present in the hexane phase were quantitated by scintillation counting.

A subsequent extraction with a more polar organic solvent such as ethyl acetate was sometimes earned out. Oxygenated compounds more efficiently partition into ethyl acetate-type solvents. Compounds present in the ethyl acetate phase were also quantitated by scintillation counting. Substrate concentrations typically ranged from 0 1 nanomolar to 100 micromolar. In some assays, the substrate was not radioiabeled Reactions generally were earned out in triplicate for each substrate concentration. Protein concentration was determined by the Bradford method For determination of steady- state kinetic parameters, enzyme concentrations were chosen such that generation of products over time was linear throughout the course of the reaction.

Diteφene synthase assays typically were earned out using 3H geranylgeranyl diphosphate (GGPP) and enzyme in 250 mM Tris, 10 mM Mg chloπde, 1mM DTT, pH 8.0. Sesquiteφene synthase assays typically were earned out using 14C or 3H FPP and enzyme in 100mM Tπs, 30 mM Mg chloπde, 1 mM DTT, pH 8 0. Monoteφene synthase assays typically were earned out using 3H GPP and enzyme. As a control for nonspecific binding of GPP by protein, identical reactions were set up which contained BSA, rather than enzyme.

Product analysis of wild type and mutant TEAS enzymes by Ag- TLC. Teφenoid hydrocarbon products are not readily separated by thin layer chromatography on normal or reverse-phase plates; however, some can be separated by argentation TLC (Ag-TLC), in which silica plates are first treated with silver nitrate. Ag-TLC descπbed here generally followed the procedure descπbed by Back et al., Arch. Biochem. Biophys. 315:527 (1994). A silica TLC plate was dipped in 15% silver nitrate (aqueous), then dned for 3-5 hours at 110C. After spotting of tπtiated enzymatic products (solvent extract), the plate was developed in benzene.-hexane, ethyl acetate (50:50:1, by volume), sprayed with En3Hance (NEN) fluorography spray, placed on film, and exposed for several days to several weeks. Long exposure times were generally necessary, as silver-nitrate treatment of the TLC plate appeared to cause quenching of the fluorography reagent's fluorescence. Alternatively, 14C labelled products were detected after one to two days without the use of fluorography spray.

EXAMPLE 5

ACTIVITY OF TEAS W273S

Ditβrpenβ Synthase Activity of TEAS W273S. The TEAS W273S enzyme and radiolabeiled GGPP were incubated as descπbed above and hydrocarbon products were extracted with hexane. Oxygenated products were then extracted with ethyl acetate. Reactions using wild-type TEAS gave counts lower than buffer alone. TEAS W273S, on the other hand, gave counts that were significantly higher for both the hexane and ethyl acetate extracts. Hydrocarbon products formed from GGPP by W273S were distinct from the products made by acid-catalyzed loss of diphosphates from GGPP. See Figure 3.

Sesquiterpene Synthase Activity of TEAS W273S. Products of FPP tumover by the purified TEAS W273S mutant were analyzed by argentation thin-layer chromatography (Ag-TLC). One major reaction product had an Rf of 0.7 by Ag-TLC, which was distinct from both 5-epi-aristolochene (Rf = 0.78) and vetispiradiene (Rf = 0.63). See Figure 4. Preliminary GC/MS data showed that hexane extracts from FPP turnover by TEAS W273S contained at least four terpene hydrocarbons, with mass spectra distinct from either 5-epi-aristolochene or vetispiradiene. One of these products had a mass spectrum similar to germacrene A.

EXAMPLE 6

ACTIVITY OF TEAS C440W/W273S

Diterpene Synthase Activity of TEAS C440W/W273S. The mutant TEAS C440W/W273S protein contains a tryptophan residue at position 440 and a serine residue at position 273. Assays with GGPP were carried out using 0.5 micromolar 3H GGPP, various concentrations of unlabelled GGPP (Echelon), and enzyme. Reactions were incubated for 60 minutes at room temperature. The TEAS C440W/W273S mutant protein converted GGPP to hexane-extractable products, whereas the wild-type enzyme did not. The results indicated that the product profile was altered compared to wild-type TEAS. Hexane-extractable products of GGPP turnover by the double mutant were analyzed by Ag-TLC. The products included two species (Rf = 0.11 and 0.28) that were distinct from the hydrolysis product geranyl geraniol (Rf = 0.0)To verify that products generated by TEAS C440W/W273S from GGPP were not the hydrolysis product, geranylgeraniol, a sample was analyzed by Ag-TLC. A reaction containing 3H GGPP (5μm) and enzyme (40μm) in 100 microliters buffer was incubated overnight at room temperature. As controls, 3H GGPP was incubated in reaction buffer alone and in reaction buffer adjusted to pH 1.5. Both the enzymatic and control reactions were extracted with hexane, which was spotted on an argentation TLC plate, and developed and exposed as described above. The results, shown in Figure 3, demonstrated that the products formed by TEAS C440W/W273S were different from those generated by non-enzymatic degradation of geranylgeranyl diphosphate. Sesquiterpene Synthase Activity of TEAS C440W/W273S.

Reactions with FPP as substrate were carried out with 14C FPP (9μm) and enzyme (160μm) in reaction buffer (20μl). After incubating for 30 minutes at room temperature, products made by TEAS C440W / W273S were analyzed by Ag-TLC. The product profile of the double mutant was similar to that of TEAS W273S, with the addition of a major product having an R, of 0.57. The new product was distinct from both 5-epi-aristolochene and vetispiradiene. Several other products were also formed, many of which migrated slowly upon argentation TLC. See Fig. 4.

EXAMPLE 7 ACTIVITY OF TEAS C440W

Diterpene Synthase Activity of TEAS C440W. Enzyme assays with TEAS C440W were carried out as described in Example 6. As shown in Fig. 3, no hexane-extractable products were detectable by Ag-TLC after an overnight incubation at room temperature with 160 μm of enzyme and 9 μm radiolabeled GGPP in 20 μl volume.

Sesquiterpene Synthase Activity of TEAS C440W. Ag-TLC analysis of the products made from radiolabelled by purified TEAS C440W detected the formation at least one major teφenoid hydrocarbon product (Rf 0.63) that was distinct from 5-epi-aristolochene (Rf 0.78) and vetispiradiene. The reactions product profile on Ag-TLC is shown in Fig. 4. Small amounts of slowly-migrating products (Rf 0-0.09) were also formed. GC/MS analysis of the hexane extract of TEAS C440W teφenoid hydrocarbon reaction products confirmed that this mutant formed a single major sesquiteφene hydrocarbon product as well as a small number of minor hydroxylated products. The mass spectrum of the major product closely matched the published mass spectrum of the spirocyclic compound hinesene. Hinesene differs from vetispiradiene in the stereochemistry at the C3 methyl group. EXAMPLE 8 ACTIVITY OF TEAS W273E

Sesquiterpene Synthase Activity of TEAS W273E. Reactions to determine the products made by TEAS W273E using FPP as substrate were carried out essentially as described above, using radiolabeled FPP. The results indicated that at least one product other than 5-epi-aristolochene was formed. The results also indicated that alkylation of TEAS by FPP had occurred. The alkylation was dependent upon the presence of MgCI2 in the reaction mixture. In control experiments, boiled W273E-TEAS, as well as wild-type TEAS and BSA, were not alkylated. These results indicate that alkylation had occurred at position 273 and that the amino acid residue at position 273 is part of the active site.

EXAMPLE 9 ACTIVITY OF TEAS Y520F

Sesquiterpene Synthase Activity of TEAS Y520F. Reactions with radiolabeled FPP and TEAS Y520F enzyme were carried out essentially as described above. Reaction products were analysed by Ag-TLC and by GC/MS. A major product of the TEAS Y520F reaction had the same GC retention time as authentic germacrene A and the same mass spectrum as authentic germacrene A. The retention time and mass spectrum of this product were different from 5-epi- aristolochene.

EXAMPLE 10 ACTIVITY OF TEAS Y527F

Enzymatic Activity of TEAS Y527F. A crude extract of TEAS Y527F enzyme was made by inducing expression in E. coii cells, and sonicating the cells. The sonicate was clarified and the supernatant used for enzyme assays. No products were observed in assays using GPP as a substrate, indicating that TEAS Y527F does not have monoteφene synthase activity. Reaction products were obtained using FPP as a substrate. Analysis of these products by Ag-TLC indicated that products other than 5-epi-aristolochene were generated by the TEAS Y527F enzyme. EXAMPLE 11 ALIGNMENT OF TERPENE SYNTHASE SEQUENCES

Residues 265 to 535 of the TEAS primary amino acid sequence (SEQ ID NO: 2) were aligned with the full-length ammo acid sequence of a limonene synthase (SEQ ID NO: 22), using the BLASTp program (NCBI) with a BLOSUM 62 scoring matrix, a gap open value of 11 , a gap extension value of 1 , an x_dropoff value of 50, an expect value of 10, a wordsize of 3 and no filtering of low complexity sequences. The output of the alignment program, shown in Table 12, included a gap between residues 527 and 528 of the TEAS sequence (numbered as 263 and 264 in the alignment output). Residues 321 , 324, 345, 348, 349, 427, 452, 453, 454, 455, 458, 492, 496, 569, 572, 573, 577, 579 and 580 were selected as having the most suitable alignment with the 19 TEAS residues. Residue 580 of limonene cyclase instead of residue 583 was selected as aligning with residue 528 of TEAS, in order to maintain the spatial orientation of structural aspects found in TEAS, i.e., α-helices, β- sheets and loops shown in Figure 1 and Table 10.

A region including residues 579 to 847 of the taxadiene primary amino acid sequence of SEQ ID NO: 44 was aligned with the full-length amino acid sequence of a bomyl diphosphate synthase (SEQ ID NO: 26), using the BLASTp program (NCBI) with a BLOSUM 62 scoring matrix, a gap open value of 11 , a gap extension value of 1 , an x_dropoff value of 50, an expect value of 10, a wordsize of 3 and no filtering of low complexity sequences. The output of the alignment program, shown in Table 13, included a gap between residues 453 and 454 of the bomyl diphosphate synthase sequence. Residues 321 , 324, 344, 347, 348, 426, 451, 452, 453, 454, 457, 492, 496, 568, 571, 572, 576, 578 and 579 of the bomyl diphosphate synthase were selected as having the most suitable alignment with residues 584, 587, 606, 609, 610, 688, 713, 714, 715, 716, 719, 753, 757, 831, 834, 835, 839, 841 and 842 of the query region sequence of SEQ ID NO: 44. Residues 453 and 454 of bomyl diphosphate synthase were selected to align with residues 715 and 716 of taxadiene synthase, in order to maintain the spatial orientation of structural aspects expected to be present in taxadiene synthase, i.e., α-helices, β-sheets and loops shown in Figure 1 and Table 10. Residues 265 to 535 of the TEAS primary amino acid sequence (SEQ

ID NO: 2) were aligned with the full-length amino acid sequence of a δ-selinene synthase (SEQ ID NO: 48), using the BLASTp program (NCBI) with a BLOSUM 50 scoπng matπx, a gap open value of 13, a gap extension value of 2, an x_dropoff value of 50, an expect value of 10, a wordsize of 3 and no filtering of low complexity sequences. The output of the alignment program is shown in Table 14 Residues 300, 303, 324, 327, 328, 406, 431 , 432, 433, 434, 437, 471 , 475, 548, 551 , 552, 556, 558 and 559 of SEQ ID NO 48 were selected as having the most suitable alignment with residues 270, 273, 294, 297, 298, 376, 401 , 402, 403, 404, 407, 440, 444, 516, 519, 520, 525, 527 and 528 of SEQ ID NO: 2.

Residues 307 to 593 of the primary ammo acid sequence of γ- humulene synthase (SEQ ID NO. 50) were aligned with the full-length ammo acid sequence of abietadiene synthase (SEQ ID NO: 56), using the BLASTp program (NCBI) with a BLOSUM 62 scoπng matrix, a gap open value of 11 , a gap extension value of 1, an x_dropoff value of 50, an expect value of 10, a wordsize of 3 and no filteπng of low complexity sequences. The output of the alignment program is shown in Table 15. Residues 590, 593, 614, 617, 618, 696, 721, 722, 723, 724, 727, 761, 765, 837, 840, 841, 845, 847 and 848 of the diteφene synthase (SEQ ID NO: 56) were selected as having the most suitable alignment with residues 312, 315, 336, 339, 340, 419, 444, 445, 446, 447, 450, 484, 488, 562, 565, 566, 570, 572 and 573 of the sesquiteφene synthase query sequence (SEQ ID NO: 50).

EXAMPLE 12 GENERATION OF NOVEL MONOTERPENE SYNTHASE GENES

A DNA sequence encoding a pmene synthase (SEQ ID NO:20) is used to construct a library of mutant pmene synthase genes. Random mutations are introduced at nucleotides encoding one or more of the following nine ammo acid residues: L, C, C, G, H, S, L, G and Y, which correspond to positions 351, 372, 480, 481, 482, 485, 519, 600 and 601 of SEQ ID NO:20. In some cases, the pmene synthase coding sequence is randomly mutated at nucleotides encoding one or more of ammo acid residues 348, 375, 376, 597, 605, 607 and 608, which correspond to positions Y, I, T, F, D, Y and S of SEQ ID NO:20. The pmene synthase coding sequence is sometimes mutated at nucleotides encoding one or more of the following am o acid residues: Y, S and G, which correspond to positions 454, 479 and 523 of SEQ ID NO:20. In some cases, mutations at these ten positions are made in addition to mutations at nucleotides encoding the nine residues mentioned above. In other cases, mutations at these ten positions are made without introducing mutations at the nine residues mentioned above.

The pinene synthase coding sequence DNA is inserted in the pET28b(+) vector and mutagenized using the QuickChange method, following a protocol similar to that described in Example 1 for the TEAS 406/407 random library. The primers used to generate mutations are synthesized as indicated in Example 1 , using N or S as nucleotides in the desired codons in order to generate random mutants.

Specific mutations at one or more of the above 19 pinene synthase amino acid residues are made by site-directed mutagenesis using a protocol similar to that described in Example 1 for TEAS. Primers are made that have specific A, T, C or G substitutions in the codons to be mutated, in order to generate the desired mutant(s).

Random and/or specific mutations are prepared in a manner similar to that described above to alter amino acid residues of other monoteφene synthases, e.g., limonene synthase, (SEQ ID NOS:22 or 58), myrcene synthase (SEQ ID NO:30), +sabinene synthase (SEQ ID NO:54), 1, 8 cineole synthase (SEQ ID NO:24) and +bornyl diphosphate synthase (SEQ ID NO:26), at residues whose α-carbons have the interatomic distances and structural coordinates described in Tables 1-6.

EXAMPLE 13 GENERATION OF NOVEL SESQUITERPENE SYNTHASE GENES

A DNA sequence encoding a cadinene synthase (SEQ ID NO:33) is used construct a library of mutant cadinene synthases. Random mutations are introduced at nucleotides encoding one or more of the following nine amino acid residues: W, I, S, G, Y, L, C, L and Y, which correspond to amino acid residues 280, 301, 409, 410, 411, 414, 448, 527 and 528 encoded by SEQ ID NO:33. In some cases, the cadinene synthase coding sequence is mutated at nucleotides encoding one or more of amino acid residues G, A, S, M, D, Y and T, which correspond to amino acid residues 277, 304, 305, 524, 532, 534 and 535 encoded by SEQ ID NO:33. In addition, the cadinene synthase coding sequence is sometimes mutated at nucleotides encoding one or more of the following amino acid residues: 383, 408 and 452, which correspond to amino acids Y, T and D encoded by SEQ ID NO:33. In some cases, these mutations are made in addition to mutations at the nine residues mentioned above. In other cases, mutations at these ten residues are made without introducing mutations at the nine residues mentioned above.

The cadinene synthase coding sequence is mutated using the

QuickChange method in the pET28b(+) vector, following a protocol similar to that described in Example 1 for the TEAS 406/407 random library. The primers used to generate mutations are synthesized as indicated in Example 11.

Specific mutations at one or more of the above cadinene synthase amino acid residues are made by site-directed mutagenesis using a protocol similar to that described in Example 1 for TEAS. Random and/or specific mutations are prepared in a manner similar to that described above to alter amino acid residues of other sesquiteφene synthases, e.g., vetispiradiene synthase (SEQ ID NO:32), germacrene C synthase (SEQ ID

NO:52), E-alpha-bisabolene synthase (SEQ ID NO:46), gamma-humulene synthase

(SEQ ID NO:50), δ-selinene synthase (SEQ ID NO:48), e-b-famesene synthase (SEQ ID NO:28), at residues whose α-carbons have the interatomic distances and structural coordinates described in Tables 1-6.

EXAMPLE 14 GENERATION OF NOVEL DITERPENE SYNTHASE GENES

A DNA sequence encoding an abietadiene synthase (SEQ ID NO:56) is used construct a library of mutant abietadiene synthases. Random mutations are introduced at nucleotides encoding one or more of the following nine amino acid residues: S, S, I, A, L, V, G, F and Y, which correspond to positions 593, 614, 722, 723, 724, 727, 761, 840 and 841 of SEQ ID NO:56.

In some cases, the abietadiene synthase coding sequence is mutated at nucleotides encoding one or more of amino acid residues I, S, T, M, D, L and T, which correspond to positions 590, 617, 618, 837, 845, 847 and 848 of SEQ ID NO:56. The abietadiene synthase coding sequence is sometimes mutated at nucleotides encoding one or more of the following amino acid residues: Y, S and N, which correspond to positions 696, 721 and 765 of SEQ ID NO:56. In some caes, these mutations are made in addition to mutations at the nine residues mentioned above. In other cases, mutations are made at these ten residues without introducing mutations at the nine residues mentioned above.

The abietadiene synthase coding sequence is mutated using the QuickChange method in the pET28b(+) vector, following a protocol similar to that described in Example 1 for the TEAS 406/407 random library. The primers used to generate mutations are synthesized as indicated in Example 11.

Specific mutations at one or more of the above abietadiene synthase amino acid residues are made by site-directed mutagenesis using a protocol similar to that described in Example 1 for TEAS.

Random and/or specific mutations are prepared in a manner similar to that described above to alter amino acid residues of other diteφene synthases at amino acid residues whose α-carbons have the interatomic distances and structural coordinates described in Tables 1-6, e.g., casbene synthase (SEQ ID NO:42) and taxadiene synthase (SEQ ID NO:44).

EXAMPLE 15 EXPRESSION OF MUTANT SYNTHASES IN INSECT, MAMMALIAN AND BACTERIAL CELLS

Constructs containing nucleic acids encoding mutant synthases of Examples 12, 13 and/or 14 are introduced into cultured cells of the insect Spodoptera frugiperda using a baculovirus expression vector. After expression of the gene, the mutant enzyme is isolated and purified from each clone.

Constructs containing nucleic acids encoding mutant synthases of Examples 12, 13 and/or 14 are introduced into cultured HeLa cells using an expression vector having an SV40 promoter. After expression of the gene, the mutant enzyme is isolated and purified from each clone. Constructs containing nucleic acids encoding mutant synthases of

Examples 12, 13 and/or 14 are introduced into E. coii BL-21 on a plasmid vector as described in Example 1. The mutant synthase gene is expressed and the mutant enzyme is isolated and purified as described in Example 2.

OTHER EMBODIMENTS To the extent not already indicated, it will be understood by those of ordinary skill in the art that any one of the various specific embodiments herein described and illustrated may be further modified to incoφorate features shown in other of the specific embodiments.

It is to be understood that while the invention has been described in conjunction with the Detailed Description thereof, that the foregoing description is intended to illustrate, and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

Table 1

δ ra t-

Table 3

α- X Y Z

Carbon Position Position Position

1 119.144 43.487 44.133

2 120.203 38.695 43.506

3 114.058 43.884 41.015

4 109.327 46.145 41.743

5 110.682 46.410 45.284

6 106.807 36.336 45.151

7 107.629 38.010 41.804

8 109.375 34.842 40.617

9 111.944 37.854 37.602

10 110.233 31.098 47.361

11 115.915 32.218 48.369

12 118.846 34.443 51.796

13 116.461 32.848 54.290

14 114.100 38.006 55.620

15 116.617 41.285 51.702

16 114.855 43.486 54.238

rr cα

Table 4

H U ft.

C I-- β

O

Table 6

Table 10

Structural Coordinates of Tobacco 5-Epi-Aristolochene Synthase

With Famesyl Hydroxyphosphonate Bound

Atom Atom Residue Residue X Y Z OCC B- Type # factor

1 CB VAL 17 105.641 55.031 61.062 1.00 98.26

2 CG1 VAL 17 104.598 56.123 61.269 1.00 97.24

3 CG2 VAL 17 105.492 53.957 62.133 1.00 94.24

4 C VAL 17 106.842 53.842 59.190 1.00 98.89

5 O VAL 17 107.108 52.650 59.359 1.00 96.64

6 N VAL 17 104.381 53.419 59.594 1.00 99.88

7 CA VAL 17 105.495 54.412 59.646 1.00 99.06

8 N ALA 18 107.671 54.719 58.615 1.00 98.95

9 CA ALA 18 109.015 54.419 58.088 1.00 98.55

10 CB ALA 18 110.007 55.478 58.572 1.00 97.57

11 C ALA 18 109.570 53.012 58.346 1.00 99.86

12 O ALA 18 109.580 52.170 57.447 1.00 100.00

13 N ASP 19 110.068 52.793 59.562 1.00 99.07

14 CA ASP 19 110.616 51.508 60.010 1.00 97.13

15 CB ASP 19 109.507 50.447 60.064 1.00 96.62

16 CG ASP 19 109.503 49.666 61.370 1.00 97.86

17 OD1 ASP 19 110.119 50.130 62.355 1.00 100.00

18 OD2 ASP 19 108.873 48.588 61.415 1.00 97.98

19 C ASP 19 111.849 50.931 59.301 1.00 95.44

20 O ASP 19 112.812 50.539 59.964 1.00 95.55

21 N PHE 20 111.814 50.854 57.971 1.00 91.33

22 CA PHE 20 112.925 50.297 57.190 1.00 84.17

23 CB PHE 20 112.630 50.377 55.686 1.00 81.03

24 CG PHE 20 111.437 49.572 55.251 1.00 77.17

25 CD1 PHE 20 110.691 49.971 54.147 1.00 74.72

26 CD2 PHE 20 111.056 48.422 55.939 1.00 77.18

27 CE1 PHE 20 109.581 49.239 53.733 1.00 72.36

28 CE2 PHE 20 109.947 47.681 55.535 1.00 78.10

29 CZ PHE 20 109.207 48.092 54.428 1.00 75.86

30 C PHE 20 114.280 50.942 57.465 1.00 82.49

31 0 PHE 20 114.400 52.167 57.517 1.00 84.00

32 N SER 21 115.294 50.098 57.639 1.00 78.89

33 CA SER 21 116.656 50.560 57.895 1.00 75.96

34 CB SER 21 117.495 49.433 58.515 1.00 75.81

35 OG SER 21 117.449 48.250 57.731 1.00 80.91

36 C SER 21 117.305 51.063 56.602 1.00 69.67

37 O SER 21 117.070 50.513 55.525 1.00 70.74

38 N PRO 22 118.111 52.134 56.691 1.00 63.25

39 CD PRO 22 118.421 52.939 57.887 1.00 60.39

40 CA PRO 22 118.773 52.680 55.501 1.00 56.42

41 CB PRO 22 119.362 53.994 56.018 1.00 53.56

42 CG PRO 22 119.657 53.688 57.458 1.00 61.97

43 C PRO 22 119.847 51.746 54.939 1.00 55.70 0 PRO 22 120.236 50.771 55.589 1.00 52.85

N SER 23 120.301 52.038 53.724 1.00 56.69

CA SER 23 121.327 51.233 53.065 1.00 53.59

CB SER 23 121.600 51.775 51.660 1.00 51.37

OG SER 23 122.574 50.995 50.991 1.00 45.40

C SER 23 122.620 51.210 53.878 1.00 57.52

O SER 23 123.161 52.258 54.236 1.00 61.76

N LEU 24 123.101 50.004 54.168 1.00 58.09

CA LEU 24 124.326 49.799 54.944 1.00 55.68

CB LEU 24 124.545 48.301 55.191 1.00 60.64

CG LEU 24 123.413 47.379 55.651 1.00 67.70

CD1 LEU 24 123.810 45.934 55.385 1.00 70.01

CD2 LEU 24 123.098 47.596 57.124 1.00 70.77

C LEU 24 125.554 50.313 54.198 1.00 51.07

0 LEU 24 126.529 50.754 54.808 1.00 50.23

N TRP 25 125.472 50.267 52.873 1.00 45.50

CA TRP 25 126.563 50.636 51.977 1.00 44.42

CB TRP 25 126.356 49.908 50.645 1.00 46.22

CG TRP 25 125.853 48.510 50.867 1.00 47.97

CD2 TRP 25 126.604 47.407 51.384 1.00 50.67

CE2 TRP 25 125.700 46.331 51.553 1.00 50.91

CE3 TRP 25 127.948 47.219 51.729 1.00 45.66

CD1 TRP 25 124.567 48.070 50.732 1.00 49.99

NE1 TRP 25 124.466 46.765 51.147 1.00 47.16

CZ2 TRP 25 126.101 45.088 52.053 1.00 52.99

CZ3 TRP 25 128.347 45.983 52.227 1.00 47.77

CH2 TRP 25 127.423 44.934 52.384 1.00 51.93

C TRP 25 126.893 52.110 51.744 1.00 44.49

0 TRP 25 127.997 52.550 52.063 1.00 43.75

N GLY 26 125.958 52.862 51.172 1.00 47.80

CA GLY 26 126.210 54.267 50.894 1.00 39.84

C GLY 26 126.744 54.449 49.483 1.00 44.69

0 GLY 26 126.375 53.696 48.580 1.00 46.55

N ASP 27 127.620 55.434 49.287 1.00 46.92

CA ASP 27 128.200 55.708 47.966 1.00 50.38

CB ASP 27 128.544 57.196 47.827 1.00 57.61

CG ASP 27 127.307 58.091 47.770 1.00 66.06

0D1 ASP 27 126.168 57.582 47.895 1.00 64.78

OD2 ASP 27 127.482 59.318 47.597 1.00 67.46

C ASP 27 129.441 54.857 47.686 1.00 46.14

0 ASP 27 130.165 55.082 46.711 1.00 47.50

N GLN 28 129.642 53.855 48.536 1.00 40.05

CA GLN 28 130.759 52.921 48.461 1.00 28.69

CB GLN 28 130.591 51.884 49.575 1.00 25.72

CG GLN 28 131.624 50.781 49.615 1.00 32.15

CD GLN 28 131.331 49.745 50.688 1.00 33.15

OE1 GLN 28 131.873 48.643 50.665 1.00 41.21

NE2 GLN 28 130.467 50.097 51.638 1.00 18.55

C GLN 28 130.904 52.221 47.108 1.00 27.55

0 GLN 28 131.974 51.709 46.787 1.00 21.99 94 N PHE 29 129.840 52.223 46.307 1.00 27.43

95 CA PHE 29 129.874 51.561 45.004 1.00 26.63

96 CB PHE 29 128.840 50.432 44.956 1.00 33.69

97 CG PHE 29 129.070 49.349 45.976 1.00 28.13

98 CD1 PHE 29 128.241 49.241 47.089 1.00 26.35

99 CD2 PHE 29 130.103 48.428 45.817 1.00 27.32

100 CE1 PHE 29 128.432 48.231 48.028 1.00 24.27

101 CE2 PHE 29 130.304 47.410 46.751 1.00 28.00

102 CZ PHE 29 129.466 47.311 47.860 1.00 16.26

103 C PHE 29 129.712 52.451 43.771 1.00 31.14

104 0 PHE 29 129.920 51.976 42.648 1.00 31.41

105 N LEU 30 129.336 53.718 43.962 1.00 33.49

106 CA LEU 30 129.164 54.658 42.844 1.00 39.53

107 CB LEU 30 128.857 56.065 43.366 1.00 47.74

108 CG LEU 30 127.443 56.556 43.658 1.00 54.63

109 CD1 LEU 30 127.508 58.033 44.036 1.00 54.01

110 CD2 LEU 30 126.568 56.378 42.429 1.00 53.57

111 C LEU 30 130.433 54.764 42.009 1.00 40.75

112 0 LEU 30 130.384 54.947 40.787 1.00 34.99

113 N SER 31 131.565 54.671 42.696 1.00 44.10

114 CA SER 31 132.873 54.789 42.077 1.00 47.85

115 CB SER 31 133.730 55.737 42.917 1.00 53.74

116 OG SER 31 133.671 55.353 44.281 1.00 52.06

117 C SER 31 133.669 53.515 41.851 1.00 45.38

118 0 SER 31 133.909 52.743 42.782 1.00 45.28

119 N PHE 32 134.064 53.302 40.602 1.00 43.37

120 CA PHE 32 134.905 52.172 40.232 1.00 45.26

121 CB PHE 32 134.213 50.812 40.251 1.00 42.83

122 CG PHE 32 135.181 49.670 40.073 1.00 33.22

123 CD1 PHE 32 136.098 49.365 41.075 1.00 29.45

124 CD2 PHE 32 135.266 48.984 38.858 1.00 32.90

125 CE1 PHE 32 137.096 48.407 40.875 1.00 28.42

126 CE2 PHE 32 136.261 48.023 38.647 1.00 27.39

127 CZ PHE 32 137.179 47.737 39.655 1.00 28.24

128 C PHE 32 135.601 52.358 38.896 1.00 50.87

129 0 PHE 32 134.988 52.256 37.829 1.00 43.81

130 N SER 33 136.899 52.626 38.989 1.00 55.26

131 CA SER 33 137.755 52.816 37.841 1.00 61.21

132 CB SER 33 138.587 54.094 38.017 1.00 61.87

133 OG SER 33 139.024 54.250 39.360 1.00 67.09

134 C SER 33 138.641 51.583 37.731 1.00 59.75

135 0 SER 33 139.488 51.329 38.589 1.00 59.49

136 N ILE 34 138.368 50.771 36.718 1.00 60.14

137 CA ILE 34 139.128 49.552 36.486 1.00 66.15

138 CB ILE 34 138.426 48.639 35.442 1.00 65.50

139 CG2 ILE 34 138.099 49.423 34.163 1.00 69.37

140 CG1 ILE 34 139.291 47.406 35.157 1.00 65.37

141 CD1 ILE 34 138.715 46.458 34.122 1.00 63.17

142 C ILE 34 140.544 49.875 36.013 1.00 70.13

143 0 ILE 34 140.725 50.551 35.001 1.00 76.00 144 N ASP 35 141.545 49.454 36.782 1.00 73.05

145 CA ASP 35 142.935 49.673 36.388 1.00 70.88

146 CB ASP 35 143.895 49.419 37.558 1.00 76.13

147 CG ASP 35 143.288 48.547 38.638 1.00 84.32

148 0D1 ASP 35 142.931 47.387 38.344 1.00 92.06

149 0D2 ASP 35 143.155 49.030 39.784 1.00 86.08

150 C ASP 35 143.198 48.714 35.227 1.00 68.52

151 0 ASP 35 143.555 47.552 35.425 1.00 65.76

152 N ASN 36 142.940 49.214 34.019 1.00 66.53

153 CA ASN 36 143.083 48.471 32.765 1.00 67.50

154 CB ASN 36 142.949 49.430 31.577 1.00 72.78

155 CG ASN 36 141.889 50.497 31.804 1.00 79.82

156 0D1 ASN 36 140.708 50.194 31.962 1.00 78.35

157 ND2 ASN 36 142.319 51.756 31.853 1.00 84.96

158 C ASN 36 144.383 47.686 32.646 1.00 68.26

159 0 ASN 36 144.461 46.704 31.906 1.00 65.02

160 N GLN 37 145.403 48.143 33.364 1.00 71.27

161 CA GLN 37 146.709 47.500 33.370 1.00 71.18

162 CB GLN 37 147.721 48.431 34.048 1.00 78.38

163 CG GLN 37 149.005 47.761 34.524 1.00 90.52

164 CD GLN 37 149.198 47.904 36.027 1.00 100.00

165 0E1 GLN 37 148.538 48.718 36.673 1.00 100.00

166 NE2 GLN 37 150.106 47.105 36.592 1.00 100.00

167 C GLN 37 146.651 46.131 34.069 1.00 65.44

168 0 GLN 37 147.138 45.138 33.533 1.00 63.18

169 N VAL 38 146.023 46.086 35.244 1.00 57.92

170 CA VAL 38 145.883 44.849 36.021 1.00 51.76

171 CB VAL 38 145.388 45.152 37.461 1.00 50.39

172 CG1 VAL 38 145.198 43.862 38.251 1.00 44.02

173 CG2 VAL 38 146.371 46.071 38.166 1.00 43.36

174 C VAL 38 144.916 43.870 35.349 1.00 52.33

175 0 VAL 38 145.142 42.656 35.348 1.00 48.70

176 N ALA 39 143.858 44.412 34.752 1.00 49.41

177 CA ALA 39 142.848 43.610 34.068 1.00 48.03

178 CB ALA 39 141.722 44.502 33.584 1.00 56.98

179 C ALA 39 143.434 42.823 32.900 1.00 47.68

180 0 ALA 39 143.178 41.627 32.759 1.00 52.03

181 N GLU 40 144.219 43.501 32.068 1.00 46.51

182 CA GLU 40 144.855 42.881 30.908 1.00 40.96

183 CB GLU 40 145.507 43.952 30.036 1.00 49.36

184 CG GLU 40 144.507 44.896 29.383 1.00 62.86

185 CD GLU 40 145.161 46.109 28.745 1.00 67.78

186 OE1 GLU 40 146.229 45.957 28.112 1.00 67.66

187 OE2 GLU 40 144.601 47.218 28.880 1.00 70.01

188 C GLU 40 145.893 41.852 31.337 1.00 38.90

189 0 GLU 40 146.076 40.832 30.678 1.00 39.36

190 N LYS 41 146.569 42.135 32.447 1.00 41.55

191 CA LYS 41 147.584 41.243 32.998 1.00 38.43

192 CB LYS 41 148.219 41.884 34.236 1.00 43.42

193 CG LYS 41 149.304 41.056 34.903 1.00 55.00 194 CD LYS 41 149.864 41.780 36.119 1.00 61.88

195 CE LYS 41 151.040 41.028 36.721 1.00 62.99

196 NZ LYS 41 151.665 41.794 37.835 1.00 69.92

197 C LYS 41 146.914 39.926 33.373 1.00 36.30

198 O LYS 41 147.362 38.855 32.966 1.00 34.80

199 N TYR 42 145.823 40.027 34.132 1.00 35.61

200 CA TYR 42 145.051 38.868 34.572 1.00 29.43

201 CB TYR 42 143.880 39.307 35.457 1.00 29.64

202 CG TYR 42 144.229 39.658 36.890 1.00 30.55

203 CD1 TYR 42 145.556 39.697 37.330 1.00 37.21

204 CE1 TYR 42 145.866 40.002 38.660 1.00 37.30

205 CD2 TYR 42 143.222 39.937 37.814 1.00 28.62

206 CE2 TYR 42 143.519 40.241 39.139 1.00 37.07

207 CZ TYR 42 144.839 40.272 39.556 1.00 40.82

208 OH TYR 42 145.121 40.567 40.869 1.00 43.81

209 C TYR 42 144.499 38.097 33.377 1.00 30.40

210 O TYR 42 144.603 36.872 33.318 1.00 29.10

211 N ALA 43 143.920 38.827 32.426 1.00 24.33

212 CA ALA 43 143.340 38.227 31.227 1.00 29.09

213 CB ALA 43 142.713 39.308 30.356 1.00 19.04

214 C ALA 43 144.358 37.423 30.421 1.00 29.23

215 O ALA 43 144.074 36.308 29.984 1.00 29.14

216 N LYS 44 145.559 37.972 30.260 1.00 37.81

217 CA LYS 44 146.637 37.371 29.491 1.00 40.64

218 C LYS 44 147.069 36.041 30.095 1.00 34.80

219 O LYS 44 147.221 35.048 29.357 1.00 35.25

220 CB LYS 44 147.824 38.329 29.396 1.00 54.18

221 CG LYS 44 149.001 37.784 28.605 1.00 67.03

222 CD LYS 44 150.141 38.787 28.552 1.00 79.04

223 CE LYS 44 151.313 38.247 27.750 1.00 20.00

224 NZ LYS 44 152.431 39.227 27.673 1.00 20.00

225 N GLU 45 147.332 36.000 31.397 1.00 31.47

226 CA GLU 45 147.771 34.779 32.070 1.00 30.36

227 CB GLU 45 148.288 35.080 33.480 1.00 26.58

228 CG GLU 45 149.071 33.920 34.105 1.00 19.97

229 CD GLU 45 149.394 34.128 35.580 1.00 33.35

230 OE1 GLU 45 149.791 33.146 36.246 1.00 31.26

231 OE2 GLU 45 149.249 35.264 36.080 1.00 37.21

232 C GLU 45 146.649 33.747 32.142 1.00 31.64

233 O GLU 45 146.902 32.545 32.058 1.00 38.67

234 N ILE 46 145.415 34.225 32.299 1.00 34.27

235 CA ILE 46 144.239 33.358 32.373 1.00 30.12

236 CB ILE 46 142.942 34.181 32.608 1.00 33.74

237 CG2 ILE 46 141.706 33.420 32.123 1.00 32.63

238 CG1 ILE 46 142.812 34.534 34.093 1.00 34.26

239 CD1 ILE 46 141.644 35.444 34.407 1.00 30.01

240 C ILE 46 144.099 32.518 31.110 1.00 29.77

241 O ILE 46 143.850 31.315 31.186 1.00 30.24

242 N GLU 47 144.283 33.156 29.956 1.00 31.42

243 CA GLU 47 144.185 32.482 28.666 1.00 37.34 244 CB GLU 47 144.460 33.476 27.537 1.00 45.72

245 CG GLU 47 144.290 32.896 26.137 1.00 68.61

246 CD GLU 47 144.808 33.813 25.035 1.00 79.62

247 0E1 GLU 47 145.302 34.922 25.339 1.00 89.55

248 0E2 GLU 47 144.728 33.417 23.852 1.00 86.41

249 C GLU 47 145.169 31.314 28.580 1.00 37.12

250 0 GLU 47 144.860 30.275 27.997 1.00 45.60

251 N ALA 48 146.348 31.492 29.171 1.00 33.83

252 CA ALA 48 147.378 30.459 29.170 1.00 30.76

253 CB ALA 48 148.720 31.054 29.575 1.00 33.78

254 C ALA 48 146.986 29.323 30.110 1.00 30.08

255 0 ALA 48 147.071 28.150 29.743 1.00 30.80

256 N LEU 49 146.542 29.685 31.312 1.00 27.01

257 CA LEU 49 146.110 28.720 32.321 1.00 23.68

258 CB LEU 49 145.793 29.445 33.628 1.00 19.74

259 CG LEU 49 146.936 30.167 34.337 1.00 15.12

260 CD1 LEU 49 146.368 31.161 35.328 1.00 8.67

261 CD2 LEU 49 147.844 29.164 35.033 1.00 12.64

262 C LEU 49 144.862 27.985 31.836 1.00 24.27

263 0 LEU 49 144.610 26.842 32.214 1.00 31.26

264 N LYS 50 144.101 28.663 30.983 1.00 27.77

265 CA LYS 50 142.863 28.154 30.394 1.00 30.88

266 CB LYS 50 142.247 29.263 29.548 1.00 31.45

267 CG LYS 50 140.775 29.153 29.242 1.00 31.65

268 CD LYS 50 140.333 30.468 28.621 1.00 33.98

269 CE LYS 50 138.871 30.468 28.250 1.00 42.53

270 NZ LYS 50 138.455 31.817 27.773 1.00 47.24

271 C LYS 50 143.120 26.925 29.527 1.00 32.84

272 O LYS 50 142.449 25.901 29.675 1.00 31.46

273 N GLU 51 144.092 27.033 28.625 1.00 33.57

274 CA GLU 51 144.439 25.927 27.741 1.00 38.44

275 CB GLU 51 145.286 26.416 26.566 1.00 45.31

276 CG GLU 51 145.241 25.501 25.339 1.00 54.99

277 CD GLU 51 143.953 25.633 24.532 1.00 61.58

278 OE1 GLU 51 143.086 26.463 24.893 1.00 63.41

279 OE2 GLU 51 143.815 24.912 23.519 1.00 63.99

280 C GLU 51 145.179 24.824 28.501 1.00 37.86

281 O GLU 51 145.145 23.662 28.097 1.00 43.06

282 N GLN 52 145.867 25.192 29.582 1.00 36.20

283 CA GLN 52 146.592 24.212 30.397 1.00 38.10

284 CB GLN 52 147.453 24.897 31.465 1.00 41.72

285 CG GLN 52 148.691 25.615 30.943 1.00 47.34

286 CD GLN 52 149.505 26.249 32.061 1.00 49.46

287 OE1 GLN 52 149.640 25.683 33.145 1.00 43.98

288 NE2 GLN 52 150.049 27.438 31.799 1.00 53.90

289 C GLN 52 145.563 23.339 31.093 1.00 38.87

290 0 GLN 52 145.732 22.122 31.219 1.00 40.47

291 N THR 53 144.501 23.991 31.554 1.00 37.87

292 CA THR 53 143.407 23.323 32.236 1.00 32.77

293 CB THR 53 142.541 24.347 32.992 1.00 31.08 294 OG1 THR 53 143.315 24.933 34.050 1.00 28.04

295 CG2 THR 53 141.296 23.685 33.569 1.00 32.90

296 C THR 53 142.570 22.522 31.233 1.00 32.05

297 0 THR 53 142.013 21.476 31.573 1.00 29.73

298 N ARG 54 142.529 22.992 29.988 1.00 28.01

299 CA ARG 54 141.785 22.312 28.933 1.00 23.69

300 CB ARG 54 141.723 23.176 27.673 1.00 23.31

301 CG ARG 54 140.724 22.682 26.633 1.00 24.23

302 CD ARG 54 140.755 23.527 25.360 1.00 30.78

303 NE ARG 54 140.674 24.969 25.619 1.00 45.26

304 CZ ARG 54 139.564 25.633 25.942 1.00 46.57

305 NH1 ARG 54 138.405 24.999 26.058 1.00 51.75

306 NH2 ARG 54 139.608 26.946 26.140 1.00 43.00

307 C ARG 54 142.487 20.998 28.617 1.00 30.27

308 0 ARG 54 141.842 19.955 28.479 1.00 33.41

309 N ASN 55 143.821 21.050 28.526 1.00 33.72

310 CA ASN 55 144.648 19.899 28.240 1.00 33.22

311 C ASN 55 144.538 18.872 29.348 1.00 35.28

312 0 ASN 55 144.679 17.660 29.105 1.00 35.19

313 CB ASN 55 146.080 20.341 27.963 1.00 36.29

314 CG ASN 55 146.150 21.264 26.761 1.00 20.00

315 OD1 ASN 55 145.473 21.038 25.754 1.00 20.00

316 ND2 ASN 55 146.963 22.307 26.857 1.00 20.00

317 N MET 56 144.309 19.330 30.581 1.00 34.89

318 CA MET 56 144.150 18.442 31.734 1.00 34.60

319 CB MET 56 144.058 19.241 33.039 1.00 27.26

320 CG MET 56 145.378 19.792 33.544 1.00 38.81

321 SD MET 56 145.237 20.594 35.159 1.00 40.35

322 CE MET 56 145.790 22.242 34.734 1.00 41.02

323 C MET 56 142.880 17.606 31.560 1.00 38.38

324 0 MET 56 142.871 16.406 31.847 1.00 36.10

325 N LEU 57 141.816 18.253 31.084 1.00 33.14

326 CA LEU 57 140.535 17.593 30.852 1.00 33.61

327 CB LEU 57 139.444 18.633 30.566 1.00 24.13

328 CG LEU 57 138.939 19.472 31.742 1.00 25.14

329 CD1 LEU 57 138.092 20.624 31.235 1.00 18.69

330 CD2 LEU 57 138.143 18.604 32.703 1.00 10.16

331 C LEU 57 140.610 16.611 29.686 1.00 37.09

332 0 LEU 57 139.922 15.588 29.679 1.00 34.95

333 N LEU 58 141.453 16.924 28.703 1.00 35.34

334 CA LEU 58 141.605 16.071 27.533 1.00 35.75

335 CB LEU 58 141.930 16.926 26.304 1.00 33.37

336 CG LEU 58 140.886 17.987 25.951 1.00 36.57

337 CD1 LEU 58 141.334 18.779 24.736 1.00 34.54

338 CD2 LEU 58 139.540 17.333 25.691 1.00 38.57

339 C LEU 58 142.628 14.946 27.688 1.00 40.17

340 0 LEU 58 143.001 14.298 26.710 1.00 38.69

341 N ALA 59 143.066 14.697 28.922 1.00 45.53

342 CA ALA 59 144.038 13.637 29.198 1.00 52.73

343 CB ALA 59 144.562 13.754 30.626 1.00 52.29 344 C ALA 59 143.402 12.263 28.950 1.00 60.58

345 0 ALA 59 142.320 11.962 29.450 1.00 62.17

346 N THR 60 144.084 11.432 28.168 1.00 63.55

347 CA THR 60 143.575 10.109 27.794 1.00 63.50

348 CB THR 60 144.405 9.528 26.641 1.00 63.61

349 OG1 THR 60 145.776 9.434 27.039 1.00 67.85

350 CG2 THR 60 144.302 10.426 25.420 1.00 59.57

351 C THR 60 143.372 9.004 28.844 1.00 64.51

352 0 THR 60 142.237 8.681 29.198 1.00 69.94

353 N GLY 61 144.470 8.435 29.337 1.00 59.72

354 CA GLY 61 144.394 7.339 30.294 1.00 59.70

355 C GLY 61 144.087 7.572 31.767 1.00 60.15

356 0 GLY 61 144.627 6.862 32.620 1.00 62.75

357 N MET 62 143.233 8.546 32.098 1.00 62.09

358 CA MET 62 142.904 8.860 33.482 1.00 62.20

359 C MET 62 141.787 7.962 34.001 1.00 57.87

360 0 MET 62 140.858 7.592 33.304 1.00 60.93

361 CB MET 62 142.512 10.333 33.619 1.00 65.78

362 CG MET 62 142.374 10.806 35.057 1.00 71.62

363 SD MET 62 141.924 12.547 35.177 1.00 20.00

364 CE MET 62 141.630 12.940 33.455 1.00 20.00

365 N LYS 63 141.877 7.621 35.308 1.00 53.67

366 CA LYS 63 140.886 6.787 35.975 1.00 51.44

367 CB LYS 63 141.401 6.323 37.342 1.00 55.26

368 CG LYS 63 142.607 5.402 37.287 1.00 65.11

369 CD LYS 63 142.968 4.915 38.682 1.00 69.24

370 CE LYS 63 144.127 3.936 38.635 1.00 76.58

371 NZ LYS 63 144.434 3.376 39.980 1.00 78.96

372 C LYS 63 139.576 7.543 36.173 1.00 48.71

373 0 LYS 63 139.559 8.778 36.167 1.00 48.30

374 N LEU 64 138.490 6.802 36.386 1.00 44.07

375 CA LEU 64 137.182 7.413 36.586 1.00 38.53

376 CB LEU 64 136.100 6.343 36.778 1.00 40.14

377 CG LEU 64 134.671 6.886 36.899 1.00 35.60

378 CD1 LEU 64 134.283 7.589 35.606 1.00 32.53

379 CD2 LEU 64 133.689 5.773 37.203 1.00 30.12

380 C LEU 64 137.184 8.363 37.778 1.00 32.66

381 0 LEU 64 136.773 9.515 37.650 1.00 32.91

382 N ALA 65 137.664 7.881 38.923 1.00 26.30

383 CA ALA 65 137.721 8.683 40.141 1.00 27.29

384 CB ALA 65 138.362 7.885 41.265 1.00 26.12

385 C ALA 65 138.482 9.988 39.919 1.00 33.96

386 0 ALA 65 138.019 11.057 40.318 1.00 35.01

387 N ASP 66 139.630 9.897 39.250 1.00 35.46

388 CA ASP 66 140.459 11.064 38.961 1.00 35.10

389 CB ASP 66 141.776 10.646 38.298 1.00 36.60

390 CG ASP 66 142.685 9.867 39.229 1.00 34.65

391 0D1 ASP 66 142.611 10.067 40.461 1.00 25.86

392 0D2 ASP 66 143.488 9.057 38.717 1.00 44.77

393 C ASP 66 139.746 12.065 38.059 1.00 31.14 394 0 ASP 66 139.846 13.276 38.266 1.00 31.51

395 N THR 67 139.045 11.552 37.051 1.00 26.69

396 CA THR 67 138.316 12.392 36.105 1.00 26.40

397 CB THR 67 137.793 1 1.571 34.918 1.00 25.70

398 OG1 THR 67 138.891 10.917 34.270 1.00 27.33

399 CG2 THR 67 137.095 12.474 33.918 1.00 28.90

400 C THR 67 137.146 13.113 36.769 1.00 24.73

401 o THR 67 136.899 14.290 36.502 1.00 27.41

402 N LEU 68 136.425 12.401 37.629 1.00 23.13

403 CA LEU 68 135.295 12.985 38.333 1.00 18.00

404 CB LEU 68 134.504 11.909 39.078 1.00 13.23

405 CG LEU 68 133.804 10.871 38.201 1.00 16.24

406 CD1 LEU 68 133.109 9.843 39.078 1.00 17.55

407 CD2 LEU 68 132.811 11.552 37.272 1.00 7.96

408 C LEU 68 135.787 14.047 39.305 1.00 19.40

409 0 LEU 68 135.181 15.113 39.420 1.00 21.96

410 N ASN 69 136.899 13.766 39.980 1.00 17.72

411 CA ASN 69 137.471 14.714 40.931 1.00 23.29

412 CB ASN 69 138.608 14.071 41.728 1.00 27.45

413 CG ASN 69 138.102 13.102 42.783 1.00 44.15

414 OD1 ASN 69 137.171 13.413 43.530 1.00 45.05

415 ND2 ASN 69 138.709 11.921 42.846 1.00 48.60

416 C ASN 69 137.954 15.985 40.240 1.00 21.73

417 O ASN 69 137.784 17.083 40.764 1.00 19.56

418 N LEU 70 138.526 15.834 39.050 1.00 19.22

419 CA LEU 70 139.012 16.979 38.293 1.00 18.06

420 CB LEU 70 139.736 16.522 37.025 1.00 14.83

421 CG LEU 70 140.274 17.650 36.141 1.00 18.22

422 CD1 LEU 70 141.330 18.446 36.889 1.00 15.05

423 CD2 LEU 70 140.845 17.078 34.862 1.00 20.94

424 C LEU 70 137.835 17.871 37.925 1.00 20.53

425 O LEU 70 137.844 19.069 38.212 1.00 23.73

426 N ILE 71 136.817 17.269 37.312 1.00 19.75

427 CA ILE 71 135.613 17.986 36.901 1.00 16.33

428 CB ILE 71 134.617 17.043 36.184 1.00 19.20

429 CG2 ILE 71 133.278 17.744 35.950 1.00 17.41

430 CG1 ILE 71 135.216 16.574 34.856 1.00 25.29

431 CD1 ILE 71 134.273 15.748 34.009 1.00 21.71

432 C ILE 71 134.927 18.661 38.088 1.00 15.45

433 0 ILE 71 134.507 19.813 37.991 1.00 10.60

434 N ASP 72 134.846 17.952 39.212 1.00 14.16

435 CA ASP 72 134.222 18.477 40.425 1.00 13.13

436 CB ASP 72 134.206 17.400 41.516 1.00 9.28

437 CG ASP 72 133.456 17.828 42.766 1.00 8.19

438 OD1 ASP 72 132.472 18.591 42.660 1.00 19.56

439 OD2 ASP 72 133.842 17.381 43.865 1.00 24.87

440 C ASP 72 134.969 19.709 40.926 1.00 20.93

441 O ASP 72 134.357 20.734 41.230 1.00 31.87

442 N THR 73 136.298 19.618 40.980 1.00 26.21

443 CA THR 73 137.162 20.689 41.452 1.00 17.72 444 C THR 73 137.051 21.912 40.558 1.00 16.99

445 0 THR 73 136.913 23.046 41.054 1.00 15.04

446 CB THR 73 138.627 20.258 41.508 1.00 18.68

447 OG1 THR 73 138.771 19.152 42.406 1.00 20.00

448 CG2 THR 73 139.503 21.413 41.971 1.00 23.27

449 N ILE 74 137.124 21.732 39.245 1.00 13.35

450 CA ILE 74 137.024 22.837 38.298 1.00 15.24

451 CB ILE 74 137.214 22.342 36.844 1.00 17.48

452 CG2 ILE 74 136.841 23.434 35.843 1.00 10.21

453 CG1 ILE 74 138.658 21.881 36.637 1.00 16.00

454 CD1 ILE 74 138.936 21.335 35.253 1.00 19.68

455 C ILE 74 135.677 23.554 38.431 1.00 21.97

456 0 ILE 74 135.603 24.774 38.285 1.00 37.27

457 N GLU 75 134.620 22.793 38.712 1.00 24.94

458 CA GLU 75 133.283 23.362 38.869 1.00 17.86

459 CB GLU 75 132.216 22.266 38.893 1.00 22.45

460 CG GLU 75 131.998 21.565 37.557 1.00 23.19

461 CD GLU 75 130.753 20.685 37.539 1.00 24.24

462 OE1 GLU 75 130.485 19.984 38.540 1.00 11.68

463 OE2 GLU 75 130.041 20.699 36.513 1.00 19.29

464 C GLU 75 133.194 24.181 40.142 1.00 16.49

465 0 GLU 75 132.739 25.323 40.119 1.00 18.93

466 N ARG 76 133.640 23.590 41.248 1.00 11.73

467 CA ARG 76 133.626 24.248 42.552 1.00 15.45

468 CB ARG 76 134.114 23.282 43.636 1.00 7.10

469 CG ARG 76 133.198 22.097 43.899 1.00 15.61

470 CD ARG 76 133.785 21.197 44.975 1.00 12.16

471 NE ARG 76 132.824 20.231 45.508 1.00 16.00

472 CZ ARG 76 132.467 20.165 46.789 1.00 19.23

473 NH1 ARG 76 132.982 21.010 47.670 1.00 26.80

474 NH2 ARG 76 131.618 19.234 47.202 1.00 29.06

475 C ARG 76 134.486 25.519 42.564 1.00 20.45

476 0 ARG 76 134.214 26.454 43.319 1.00 19.47

477 N LEU 77 135.525 25.539 41.732 1.00 20.12

478 CA LEU 77 136.419 26.692 41.634 1.00 19.40

479 CB LEU 77 137.756 26.281 41.014 1.00 12.91

480 CG LEU 77 138.678 25.382 41.843 1.00 12.12

481 CD1 LEU 77 139.825 24.903 40.973 1.00 2.00

482 CD2 LEU 77 139.201 26.125 43.070 1.00 4.07

483 C LEU 77 135.796 27.823 40.818 1.00 22.31

484 0 LEU 77 136.374 28.906 40.702 1.00 30.09

485 N GLY 78 134.628 27.551 40.238 1.00 26.16

486 CA GLY 78 133.915 28.542 39.447 1.00 20.26

487 C GLY 78 134.496 28.855 38.082 1.00 16.66

488 0 GLY 78 134.185 29.898 37.504 1.00 19.22

489 N ILE 79 135.323 27.959 37.553 1.00 13.23

490 CA ILE 79 135.938 28.179 36.247 1.00 16.00

491 CB ILE 79 137.488 28.083 36.321 1.00 14.32

492 CG2 ILE 79 138.055 29.257 37.111 1.00 9.65

493 CG1 ILE 79 137.909 26.751 36.944 1.00 15.84 494 CD1 ILE 79 139.413 26.574 37.082 1.00 20.69

495 C ILE 79 135.420 27.216 35.185 1.00 17.13

496 0 ILE 79 135.860 27.256 34.033 1.00 20.55

497 N SER 80 134.459 26.377 35.567 1.00 21.41

498 CA SER 80 133.878 25.392 34.654 1.00 23.76

499 CB SER 80 133.004 24.393 35.419 1.00 20.88

500 OG SER 80 131.996 25.047 36.170 1.00 23.54

501 C SER 80 133.093 25.977 33.485 1.00 20.44

502 0 SER 80 132.839 25.280 32.505 1.00 28.56

503 N TYR 81 132.723 27.252 33.577 1.00 18.39

504 CA TYR 81 131.972 27.907 32.507 1.00 19.66

505 CB TYR 81 131.389 29.244 32.986 1.00 10.58

506 CG TYR 81 132.396 30.362 33.170 1.00 19.55

507 CD1 TYR 81 132.635 31.285 32.151 1.00 26.56

508 CE1 TYR 81 133.540 32.331 32.320 1.00 23.18

509 CD2 TYR 81 133.092 30.513 34.367 1.00 12.72

510 CE2 TYR 81 133.998 31.555 34.546 1.00 18.75

511 CZ TYR 81 134.218 32.460 33.519 1.00 21.59

512 OH TYR 81 135.122 33.487 33.688 1.00 23.90

513 C TYR 81 132.814 28.103 31.240 1.00 23.33

514 0 TYR 81 132.294 28.498 30.195 1.00 26.36

515 N HIS 82 134.114 27.835 31.352 1.00 27.33

516 CA HIS 82 135.044 27.955 30.229 1.00 28.77

517 CB HIS 82 136.471 28.227 30.724 1.00 20.70

518 CG HIS 82 136.676 29.592 31.301 1.00 18.33

519 CD2 HIS 82 137.002 29.989 32.553 1.00 7.90

520 ND1 HIS 82 136.574 30.742 30.548 1.00 14.62

521 CE1 HIS 82 136.829 31.788 31.312 1.00 11.77

522 NE2 HIS 82 137.091 31.359 32.533 1.00 13.85

523 C HIS 82 135.085 26.654 29.440 1.00 28.78

524 0 HIS 82 135.456 26.643 28.265 1.00 31.36

525 N PHE 83 134.719 25.557 30.098 1.00 30.57

526 CA PHE 83 134.774 24.241 29.475 1.00 32.99

527 CB PHE 83 135.829 23.389 30.191 1.00 38.74

528 CG PHE 83 137.052 24.157 30.603 1.00 40.58

529 CD1 PHE 83 137.204 24.583 31.921 1.00 40.06

530 CD2 PHE 83 138.041 24.476 29.675 1.00 41.50

531 CE1 PHE 83 138.320 25.318 32.309 1.00 43.27

532 CE2 PHE 83 139.163 25.211 30.050 1.00 38.18

533 CZ PHE 83 139.303 25.634 31.371 1.00 46.92

534 C PHE 83 133.444 23.496 29.471 1.00 32.87

535 0 PHE 83 133.378 22.340 29.886 1.00 31.33

536 N GLU 84 132.397 24.133 28.960 1.00 33.76

537 CA GLU 84 131.086 23.496 28.929 1.00 38.03

538 CB GLU 84 129.991 24.514 28.601 1.00 47.83

539 CG GLU 84 129.901 25.690 29.578 1.00 58.57

540 CD GLU 84 129.403 25.312 30.975 1.00 69.66

541 OE1 GLU 84 129.719 24.208 31.479 1.00 74.44

542 OE2 GLU 84 128.695 26.146 31.586 1.00 66.21

543 C GLU 84 131.030 22.314 27.966 1.00 39.30 4^. l- t o o

cn cn cn cncn cn cn cΛ cn cn cjιCΛ ωtD(Dωωωωάcoδιcoco ωMJθ (oco M δcn δωM

O P O O P P o o o o o o O O O P o o o OOO O P Z O OO O O z o O O DO > o O O CD o > ooo Oo Oo O CDo mO oP oO >z σ o o D > mO nO > N

- ->> to to - to -■ - -■ IO IO -■ m α o co > > >Λ>>Λ>>n >>Λ?>Λ ?>A>iΛ >>n>?ft>>Λ>n^^^^rrrrrrrrΩOOOOG)ΩC)C)' f;c; ;'; r~ ι— r- r~ CD mπιπιπιπιπW OWT3WTJMT.C_αfl(Tg)MT3 (Tfl3WTJMT3wT3toT3w-OwTJM-DM"U(ηιππιπιπιrπmιιι C C C CCC C C C tocococoωcocococo

oo oooδθ(θ Φ (θ (otoco(θ(θoocβoόco ΦcooόclόM SM S M M M Mαcnφ α)co α

eoeo eo ω eo co eo eo co co eo co eoeo eo to eo toto toro to co co eoeo co co eo eo co e ς eo co eo co eo co eo co CO CO CO CO CO CO CO to en en IO IO IO * ^ CO co n co co co co to to CO co to to -* -*■ o tocn cngoco co^44* cn - -JJ 4 ■k-■ pp - J k o φ oιcρ -Mθoo o en -ι cn oo een oen ιo ιo co eJ) n io "-* oo oo to en o to -* ω co i co . - o -^ o oo co - oo -^ -* -^ e en -^ -| -^ σ= c—o t.o- to cDo ooro op ^i co -* oo co

M W O -O Cn ϋl ^ CtKO i M 88 -j j(- o eo ι oi Mωϋi ι-cnωo wcoωαj j-.w scr) σσ oooo ttoo tn CO o en ω έ M n o io

_ι _- _k |vj iso _-, _A _. _j. _- _ f r f r N) -^ r N M r W f M N I M

Mcn ω^ω* σ>_cncnM^ np)oισ> ->i MSCo s oo en vi -* o oo co oo co -M oo ιo N. to o o cD θ CD 000 -* 0 - -* -'

∞ en o hj tocn ^ c cn cn o o to to to *. en -ι 4- cnt scoω ωιoσ) 2 co eo en en - -M _- 4, O -' Cn -' IO --J 00 C04-. CO eo ιo -* oo . fo cn *' en o. -j eo s. c _o e _n. - en -j eo ->ι . . . _ _. -. ._ _ k θ . en - en eo en en -si eo to o ιo c ococπcn sωcnω^ i cn-'oω oco -c 4. n-.c< _oop _ coc _ co. no-io _ oo- t - oo PS p co- gι κ) o to oo co co co cn o co co to oo -' oo -' fo o -' o co io -' oo

U U M UOJ MM MW N WW MMN M MI M M M MN U UU UW U U MW M MW M r N M p p co ^ p co α u ^ ^ ιn M cn N co cβ c p s s o) (θ p ρ ω f t ^ p co cβ cβ c&

'^ e '^ e Kj e eo : ι eo e e e eo eo '^ e '^ '^ '^ e : ι :^ io : j '^ i '^

Mθ c M (Λθ MM 5 ω N) Mp ωω^ θ M ( ωffi cn oow M N ^ wco s oro ωj ffl M M ffl p ω rji ϋo ω θ -n α ^ Cn θ CO O(l M J J J θθ [i M θω M yi θ J θ O θ J (D (D M i CO O M N) J (0 ( ^ M 5 S J M O M (I) -ι (J) W 03 o o o o o oo oo o o o o o o o o o o o o o oo o o o o o o o o o o o o o o o o o o o o o o o o o o oo oooooo o o o o o oo o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o Ji CO CO O M M - σ> co

co en co

<-> 4 eo to t o O o o

cn o) cn cn cn en cn cn cn en cn cn o) en cn cn o> cn cn oo oo co co en eΛ θo en c3) σ> σ) cn σ) cπ cΛ cn cn o) cn cn cn cn σ) cn cn en en en en en en 4^ &.4 4^ co co co co co co co co co co to to io to to to to KJ to N -' J J J -' -' - - ^ O p θ θ p p O O (p (p tO Ip (D (p eo to - o co oo ->ι en en 4^ eo fo - o co oo ->ι en en 4* co ho -* o ιo co Ni cn cn *. ω M -O o co - σ) oι ω r -O (θ co θ) uι 4-

P P P z OPOOOOOPOPPZ OPPOOOPZ Ω CD > ιNrπαmσo D> OPZOOPOO o o o D > rπ m o o D > o o o O o O o P OOPO O O Z o CD o > O D O CD >

_v _. S3 to -. t -i

>^> _JJ JJJJJJ-JJrFFFrFFrO )ΩOOOOOC .)> _.>>>>>>> m m m m m rπ m m

-ZZ^Z737}7i 3 37373737}73737} zzzzzzzz Z "U "D "D T3 "O "O ) "O C C C C C C C C m

(O CO CD CO CO eo co co co co co co co co co co co co cD co co co co co co co co co co co co co co co co co co co co co co lO CO CD CO CO CO CD CD CD en en en en en en en en en en en en αi cn en en 4 4^ 4^ 4^ 4^ 4^ 4^ 4^ eo eo eo eo co co eo eo co io to to to to io io to _- _- _- --. _- _- _- _- 0

to to to to to to to to to to to to t to t to lo eo eo co eo co eo eo eo co co eo eo co co eo i to fo to fo to io fo fo to co to co to eo co co

CDS M s en cno eo ti * 4-.00 -| 00 CO co co to o -> o o o o cn cn 4* ω i O O CO CO M O) M CO CO (O CO U> 0 10 0 (00 ^ 10

W M O M CO M Ol 0-0. 2 o en -* o 4. 4k _k cn eo -^ e co oo c cn ro oo eo 4k- co to to co oι - ιo eo eo - en t 4k 4 IO 4. tO CO CO cn -M ->ι co oo -* 4* co ., en eo to to to o κ) M θ io - ω M ω -vi -' ω δ cn -vi 4. o fo cn oo co - co oo 4- 00 CO CO - CO CO

Nj c ω -' m cB cns o o ~>ι to -■ -* B 4*. -M o -' to -' M ω o ω M M -i cn Ji 4* -vl 00 C000 IO fO 4 -vl CO CO σ co ψ. N) (O CO - -i

644 OD1 ASN 96 125.093 7.141 26.806 1.00 52.90

645 ND2 ASN 96 126.679 8.138 25.567 1.00 56.55

646 C ASN 96 127.911 4.434 28.545 1.00 54.46

647 0 ASN 96 127.502 3.324 28.202 1.00 58.60

648 N GLN 97 129.067 4.606 29.183 1.00 57.00

649 CA GLN 97 129.933 3.469 29.494 1.00 62.35

650 CB GLN 97 131.385 3.924 29.690 1.00 63.17

651 CG GLN 97 131.622 4.834 30.885 1.00 68.59

652 CD GLN 97 133.052 5.351 30.970 1.00 68.54

653 OE1 GLN 97 133.659 5.357 32.040 1.00 66.32

654 NE2 GLN 97 133.594 5.798 29.836 1.00 59.07

655 C GLN 97 129.458 2.654 30.698 1.00 66.41

656 0 GLN 97 129.682 1.442 30.754 1.00 66.29

657 N ASN 98 128.790 3.317 31.642 1.00 75.07

658 CA ASN 98 128.274 2.676 32.854 1.00 85.32

659 CB ASN 98 127.000 1.878 32.554 1.00 92.56

660 CG ASN 98 125.798 2.771 32.325 1.00 97.44

661 OD1 ASN 98 125.273 3.375 33.262 1.00 97.63

662 ND2 ASN 98 125.357 2.865 31.074 1.00 98.68

663 C ASN 98 129.314 1.791 33.535 1.00 89.40

664 0 ASN 98 129.073 0.612 33.812 1.00 88.19

665 N SER 99 130.486 2.369 33.779 1.00 94.53

666 CA SER 99 131.560 1.640 34.435 1.00 98.60

667 CB SER 99 132.918 2.248 34.106 1.00 99.63

668 OG SER 99 132.996 3.591 34.559 1.00100.00

669 C SER 99 131.332 1.673 35.926 1.00 99.96

670 0 SER 99 131.030 2.717 36.500 1.00 98.72

671 N ASN 100 131.508 0.532 36.566 1.00100.00

672 CA ASN 100 131.294 0.473 37.995 1.00100.00

673 CB ASN 100 130.733 -0.892 38.382 1.00 97.11

674 CG ASN 100 129.297 -1.056 37.956 1.00 95.75

675 OD1 ASN 100 128.429 -0.279 38.360 1.00 86.86

676 ND2 ASN 100 129.028 -2.069 37.139 1.00 94.51

677 C ASN 100 132.513 0.784 38.857 1.00100.00

678 0 ASN 100 133.196 -0.133 39.303 1.00100.00

679 N CYS 101 132.829 2.068 39.047 1.00 98.98

680 CA CYS 101 133.942 2.429 39.953 1.00 94.29

681 CB CYS 101 134.350 3.905 39.872 1.00 96.36

682 SG CYS 101 135.708 4.382 41.017 1.00100.00

683 C CYS 101 133.151 2.160 41.226 1.00 90.03

684 0 CYS 101 132.261 2.914 41.595 1.00 89.78

685 N ASN 102 133.483 1.057 41.870 1.00 85.97

686 CA ASN 102 132.753 0.573 43.043 1.00 81.73

687 CB ASN 102 133.072 -0.902 43.238 1.00 86.41

688 CG ASN 102 132.971 -1.688 41.962 1.00 88.71

689 OD1 ASN 102 133.978 -2.107 41.412 1.00 90.82

690 ND2 ASN 102 131.750 -1.869 41.462 1.00 81.79

691 C ASN 102 132.652 1.257 44.413 1.00 74.07

692 0 ASN 102 131.770 0.881 45.187 1.00 77.40

693 N ASP 103 133.474 2.260 44.713 1.00 58.82 4 4*. eo eo r

O o o

S S ->I M M >I S S M S M M M S M >l >I M ->J M >I M M M S N N N S S M S M N S I S N O) 0) 0) 0) a) CD ^ ^ ^ A ω ω UW U W ω u ωU M M M I H MW M M I J - - J - -' - -' -' - O O O O O p O O O O (D (0 (0 l0 (0 (D ω M ^ o iD ω M CΗ CTi ^ ω M J o ω co M OJ cn ^ ω M J O iD ω M CΛ cn ^ ω M -i O a m n J ω M

PPZOPPPP O P O P z O P O P P P P O P P O P O p p OPPPPOPZ

CD > o a oP oaP > CD > Q CD > O O CD > O CO > O P O a σ CD D > D O O P O P CD o > to -■ t _- to -■ IO - 0-<O-<O-<n-<O-<O-<rErr mErπEmr'πiπr ι;ι πr C

Uiυi(ΩCΛUiU)C '":C'"'Z" -D

_*. _- _- 0000000000000000000 o o o o o o p p

OO OCO lO IDCO tD CO DCO CO CO CO CO CO M M M M M σ> en 35 en en 35 en ϋi ui en en cn oi S -S. gs ggss oeo oeo oco oco oco oco oco

ro to to to to eo co co eo ω ro to to to to to to io to to to co eo eo eo eo co co eo eo co to to to co co co co co co co co co co ifl iD m io ω^ i j p p M c. po coco co io pω j -i ' S en S CO co to to to to p -* co -M co Q O -k -- fo cn cn cn . co

Φ M -i a-* M-i bS MbM MM ctn 'O^ b^ ^Ul et ^O bcβ '^ b c ' -^ '-M- b- -- a-- ώ . -._ — _ — -NI oo oo t -o- e-n- e-n- c^o ~J co

Φ O M r ^ ^ cn ω m ca cn M tt Φ σi cπ cii ui co cn ω iA u co N cp ^ σ ~i M " " N ->l ' cCoO ~ - o0o0 i 4*- -N|

(o s co c co oo o -l s cn 4 oι ω en o oo co oo co -M

00 r b) OOIO C04.C fO-'0 co co -* cjι cn -*ι ιo cn .o o co oo O cD Qo to co en eo vi eo co cji co *.

(o ooo^MMNNMωωωcnjk^i ωwωωω^t ^ωi ω^cn e σ)eocβ4k4 en )eocD:i4keoM 3 kωiNj4:^o"*kcoip

U O C) O Cn ^ Φ O (00 | Φ Cn Q) ^ (π Kl Cn U θ ώ CO Q ^ Cr) I Q) ( CO rV} a N} K) M (O M Φ co o e -ι co .o cΛ ω c l co c M θ c cn c c cn co ^ 4* cjϊ co ^ c co ^ cji 4* c ^ cj.4k c-θ 4^ oooooooσooooooob oocDoo oooooooooooooooooooooooooooooooooσooooooooooσooooo MM '0 -' -' -' M J cn n cn ii

o ω Φ r σ M Φ (θ Φ

744 CG GLN 110 129.287 8.221 37.949 1.00 31.51

745 CD GLN 110 129.373 6.711 37.797 1.00 31.57

746 OE1 GLN 110 129.661 5.990 38.756 1.00 35.16

747 NE2 GLN 110 129.117 6.225 36.586 1.00 34.19

748 C GLN 110 127.926 10.478 39.414 1.00 21.12

749 0 GLN 110 127.508 11.009 38.389 1.00 20.13

750 N PHE 111 127.139 10.140 40.431 1.00 23.63

751 CA PHE 111 125.699 10.356 40.409 1.00 21.06

752 CB PHE 111 125.065 9.729 41.655 1.00 21.44

753 CG PHE 111 123.565 9.806 41.685 1.00 18.29

754 CD1 PHE 111 122.795 8.933 40.924 1.00 18.70

755 CD2 PHE 111 122.921 10.744 42.483 1.00 14.43

756 CE1 PHE 111 121.404 8.990 40.959 1.00 18.31

757 CE2 PHE 111 121.533 10.810 42.523 1.00 21.91

758 CZ PHE 111 120.773 9.929 41.758 1.00 17.47

759 C PHE 111 125.373 11.846 40.345 1.00 19.49

760 0 PHE 111 124.731 12.305 39.399 1.00 17.88

761 N ARG 112 125.857 12.598 41.332 1.00 16.34

762 CA ARG 112 125.606 14.033 41.407 1.00 8.21

763 CB ARG 112 126.326 14.651 42.608 1.00 7.94

764 CG ARG 112 126.081 16.153 42.745 1.00 14.61

765 CD ARG 112 126.507 16.703 44.100 1.00 22.36

766 NE ARG 112 127.955 16.745 44.291 1.00 19.69

767 CZ ARG 112 128.777 17.561 43.639 1.00 22.41

768 NH1 ARG 112 128.300 18.407 42.737 1.00 29.76

769 NH2 ARG 112 130.073 17.555 43.915 1.00 26.92

770 C ARG 112 125.961 14.808 40.145 1.00 13.57

771 0 ARG 112 125.113 15.505 39.588 1.00 17.92

772 N LEU 113 127.205 14.676 39.693 1.00 11.94

773 CA LEU 113 127.671 15.385 38.504 1.00 14.83

774 CB LEU 113 129.151 15.088 38.239 1.00 20.65

775 CG LEU 113 130.149 15.516 39.322 1.00 16.72

776 CD1 LEU 113 131.568 15.259 38.847 1.00 15.77

777 CD2 LEU 113 129.970 16.985 39.651 1.00 21.06

778 C LEU 113 126.840 15.108 37.256 1.00 19.17

779 0 LEU 113 126.484 16.034 36.532 1.00 26.79

780 N LEU 114 126.516 13.841 37.014 1.00 23.83

781 CA LEU 114 125.717 13.464 35.849 1.00 14.66

782 CB LEU 114 125.668 11.943 35.703 1.00 18.52

783 CG LEU 114 126.969 11.251 35.287 1.00 19.65

784 CD1 LEU 114 126.800 9.746 35.362 1.00 22.06

785 CD2 LEU 114 127.352 11.666 33.882 1.00 21.06

786 C LEU 114 124.300 14.030 35.939 1.00 15.67

787 0 LEU 114 123.787 14.596 34.972 1.00 18.67

788 N ARG 115 123.678 13.883 37.104 1.00 9.26

789 CA ARG 115 122.328 14.387 37.328 1.00 7.86

790 CB ARG 115 121.849 14.021 38.736 1.00 10.49

791 CG ARG 115 121.450 12.562 38.901 1.00 12.35

792 CD ARG 115 120.323 12.202 37.949 1.00 17.12

793 NE ARG 115 119.807 10.857 38.179 1.00 21.26 *. 4* to r o O o en o

c Qocs∞oooooocβCQcnoooocβoooooa∞∞oaoocncn∞∞oocnooooooo Co0O O0 C 0O O000 C C CD O0 0O 0O 0O 00 v -v| -vl -v| -v| vl 5555ωωωωωωωωωωMWr K)wwr t MN3---'-'-'-' ' - ' O O O O O p O O O O CO CD CO CO CO Cp c to^ocooo-see kC to-*ocDoo->ie e 4ke 5-oeDoo--Jc en4^ co to o co oo -M en en 4. co ro - o co oo -vi cn en 4^

PP z OP Z O P O P Z O P P P P P P P P P Z O OPZPZPPPP z P o > Nmrnpqoco> P P CD > o σ o >Z OPZOOPPO O P z rn m o o C CD > m m o CD oo > X X N to to -• -* t to — k t -■

FFF>>>>>>>>"D"0"0"C1T'I"UT. -O'DTJOCDC OX XXXIXXXXX(DCDCD(DcDOCD(DCD>>>>> mrnrncococococococotoxxixxx iixxr-r-r-r- rπmrπrπmmmmmm-<-<-<-< c- zzzzzzzzm ococoωojwcΛω oco zzgzςzgzςzςzgzςzggggg

t NJ f I I M I I ISJ I I -* -* -* - -* -* -* - -* - -* ^k - -* -* -* - - -*

_ _ _k O O O O O O O O co co co co eo co co co eo co co oo oo oo co - i vi ->i - i M M M M vi N cn cn cn σi cn cn -o cfl cn oi cn cri ϋi ui

t to t U - 0 b) co

- -o. co

00 CD

pspu cocococococococ cococoeoco Njcococowcococococoeococoωcocococoω coϋioι5$c ϋiSω5co5 po -'^W[ NWMNω^ωϋiω n

Mαi b b '4 b'-'^cntn^cobco'A cn bcnα M θΦcnj5sΦCβMMθ)AMθM(n(θows^Mωr\)ω^ooQω*ϋιo)McβJK3(ncoϋim ι αjJsωtΛJMoojffiα)ωMθθfflffiMoωM^ffiωofflJcommϋ)θMc.^ωj(Dooco^ωω bbb bbbbbbbbbbbbbbb bbbbbbbbbbbbbbbbbbbbbbbbbbbbbb o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o c to eo e NJ to ^ M fo i io ^ J ^ ^ ^ ^ ^ ^ ^ o NJ M i ^ ^ ^ -k | -' -' -- --' -- -' -' --k -i f -k _.. _. _. _. _. j o M p A cβ ω ω w p s lό p s co ω ω cn ω ^ ^ s en co M p ω s ω tΛ p bω en ιώ s ϋi M sω b j s ^ W r bb co jω k) ώ u

J O M Cβ M M t O n ro ffl ω O CΛ ^ J CB O A CO M M φ J COα ffl N M ffl CO CO ^ ω N ϋl CO OO S M ∞

4*- * eo ) to o en o n o en

oo oo oo oo oo oo go co co co eo oo oo oo 80 0000000 O-3I -00I O-N3I 0-V0I 0-MO 0-00.0V0I 0-O0.0-M00-M0 O Co co -o αi co co c cD Co oo t- o -00 o o -0 CD Co co ω co co ω ω cr. -o cD o en co to -■ o eo oo -j φ en OT en c c e e en eΛ e e en e en cji e S i- jf jS. *-

-i θ(D co M cn cn *> ω ι -' o ~ co oo -vi en en 4 t -' O co co o) ui 4k Co M -> 0 (D co M cn en

OPPZOPPPPPPPPP P P P P P P (D D > N m m o o o D > O O P P o to -J. to -^ σ o a co > OPOO

B mP oP aPoP > O P P P P P 2 o co > σ o P o P P z

CD D >

-" -■ t p pp

M M I MMMM M M MM N MMM M MNM M MMN M MM I MMM rO M rO N rO rO M M I M M N

Ms sσJcncscnroroΦcnfflcorociicnϋicncn ncn n^A ^^^^AAωwωωωωωM

N) M M I | M M I M I M N |O I I M M MM M M M | | l J J J ^ ^ M M rO M - J -' J -' r r -' -' -i to ro to to to lo o ^ K> 3 K3 eo ^ 4^ co ^ K5 c h eo e ejι ^ - i cn ^ 4k ^ K) ro ^ c ∞ -M ∞ co o o o o -M oo co o o σ ui co eo k e -n.. t .o _ -vi . c _o p to 00 e _o- -v .it.o. -vicn4.*4.vcoo co ιo -vi - en to oo co o oo σ> -vj eo - σ>tocno o

_- o en eo _ocD--cncn4>. _ -vi T cn cn co co 4^ cn o co o o 4fc θ vl _ _ . bo en 4*. bo ^ -M ^-

O -* !o cn co cΛ - eo cp -* oo *- en co -vi eΛ cn co cn cD -vi 4 oo oo cn co cn cn co -'

Ol CO CO O CO M rM Ol O -' CIl -i CO rO O vl -' Cn ω oι ω o cn κ3 | - to en co en en σ co oo o -. -vi cn to en o -' Cn io cn 4> cn to o 4>. co en cti N -Ni N CD CD c-n

c co oo c co o cΛ

4^. J-- 4-. *- 4-.4^ 4- 4 4 4-.4 4* 4-.4-.4-.4-.4-.4* 4-. Cθ 4-.4 4-.4-.4>. '.4. 4=. co co eo eo co co co co co eo c-) co c

*fc cn cn i oo pi ? σ> * CΛ CΛ Cn CO CO C O - -* 0 -* - IO -* - CD O -* 0 -* -' CO -* ^ lO p jO CO M M S p M ro p tO -M 00 fO CO O bo bo ^ fo ^ cJi co c co cn ^ c ^ c " Φ CQ u qo o ω en A M σ) -' -> (θ K) o ω eo | ccoo -^> ccp (coo ob αιi eeπn -j - i io -j to eo eo eo oo o -4 o 4. en eo fo co eo -* cn o) -vi oi co e co e σ - i to e ~Ni 4>. cn - i k -i K3 - σ —. oo e ι 44^ ..44.. eeoo ccoθ 4k -l -M Q0 - eo co en co oo co en cn en en en eo oo to cn o en en oo co co o oι eo oo ιo co en cn eo oo to cn -vj ->ι σι -ι Mio oCOo oO cCOo 4^ C *. O 5 M

en * N) N> en o en en o

P Z OP O OP PPP O P Z > O P

E mΠ. O CD CD >

> >000000000>>> > > > >O OOOfl(ι O OOT) T T T ^ T l T) TlT] ^r r r r r r r r r ι^ t zβMzrcrcrcrcrcrcrcrcrcW^tToJw^wTJtTfl-WJtTflJtTnJrZrZrZrzrzrzrzrzrzlmlmlmimlmimimlmimlmim^cow^cΛCΛωKw^ω^ωcomim^i

eo eo co co eo co co co co co co eo co co co eo eo co co co co co eo co co co co co > M ro r M M tθ M M NJ M

C eO M M M fO M M tO M M ^ ^ ^ ^ ^ ^ ^ ^ O O O O O O O O O CO CO CO CO CO CO CO CO CO eO CD C C CX3 C OO CO C C C ^ ^

J J ^ J J ^ J ^ J ^ J J M J ^ M N M M M M M J M N N M M N I M M N I M M rO rO r I r rO M M M N) l M ffiMffisco M pcoωpp p p pp j j j jό l p j j i c ωA p i po pM ptn s

4 44ω bviM iω Mωb ώωωb M bb o -M o eo oco co eo oo oo cnoo co 4k ^ e cn 4^ ^ eo p ^o ^ e M e en oo co -M CΛ 4^ ι θ M e o e c eι -M 4k ^ 4i c- ιo o oocn ^δ ^ ω s∞ uicn ωMMω Φ^ c ϋi ϋi cD cn 5 ocoσ c)) θ 4 ^co ^ oM ωm

k oo

ro en en en en en S en en 4 4k 4k 4. co co ->■ ro en k CO eunι eun) euni - ) uι

'-J to en to '-* b co e bo cΛ to co en eo en eo o oo fo oo co fo en o cn cn en vi co sto

co cn σ) ro -vi ooooooooooooooooooooooooooooooooooooooooo ooooσoooo ooooooooooooooooooooooooooooooooooooooooo ooooσoooo

en to to en o en o en o

co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co m θo ω en cn o> en en en en en en en en en en 4k 4k 4k 4k 4k 4k e -o. m t.o. <o o -* O _ co o- α CD 00 -M caft cn> K co i -oo ooo co cMo Sv] M M S M M e- M M n cn 4k eo to o - θ c -) o $co8 cn cn cn cn j CD tn 4k. eo to -k θ co oo -vi θ5 cn 4k. eo to -' θ co oo vi oo en 4k

PZOOOOOPPP OOZPPPPPZOOPPPPPPPP OP z p p p p p p p z

> m m o o co > N rπ o C co > N m m o o o co > N m α CD co > O P z o o o to -k > σ α o o ro - mrπr-r-r-r-r-r-r-r-r-^ ^^^^^^^X X ^^^^^^^^^r-r-r-r-ωωωωcΛCΛ

co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co co eo co co eo co co c oo e oo c e e oo e -M -j ^ -v( ^ -vi ^ vi ^ en en en cn en cn cn en en en cn cjn cji cji cji en cn eji en cji K 4 eo eo eo co co co

to to to to ttoo ro to to ro fo to ro to to fo ro fo ro ro io io ro o to to to ro ro - -* wcowoo uo.o i-<J. ω- 4> ω ω φ eη uι i i ui ι ω ω eo - eo - to eo B to

_-. -- O 4k 4k cn -vi oo oo oo -vi -M -vj -vi en en en 4k en en cn> itoo toj cn ^ ^ eo 4k ^ e ) a. ^ bi e)o e to —o 'eo B t to to e 4 cn -i vi e o en - o e o) i -k io en co eo - j -M -i ro ro to ro to en oι ^ co k 4k to o eo oo -' en - -i o e -k k e eo p o en M M -* o cn 5 co - θ) ro o ro co o (D M a) ω ^ en r o -* 00 eo o eo -k θ -vi eo -M to cn co to fo cD θo en cn eo to 4k -M oo σ> oo io oo to oo to cD θo to en cD aι en oo oo cD to ro oo o 4k 2 O CO k co ro oo o

en en en en cn en cn en en cn en en cji cn en en en cji en en en oi en en en en en en cn en cji eenn eenn eenn en en eπ en en en en en en en en en en en en cn po po ω po p -k p p p o ^j ^ Nj t ω ^ cn ^ ^ p ^ ^ i i ω ω ^ ωω ωω ^j ϋι en ι c c ^ M -. ro p ro ι aι en

L* '_j. b) CD b) en bι io '-k o -vi ^ .k K ._j b b ^ oι ^ ώ rN3 c to 4k en c cp eeoo bo cc eβo ^^' o e 4k b i ι b 4 ^ ^ co en -i o ro ro 4- oo -' j ) r co cn ro no vMi Mvi ffl Ki vi (τι .rι vi ffi π .n ffl Oι nι i. J. iκι -ϋιi θθ M i4. θ) w t ot) (θ cιι r vi - i ω co co ω vi u ro co to co 4k -vi oo en -vi 4k -vj oo ro en eo to o o c „o8 co c_n co oo cn -M cn cn co eji ro co -vi o ro co OT cn ro co -k eo en ooooooooσooσoooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo eo 4k e 4k - i e e e 4k 4k 4k 4k 4k 4 4 4k eo co eo eo 4 -^ -ι - ω ω ^ ω ^ cn cD ro cn ςn oι en c ccn σ) CD - v| CO 00 CD N s o j o co Φ tn oo ω fc M p ρ ω ρ s ρ ρ p ^ ω p ι p a p p ρ , ρ t κ) M ^ j ω i S ( o tnppp i ω b ^ b b b ] ω ω i M ^ b b b b b r b b b ω ώ b a b ω M M ω ω b '->■ co co c e e o S c to e ι e o ^ 4 ^ - i oo e - i ro o ^ eo k -M e e e -M Ni θ θ 4k θ io 4 4 -' θ 4k θ -k co oo 4k θ c oo oo to

OPPZ O P P OP P P σ o o co > OO P P P P OPOOOPPZ POP P Z O PP P Z O P P P P P P Z OO CD > O P O P > O O O CD > CD CD > CD > D O CD CD > o -* CD CD to - r to -k ro -■ rrrrrrrrωwωω r-rr-r-rπrπrπrπrπrπmm>>>>>>>cΛCoc73Cowω

■(-(^-( CCcccccf-r FTf-f-innnnjTnnjTjjjijjjij^^^^^ mmrnrπrnmrnrπmmrπrπ cccccccc;o;o;o;α

4. 4. 4. 4- . 4. 4- 4- .4. - 4. J- 4 4k k 4 4 k 4k 4k 4k 4k 4k 4k 4k 4k 4 4 4k 4k 4k 4k 4k. 4k 4k 4k 4k 4k CO CO CO CO oo oo ooen en encn cn en en cnen S t eo eo eoeoco eo co co roio ioio to ro -' -k -k -k -k o o o o o o o o co co co to

ro co co co eo co eo co eo co co c co eo co o eo eo eo eo eo eo e ω eo eo eo co co fo ro ro eo co eo ro ro ro co to co co ro ro pf ωωωscoMC >4k ω ω k <%<< eo e ro co en eo 4k eo U p Jk J. Jk UM J j p p S O p J O iD co bo '-* io to vj C cn to p eD o eo eo -vi o - 4* en -M to -vi o M M * i * i u . Q j m ω ω b r ^ ω ϋi cn en en o eo 4 to ι e k C - eD -i oo cD to oo vi ro c -k ω eo M co co oo ro co cΛ ^ co -k θo -k ro -k en eo co cD eo o po -' -vi

CO 00 CO CO 00 4k -vl 2 -vl 4k 00 O 4 Φvvrroo MM ccoo(coo ωωooccnn cunivMi ccoooo vi cD io oo eo ro co 4k en cn ro o) eo -M en -i en -i co -- eo cn k oo en co co to oo oo oo -vi cn cn en cn en cn en eo 4k en en en en 4k en 4k en 4k -. ro ro co ro cn co -M eo -* o ro -• - .■ o . . o . - o o to -* o eo to o o -M - -vi en o ιo co o ro 4k p co oo cD eo -k |o ro oo c i co - co - o en j ι co ^ ik | l- cn co -vi to 44kk ccoo eeoo ttoo ρp ecnn ccoo oo cg -M en e e -' -' 4 -ι |o en -' - i e 4k On -4' o 0 cvl r4ok -'' vk

->• co cn oo eo eo cD Oo -k Oo to oi o s oo oo co -k -M oo en 4k co oo -k cn oo oι ^ι co - co e - i cD -' - θo 4k -ι 4k - co 5 o e -i 4 ^ en en 00 co o o K -vl CO IO co en -* s

ooooooooooooooooooσooooooooooooooooooooooooooooooo 00000000000000000000000000000000000000000000000000

M rop^^i Mpi ωroα^^touM|Mθ^)^nuMc^oNJt[o^ ^^Mr^o^ccnt^oMMM^ω^^eoipuro oruoιeoe^ro -* fo ro -* ro ro ro .o ro ro co CO 4k

o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o co ω co co ω α co op eo ca oo cβ α α vi j i M M S M vj o es σ) cn cn cn cn en en en en en en en en en en 4k 4k 4k 4k 4k " eo M ^ o eo oo -v) cn cn k eo to - o co oo -vi cn en 4k eo to -k θ co oo -vi co to -- o co oo -vi cn en 4k co ro -k θ co oo -j cj> en

O P P P P z OPOPPPPPPPP OPPPPPPZ oo Z O P P P O P P P P P P m o o D > X NΓΠOΓΠO OCD > σ o D ro > α o CD co > α α o ro > ZOPPPPPP ro -k α o C ro > to _- to -* ro -■■ r- r- r- r- r- r- r- |- > > > > > > > > r- r- r- r- r- r- r- r- r- r- r- r- ι— ι- ι— i- mmmm m mcΛCΛcocyjcoωωcorπm mmrπrπrπrπrπrπrrirπrπrπrπ CCCC 3333303-7J3J J )?03D?0 ) cccccccczzzzzzzzcccccccccccccccc

en en en en en en en en en en en en en en en en en en en en en en 4k 4k 4 4k 4k 4 4k 4 k 4 4k k 4 4k 4k 4 4 4k 4k k 4 4k to to to ro io ro -k -k -k -k -k -k -k -k -^ -k -k -k O O o o gg Cπ e 4

O O (0 C0 (O (0 C0 α) II) tt) 0 0000 α) 00 C00- 05 v| M S S v| M S v|

N N Kl N I rO I U U U M U r r U U θ)4. ιjιtn ωffl Mis vji ii bM O 4> 4kCβωl Q

co o ϋi M ϋi*cn J' (D roθ M ω M m j -ι α -. α j α -ι a α j J α α j α j J α (Ϊ Cβ (O ffl J J a a -ι -i J -ι -ι a -ι -ι -ι j -u -ι -ι -ι θ) (O Oa a vj p p p p p p p M | p p 4.4> M N N ^ jj j ij J ^ N N C W M I l M ^ p p p

M i M ω ω b 4 K3 M b s b w '- ^ w ω 5 b α -* -* ro co ^ co k ^ -i M ^ eo M M e 4k e eo e k eo e eji 4k θo 4k k Cθ t eΛ CΛ oo oo co oo cβ M cjι o oo o 4 cn -* ro ro eo co oo 4k -k -k θo o -^ k io cn ιo co -* o 4k eo co oo co -k Co -' -vi co oo cn o oo cn co en -vi cn co o -vi co cn

4 ,k- oo en cn to

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOOOOOOOO OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOOOOOOOO

_- _- _k -- _-, -k o - -* -' - _* _- _- -_k-, rroo rroo -' -i - o ro ro -k io ιo -k -' -' -' - -* - to ι M w -^ ->■ m Q M α p p M J j p o αw ^ o iβ po i N α cn p ω p jk vj M J Mp p p p p ω vj ^ 4 Kj eo -* e b v) ^ !| 4k e 4 34k ^ b b vj b o ^ b b ro e ω ^ ω j cΛ u ω io o co oo M ω M o M ω o M α o M i o cn oi o N w ωCD M Oo ω

1094 OE2 GLU 152 128.681 19.252 50.034 1.00 22.78

1095 C GLU 152 124.977 15.750 47.413 1.00 13.63

1096 0 GLU 152 124.114 16.463 46.904 1.00 20.19

1097 N ALA 153 125.1 15 14.458 47.125 1.00 18.04

1098 CA ALA 153 124.271 13.778 46.143 1.00 14.37

1099 CB ALA 153 124.859 12.417 45.794 1.00 13.44

1100 C ALA 153 122.815 13.624 46.580 1.00 13.36

1101 0 ALA 153 121.921 13.577 45.738 1.00 11.20

1102 N SER 154 122.574 13.568 47.889 1.00 16.02

1103 CA SER 154 121.218 13.413 48.416 1.00 13.22

1104 CB SER 154 121.250 13.157 49.928 1.00 8.73

1105 OG SER 154 121.581 14.330 50.651 1.00 16.49

1106 C SER 154 120.312 14.607 48.118 1.00 14.26

1107 0 SER 154 119.087 14.504 48.207 1.00 26.54

1108 N HIS 155 120.915 15.735 47.757 1.00 14.00

1109 CA HIS 155 120.154 16.942 47.457 1.00 8.22

1110 CB HIS 155 120.920 18.177 47.928 1.00 2.00

1111 CG HIS 155 120.932 18.340 49.415 1.00 2.00

1112 CD2 HIS 155 120.036 18.914 50.255 1.00 3.97

1113 ND1 HIS 155 121.946 17.856 50.211 1.00 3.74

1114 CE1 HIS 155 121.676 18.123 51.476 1.00 12.80

1115 NE2 HIS 155 120.522 18.764 51.529 1.00 11.17

1116 C HIS 155 119.742 17.092 45.997 1.00 10.18

1117 0 HIS 155 119.025 18.030 45.645 1.00 16.07

1118 N VAL 156 120.182 16.163 45.152 1.00 6.86

1119 CA VAL 156 119.843 16.202 43.733 1.00 7.09

1120 CB VAL 156 121.109 16.099 42.823 1.00 5.97

1121 CG1 VAL 156 122.161 17.113 43.248 1.00 2.00

1122 CG2 VAL 156 121.678 14.682 42.841 1.00 4.04

1123 C VAL 156 118.866 15.087 43.354 1.00 11.84

1124 0 VAL 156 118.644 14.827 42.170 1.00 13.76

1125 N ARG 157 118.264 14.443 44.351 1.00 12.59

1126 CA ARG 157 117.329 13.357 44.074 1.00 21.43

1127 CB ARG 157 117.224 12.398 45.271 1.00 17.56

1128 CG ARG 157 116.482 12.908 46.491 1.00 22.45

1129 CD ARG 157 116.525 11.846 47.583 1.00 26.00

1130 NE ARG 157 115.512 12.037 48.620 1.00 35.19

1131 CZ ARG 157 114.360 11.370 48.676 1.00 40.41

1132 NH1 ARG 157 114.064 10.465 47.753 1.00 42.25

1133 NH2 ARG 157 113.505 11.598 49.664 1.00 42.66

1134 C ARG 157 115.945 13.815 43.609 1.00 22.46

1135 0 ARG 157 115.473 14.885 43.985 1.00 28.62

1136 N THR 158 115.334 13.012 42.740 1.00 30.57

1137 CA THR 158 114.003 13.287 42.200 1.00 23.48

1138 CB THR 158 113.951 13.012 40.675 1.00 18.85

1139 OG1 THR 158 114.132 11.613 40.424 1.00 23.14

1140 CG2 THR 158 115.044 13.781 39.959 1.00 5.29

1141 C THR 158 112.962 12.409 42.911 1.00 26.07

1142 0 THR 158 113.258 11.786 43.936 1.00 29.73

1143 N HIS 159 111.745 12.362 42.373 1.00 25.85 en 4k 4k CJ t-v> t ro

O en O en en o

CO CD CO CO 000000 000000 oo co oo oo -vi vj vi vi vj vj vi vi vi vj cn cn cn cn cn cn cn cn en en en en en e 4k 4 4k eo ro -* o co oo i δό en *■ eo ro -* o co oo vj cn oi 4k. eo to -k O co oo -M oo en 2 n en co ro -' o co oo vi cn en s en en eo to ->• co oo vi cn cn έ

PP P Z O PPOOO O O O O O O O O O O O O O O O O O O O O O O O P P Z O P Z P Z O P P O (DCD > O OCD CD > OO O CD> O O O CD > O O O CD > CD > to -k rπmoσcDcπ> -k _-. ro ro -* to -- ro -■ -- ro

CD O CD CD f- r- |— ι— r- r- r- >>>>>>>>>>>>>>>>>> ______-._ϊ zcc zci i ci iczccz 1 ' ' ' ' ' ' TJ "0 TJ "O TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ "0 > cococoωc cococ c)

Φ cn Φci) cn cQ θ) Cj) θ)α) φ φ θ) θ)θ) θ) α) c^ c e cΛ eΛ k k 4^ ^ 4^ k k e c e e c ω e eo M M N) M to M i r -^ -k -k _ι _k _k _ _k

to -- O O O O O O -k ω e vi i ρ α e vi p i p p i cn k k p p ^ ω ω 4 4k ω p ω ro -_ _- o o oo oo oo oo co co o

8 to -k O) to 00 b ro ^ 4k ro ro 4k to c 4 co 4k c_ ώ eo eo b co bo vi ro ^ to σ) t ∞ - 4k co co co cn to en to cn en ~ vl vl c _n o co -k o cn co vi oo M oo M en cD e_o vi. o to io o- e_n. c-n oo vi 4k - -_ cn vi ^j cD co vioi coo- co v| v| cn o vi — vt co vj c -o- c —ji -' o — c-n o-.o- c—n e-o. e —n c _n -k e —o co- o— o —o c —n e -o- cn- e—n c-o o co oo oo oo cn vi co 4k CD CO 00 co t - σ> vi oo vi co oo vj co oo oo -vi cn 4k cn rroo kk co 4k en en en CO vj en en oo en 00 v| — oo CO CO 00 oo cn N OO tD lO jfl co vi cn oo cn vj ro -- e ccn oo co op σ ccnn> o b oooo oooo 4k CO vl cnn --vvli o 0o0 eenn CcOo CcOo 2 CJ

2 e bni 4k rroo ^-> eoni vi c io eo vi ro p Cn 4 CO 4k to oi ro oo - * ro -vioo cooo oo oo v ii cn r roo o ooo c ono o _ *_ to oo ttoo - cc-nnee_oo ccnn o 0-0o o e enn 4k eenncCOo -- eo ecoovj r co en eo -- v| b 4k co cn bι co co en 4k en co to oo S o - -en S σ) - . COo co -- en 8 ro 00 2 2e

CO o c 0n) CCOO oO vvll OoO v| o0 O0l1 tto04k -k I -k CO -- eO -k ro 2 " c"o" -k ro co en oo cn ro vi co oo oo vi - e e en en c 4k 4k 4k 4k 4k 4k 4 4k 4 4k 4 4k k 4k - 4k 4k k 4k 4k 4k 4k 4k k 4k 4k 4k 4 k 4k 4k C0 k k k 4k 4 4k k 4k

- ^ _ ρ ^ u α M ) α α ιn Ln ) M p co s ui M ffi αι ιη ^ ^ N u ω u ^ r b ^ ^ ι e e b b eo 4k 4k b k3 v| vi en eo co en b b en ^ ro b 4k jo ∞ c o 4k en o en c -' eo -k θ co -k vi to vr _k to K5 cΛ C_o vi c- to eo co ω <s en oo o p lo cn o en en eo eo 4k C^ co M ω -k -k ea 4k 4k e ro vj o M θo e -k ro o co o co eo cD M o e co -k 4 -k θ 4k M co o o en c cjι ^ cΛ 4k co oo o v^ oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo

4k to -k ro co ro -- ro ro - to co ro to 4k co ro ro ro to ro ro 4k eo 4k ro to co ro -- rroo rroo rroo ro ro eo ro -' -'- ro io ro ->■ ro ro -■ ro ro ro o 4k oo -- to co vi to o oo 4k O CO OO C O CD 4k vl O> OO v| CO Cn rθ oo co oo co c "o~ c'o~ ro 4k vi o 4k ro en ro iD oo 00 p ro 4 O 4k 4k

^- s ^ iωb ω A ω ^ ω e eo en ω --k eenn 4 oeo ccoo --voi vi to o -k en eo cD ro en en ro v cn co co oo c _n. vi b o b b vi oo co co oo en oo ro 4k eo 4k eo cn oo ro o -vi vi 4^ eo vi cD 4kk Jk. oθ oθ oo -k K3 -k θ 4k en -k cn eo co en oo co o o ro (O_ O OO Ol ϋl M -

1194 CD GLU 165 112.819 5.561 51.814 1.00 57.24

1195 OE1 GLU 165 1 11.765 6.076 51.375 1.00 63.77

1196 OE2 GLU 165 " 12.850 4.434 52.353 1.00 62.32

1197 C GLU 165 115.907 8.727 52.405 1.00 16.81

1198 0 GLU 165 1 15.598 9.687 53.106 1.00 18.04

1199 N ASP 166 116.817 7.828 52.771 1.00 23.03

1200 CA ASP 166 1 17.497 7.914 54.061 1.00 27.94

1201 CB ASP 166 117.383 6.579 54.811 1.00 35.23

1202 CG ASP 166 115.936 6.177 55.082 1.00 50.03

1203 OD1 ASP 166 115.565 5.024 54.771 1.00 57.17

1204 OD2 ASP 166 1 15.169 7.013 55.606 1.00 53.93

1205 C ASP 166 118.966 8.330 53.943 1.00 24.13

1206 0 ASP 166 1 19.674 8.409 54.950 1.00 23.24

1207 N ALA 167 119.401 8.638 52.721 1.00 14.78

1208 CA ALA 167 120.780 9.044 52.443 1.00 16.72

1209 CB ALA 167 120.993 9.169 50.948 1.00 12.70

1210 C ALA 167 121.215 10.333 53.136 1.00 24.13

1211 0 ALA 167 122.355 10.443 53.590 1.00 29.67

1212 N LEU 168 120.317 11.313 53.193 1.00 27.80

1213 CA LEU 168 120.614 12.590 53.831 1.00 19.27

1214 CB LEU 168 119.540 13.623 53.487 1.00 23.80

1215 CG LEU 168 119.706 15.016 54.099 1.00 18.12

1216 CD1 LEU 168 121.006 15.642 53.626 1.00 19.21

1217 CD2 LEU 168 118.524 15.890 53.719 1.00 17.36

1218 C LEU 168 120.730 12.450 55.343 1.00 20.39

1219 0 LEU 168 121.663 12.973 55.943 1.00 26.94

1220 N ALA 169 119.776 11.755 55.954 1.00 22.95

1221 CA ALA 169 119.784 11.555 57.400 1.00 28.99

1222 CB ALA 169 118.472 10.934 57.856 1.00 26.34

1223 C ALA 169 120.959 10.676 57.816 1.00 31.11

1224 0 ALA 169 121.529 10.855 58.895 1.00 32.24

1225 N PHE 170 121.319 9.736 56.944 1.00 26.27

1226 CA PHE 170 122.423 8.819 57.197 1.00 22.01

1227 CB PHE 170 122.448 7.714 56.135 1.00 20.64

1228 CG PHE 170 123.592 6.747 56.284 1.00 28.63

1229 CD1 PHE 170 123.622 5.837 57.338 1.00 28.29

1230 CD2 PHE 170 124.642 6.745 55.368 1.00 25.46

1231 CE1 PHE 170 124.683 4.938 57.479 1.00 27.46

1232 CE2 PHE 170 125.706 5.850 55.500 1.00 24.24

1233 CZ PHE 170 125.726 4.945 56.558 1.00 22.35

1234 C PHE 170 123.752 9.564 57.205 1.00 20.63

1235 0 PHE 170 124.440 9.610 58.224 1.00 23.76

1236 N SER 171 124.095 10.156 56.066 1.00 16.15

1237 CA SER 171 125.340 10.899 55.918 1.00 12.93

1238 CB SER 171 125.476 11.429 54.488 1.00 12.97

1239 OG SER 171 124.397 12.281 54.152 1.00 12.50

1240 C SER 171 125.479 12.047 56.912 1.00 13.92

1241 0 SER 171 126.567 12.297 57.420 1.00 15.50

1242 N THR 172 124.372 12.726 57.205 1.00 16.38

1243 CA THR 172 124.383 13.854 58.137 1.00 16.69

M M M M M M I M t M t M M M M M M M tO M M M tO M M M NJ M to rO M rO O M I M ro M M M M co (o ωco co ∞ o3 n o3 θ- Q9αm ά M S M M S M s s s M α) θ α) co co ά eo ro o - c —o 0 —0 vl cS 0.4- ω M ^ o co e vi c en 4k e M -k θ co e -M θo e 4k co

P P P Z O P O P O z P P P P P P O O P O P CD > CD CD > zooo~omoσoooo>z o o o

I o r σ o o S o o CD ro o oozozoooo > rπ m o o o D > O CD CD CD > ro - IO -- -v IO a o o

- -k to ro -.

v| v| -g ^ι - v| ^J vi i vi j ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^ ^j -sl ^i ^j ^j -i - i -o - - i ^i - - oo ∞ e c vj ^ ^ ^ ^j vj c—n c —n c —n c —n e —n c —n c —n e -n c —n e —n e—n e—n e-n- e-n- c—n e—n e-n 4k 4 -k 4 -k k k k 4k k k. eo eo eo eo c co co co ro o ro ro ro

UU U U U U I I I r N M I I Kl M M I rO UKl tO M I rO N rO r rO N M M I r N N N I M uu ω ^ M J (D ω -) ffi (Dω ω * *cripp) Cop pco co p ρco cn ro M ro vi s oo co -k v| _. eo eo oo M ^ ω ω b ^ b ^ ω ^ bb M b ω ^ i ^ ^ ^ M o'o co vi o co eo co oo i eo _. - oo CΛ 4k Co < p cD C3> e vi e en en vi o. p - -k 4k p en co en en -' co cn p cβ eπ en e -n en to eo ro en - 4 en o vi o en vi vi ro o 8o o eo 8 c -k M e -M co o eΛ 4 co e r eo to o e 4 vi e vj oι 4k oι vj k -- c-o en vi eo cD co co - co co oo oo o

cn cn cn cn cn cn en en en en t- -> N) -' θ θ (θ (o σ) oo cn co o cn - _ i e co - -v ,i o„ vj ro oo co en 4k cn co ro en o co o oo en oo oo σo oooooooooooooooooooooσooo o o o o o o o ooooooooooooooooo ooooooooooooooooooooooooo o o o o o o o ooooooooooooooooo r ro -- -k -k io ro to ιo eo eo ro en 4k en eo ro ιo -' co -k -•■ -k |o ro ro co eo eo co 4k eo ro -' eo ιo eo co ro ro ro ro ro -- _- _. k rθ CO vi ^ ϋ1 vI k 00 ^ v| θ f - p vJ ^ p v| p rθ 4 |O vi vj ρ ω rk p vi 4 co co c ιo ro co σ ro 4k eo 4 ro vvii cnbeno 44kk cpp i to efl i ^ b b ^ ^ ^ b e eo Koi mo w ω ω όi ω b b ^ ω ^ i i -k vi o - e ~n en o ~ CD eo oo co eo oo -k CO vj vj o oo eo o vi fo o oo o co o o oo cn vj 4\ o eo 4k vi ro co co cD co oi eo c)o cn. o o

1294 0 ALA 178 135.107 14.054 62.769 1.00 24.74

1295 N ALA 179 133.124 14.975 62.214 1.00 25.32

1296 CA ALA 179 133.630 16.326 61.971 1.00 25.36

1297 CB ALA 179 132.460 17.289 61.779 1.00 32.63

1298 C ALA 179 134.658 16.943 62.928 1.00 23.67

1299 0 ALA 179 135.706 17.420 62.487 1.00 23.47

1300 N PRO 180 134.384 16.929 64.244 1.00 21.48

1301 CD PRO 180 133.196 16.355 64.900 1.00 20.79

1302 CA PRO 180 135.291 17.505 65.247 1.00 20.21

1303 CB PRO 180 134.601 17.155 66.568 1.00 10.68

1304 CG PRO 180 133.162 17.108 66.203 1.00 16.34

1305 C PRO 180 136.747 17.040 65.264 1.00 21.05

1306 0 PRO 180 137.623 17.772 65.722 1.00 30.38

1307 N HIS 181 137.015 15.846 64.750 1.00 24.41

1308 CA HIS 181 138.372 15.310 64.785 1.00 20.38

1309 CB HIS 181 138.359 13.955 65.498 1.00 22.19

1310 CG HIS 181 137.686 13.989 66.837 1.00 20.19

1311 CD2 HIS 181 138.077 14.524 68.018 1.00 22.10

1312 ND1 HIS 181 136.437 13.448 67.055 1.00 24.79

1313 CE1 HIS 181 136.086 13.649 68.313 1.00 28.39

1314 NE2 HIS 181 137.064 14.300 68.919 1.00 34.90

1315 C HIS 181 139.073 15.184 63.443 1.00 16.56

1316 0 HIS 181 140.138 14.575 63.351 1.00 20.78

1317 N LEU 182 138.496 15.775 62.407 1.00 19.38

1318 CA LEU 182 139.095 15.698 61.082 1.00 19.81

1319 CB LEU 182 138.023 15.838 59.999 1.00 12.64

1320 CG LEU 182 136.883 14.822 60.017 1.00 9.36

1321 CD1 LEU 182 135.883 15.191 58.946 1.00 6.26

1322 CD2 LEU 182 137.414 13.405 59.808 1.00 5.44

1323 C LEU 182 140.164 16.760 60.884 1.00 23.01

1324 0 LEU 182 140.177 17.787 61.567 1.00 24.75

1325 N LYS 183 141.071 16.492 59.953 1.00 23.75

1326 CA LYS 183 142.139 17.426 59.646 1.00 25.95

1327 CB LYS 183 143.300 16.712 58.948 1.00 25.08

1328 CG LYS 183 142.946 16.106 57.600 1.00 32.88

1329 CD LYS 183 144.157 15.465 56.949 1.00 39.75

1330 CE LYS 183 143.804 14.905 55.581 1.00 45.64

1331 NZ LYS 183 144.980 14.277 54.913 1.00 50.66

1332 C LYS 183 141.590 18.522 58.747 1.00 26.52

1333 0 LYS 183 140.579 18.333 58.068 1.00 31.05

1334 N SER 184 142.247 19.675 58.769 1.00 25.24

1335 CA SER 184 141.842 20.806 57.949 1.00 18.75

1336 CB SER 184 142.202 22.111 58.656 1.00 15.62

1337 OG SER 184 141.536 22.192 59.906 1.00 17.72

1338 C SER 184 142.553 20.707 56.605 1.00 13.85

1339 0 SER 184 143.666 20.186 56.528 1.00 23.56

1340 N PRO 185 141.930 21.221 55.526 1.00 14.69

1341 CD PRO 185 142.636 21.342 54.235 1.00 6.08

1342 CA PRO 185 140.622 21.886 55.462 1.00 13.32

1343 CB PRO 185 140.758 22.747 54.213 1.00 7.14 1344 CG PRO 185 141.553 21.860 53.309 1.00 4.25

1345 C PRO 185 139.378 20.990 55.368 1.00 19.26

1346 0 PRO 185 138.268 21.502 55.198 1.00 22.11

1347 N LEU 186 139.547 19.671 55.478 1.00 15.43

1348 CA LEU 186 138.410 18.757 55.385 1.00 7.82

1349 CB LEU 186 138.859 17.304 55.533 1.00 10.45

1350 CG LEU 186 137.743 16.259 55.379 1.00 14.68

1351 CD1 LEU 186 137.199 16.257 53.953 1.00 2.00

1352 CD2 LEU 186 138.269 14.885 55.744 1.00 10.39

1353 C LEU 186 137.339 19.061 56.424 1.00 14.43

1354 0 LEU 186 136.147 19.062 56.114 1.00 15.11

1355 N ARG 187 137.774 19.318 57.653 1.00 11.19

1356 CA ARG 187 136.868 19.626 58.755 1.00 10.77

1357 CB ARG 187 137.675 19.929 60.019 1.00 9.64

1358 CG ARG 187 136.839 20.202 61.251 1.00 12.29

1359 CD ARG 187 137.724 20.530 62.429 1.00 17.99

1360 NE ARG 187 136.944 20.796 63.633 1.00 40.99

1361 CZ ARG 187 137.468 20.982 64.841 1.00 53.63

1362 NH1 ARG 187 138.785 20.931 65.014 1.00 54.42

1363 NH2 ARG 187 136.674 21.217 65.879 1.00 49.07

1364 C ARG 187 135.949 20.804 58.424 1.00 19.68

1365 0 ARG 187 134.754 20.771 58.731 1.00 20.19

1366 N GLU 188 136.512 21.831 57.789 1.00 19.04

1367 CA GLU 188 135.758 23.026 57.405 1.00 14.75

1368 CB GLU 188 136.708 24.179 57.052 1.00 18.38

1369 CG GLU 188 137.416 24.825 58.248 1.00 25.44

1370 CD GLU 188 138.326 23.865 59.000 1.00 37.02

1371 OE1 GLU 188 138.143 23.708 60.228 1.00 36.96

1372 OE2 GLU 188 139.224 23.271 58.362 1.00 33.70

1373 C GLU 188 134.819 22.758 56.236 1.00 15.06

1374 0 GLU 188 133.720 23.317 56.176 1.00 16.38

1375 N GLN 189 135.263 21.920 55.301 1.00 12.50

1376 CA GLN 189 134.458 21.567 54.134 1.00 10.80

1377 CB GLN 189 135.269 20.711 53.153 1.00 10.38

1378 CG GLN 189 134.529 20.384 51.856 1.00 9.35

1379 CD GLN 189 135.415 19.722 50.811 1.00 16.04

1380 OE1 GLN 189 135.319 20.022 49.617 1.00 8.08

1381 NE2 GLN 189 136.277 18.812 51.254 1.00 11.78

1382 C GLN 189 133.204 20.814 54.574 1.00 12.51

1383 0 GLN 189 132.117 21.057 54.059 1.00 19.40

1384 N VAL 190 133.363 19.920 55.546 1.00 11.87

1385 CA VAL 190 132.250 19.139 56.070 1.00 14.05

1386 CB VAL 190 132.750 17.975 56.967 1.00 18.34

1387 CG1 VAL 190 131.574 17.265 57.637 1.00 19.94

1388 CG2 VAL 190 133.556 16.986 56.135 1.00 2.59

1389 C VAL 190 131.300 20.031 56.865 1.00 12.69

1390 0 VAL 190 130.091 20.012 56.642 1.00 16.38

1391 N THR 191 131.858 20.822 57.777 1.00 19.11

1392 CA THR 191 131.065 21.727 58.606 1.00 20.76

1393 CB THR 191 131.964 22.557 59.551 1.00 23.59

4 4k 4 4k 4 4k 4k k k k 4k 4k 4k 4k 4k 4k 4 4 4 ,-k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k CO CO CO CO CO CO 4 CO CO CO CO CO eo co eo co ro ro ro to ro ro ro ro ro o co co eo ro -k o co oo i cn cn co ro - o eo o3 vi cn en 4k co ro r-o ro ~-. -k -. _ι _k _ _k _. _k _. o o o o o ό o o o o co co co c o to oo vi OT cn 4k co io -* o co co vi cn cn 4k co ro -k O co oo vi oo cn 4k owooz OPZOOOOO oooooooo o o o o o o z o ro > r > o σ oo > O P P P rn m o o ro > CD > OP rZπPmZoPo P ro — k IS rπ o oo PpPco>ZOPP pOp to -- r ro -k _k ro ro — - rrrrrrrrrrrrrrrrrrfπrπmmrπrnmfπ >xx x xx xx xxx ococococ zzzzzzzzzccccccccccccccccc ^cocococococoωc coco X X X X 73737373

CO CD CO CO CO φ CD φ cp φ eo eD CD eo co eo cD CD co co co co cθ cD eD CD ep co cD <p co co co co co cD co cD co co co cD co co co co co eo co co v| v| v| v| vl 5) en e e OT OO ao eJ) e e en efl e efl eji e cn eji 4k k k 4k 4 4k ^

ro io roto ro ro ro ro -■ -k -• ro ro ro t roo -- ro ro io ro ro ro ro ro ro ro ro ro ro ro ro ro cn .fk i 4 jo v| oo oo co o o -* -k co -' to eo eo en vi cn en en 4k 4k co ro ro co -k renn reoo icon .to L__ rn i en io σ> ep 4k 'vi b o co ro o oo eo cn 4k oo en en cn o -' co oo oi o) -k o co co oo ro 4k -- 4k θo k to r -vi oo oo co ro en ro -' o o oι eo co ro en -. vi en cn o en ro ι 4k eo en oo oo vi eo vi σ> oo c c -k -' c 4 co o o "o - ro - c —n i k _. n

4k 4 cn cn cn cn cn cn cn cn cn cn cn oi e_n. e _n. cn en en en oi en en cn en en oi en oi i oi oi en oi oi oi cn en cn cn cn oeni oeni cn en cn en en cn co p co o o -k -^ to o -k -k -k to e cn ι O fβ (D OO oo oo -vi cn vi co co oo cjo n 4k p ω Jfc.4. *. ro co 4k ttoo CcOo 4k en p oo vi o p l- 4k -- co 4k bo σ -- cn b co vi 4 4k b CO 004k vi ω cθ k k O -k vl oo b bi eo vi cn cn eo b b ^k 4k vi vvii vvgi po b vl CO 4k ro co -A Cθ -k Co co en eo cn ro 4k CO CD CD Ol e_o e_n. o cD vi p eo e _n. o cn vl a _>. o n ro co co ro vi 4k ro coo 4 -k ro co co ro en ro 4k oo cn o eo to co -k -k o coovioroc kovicoe 2. ji -k O v| * co o eo eo o co 2o eo c co cn 4k σ) co en co -k oo k - co 2 CO -• -k 4k oooooooooooooooooooooooooooooooooooooooooooσoooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ro -k ro eo -* cn en σ> 4k ro ro ro ro ro ro -' io -k -' io -i -' _. r _k _- ro _- _- _- _- _- -- r -' ro .o

- p p co ;- p O o ω io o vi 4 cn p -k po p co co po o p [o MMaup a u v| to p CD eo eo ro eo vi bi CD eo cp J In vi en en vi -_ bo eo en co e b) eo '-k 4k io oco )io ^k 4k k 4 CO v| ip 4k b eo bo 4k ^ co b bo σ> ro ro en en en ro vi ^ι en 4k -vl -k 4 vj _k -x| cn cp σ> vi ro -vi oo -k co -k θo -k ooωoo vio) -* en en vi o vi ro O 4k o cjι co co 4k cn ro oo o

en c_ eo t to o en O en O en o

4k 4k 4k 4 k 4k k 4k 4k 4k 4k k 4k 4k 4k 4k k 4k 4k 4 4 4k 4k 4k k 4k 4 4 4k 4 4k 4k 4k 4k 4k 4k 4k 4 k 4 4k 4k 4k 4k 4 4 k cD co cD Oo oo ω oo oo & oo oo oo oo vi ^i vg ^i ^i -g ^i - -^i - oo cn c cn c p cn cn en cn en en en oi oi e e oι oι 4 k 4k k co M -^ o co c>3 vi c e k Cό r -k θ CD θo vi c e 4k eo ro -k θ co oo vi cn c 4 eo ro -k o co oo -vi en en 2 eo to o co oo vi σ> en

P P P z O P P P P P z P P P P P OPQ oozooooo OPZPZPPPP O P P P P O Z pro > CD ro > o CD o ro > > N m o CD ro > m m o σ o ro > O O O ro > ro - ro ->■ _- ro ro -_

CD CD Ω O r-r-r- χχχχχιιχ χr-r- r-r-r-r-ι— r-p ooonooooooo^^ '^rr^-<-< -<-<wcocy)Cotoco CΛ CO Cθ CO C/. CO CV- CΛ O. CO CΛ C/) CO ^

ro M ro to M ro to to M ro ro to rO M M rO M ro ro NJ ro o to ro ro to ro to to io ro p o p p o o o o p o p p o o o o p o o o o o p o p o o o o o o co cD co co co co co eo co co eo co co co co co co co to eo co co eo eo co eo ro ro ro ro ro ro ro o o o o o o o o co co co cD co co co co co cD oo cβ oo oo oo cD Oo oo vi

ro 4k cD 4k

oo co co co eo ro ro ro ro ro ro ro ro ro ro io io ro ro ro ro ro

O O O O O O J J U I -' U M -' I -' U

p i i _. v| vi CO pco oo cn -k to 4k cρ 4 en vi co oo co i Ol CO vl

4k J> 0 co0 pp c -o oo en M Cg vl 004keo -k cn o -o enoo c -n co e_ Sc_ σ. cn δ cncn o -- -- oooo eσn. ccoo _ -_. . OcnO Oenl 44kk 2 cn 2 oo -_ oooo ccnn cenn

O vl M 5 σ oo to 2 eo ov| vi -k co eoco co vi o -kCS coeo oo co cD eo o eo ->. cn co oo en eo o en vi cn oosro.2 v -_ cn vi o en oo

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO

_. ro -- -_ _k _k _k _k _- ro o ro __ _k _. ro ro _. -_. _v _-. _k _. -_

O 4k ^ p ro ρ p ro p rs3 rk r' ro 4k --- p | kprop4k 4 r oo o -k co o p ro p 4k 4k 4 σ> to ^ 4k en b b eo ^ '-^ ^ e b to eo bι b vi bo co 4k k I. co eo vi to 4 o o 4k CD o oi vi 4 o eo -k e eo ro en o -k - eoenfeoen^oocnroucobro-kθ^oooioo-v'itcoovib4k 2 4- co bι oi 4k Co 4k cn o- co en oo oo -k o co

en 4. 4k e_> eo to IO o en o en o en o

cn w cn cn cn cn cn cn cΛ cn cn cn cn cn cn cn cn cΛ cn cn cn cn cn cΛ cn cn cn cn cn c^ c-n cΛ cn cn cn cn c^ 4k 4k 4k 4k 4 4k 4- 4k 4k ^ ω eo eo e eo e. eo co co ω ιo M ro M M io ro ιo M N. -k -- -k -- -- -_ -_ -- _k -- o o o o o o o o o o p CO CO CO CD CO CO co ro -k o co oo vi oo oi ω ι ^ o co oo vi c c eo ιo ^ o co c vi cn cΛ k eo ro -k θ cD oo vi cn e ^ co ro -k θ to oo vi oo en

PPPPPPPPZ OP z P Z P P P P

Nm O P P O P P OPOOPPPP O P P P P P z

N m o CD ro > rom -_o roσoro> o z o

X -k OO - > m m O o cα > a O cα > o o z z ro to -- to _ ro -k x x N ro - rn o

TJ TJ TJ TJ TJ TJ TJ TJ TJ > > > > > > > > > H H H H H H H OOCDOOOCDCDO < < < X X I X X X I X 5θ Λ 3J π Λ 5D7J Λ 7J π 5θ X X X X X X > > > mrr mπ\mmmmmQΩθΩQG)G)G)G G)Ω737i73 373 3 3 C C C C C C C C C r- r- r- r >->>>73737373737373 rOOO O OO

ro ro ro ro ro ro io ro to ro io ro ro io to ro ro ro t Mo M ro M ro ro to to ro to ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro

O u Ou Ou uO Ou OuuO Ou uO Ou uO Ou Ou uO uO Ou Ou uO 1 o"1 o o o o o o o o o p o o o o o o o o o o o o o o o o o o o o co co eo co co eo co co co oo oo oo oo oo oo oo oo oo e c v| v| vi vi vi vj vi cn o) cn cn cn cn cn cn en en en cn en C θl Ol 4k k 4- 4k 4k 4k k

so ON eo eo co co co eo co CO CO CO C 4O- C vO| C pO C pO C pO C pO C 4O- co eo co eo eo ω eo coeo eoeoeo ro ro ro ro ro eo ro eo ro ro ro ro io ro eo c CO CO CO CO CO CO

(uωuuuu cn co ω p k ^i i ω ^ jsi ^ M p p p p p p i p i f- c - to to co ro _k o b vi co 4k 0. co b eo b b ceoo -k co vi b en eo oi *, _ b ω i i. b i M b ω - (ji M b b - 'c—o co ro en 4- bo to p ro vi o vi o oι -k vi p cp vi co cn co 4- (D- -k OOvi en eo vi vi eo co Qo cD O oi o co JS oo J^ oooopgpenrroo oo cconi cooo ccoo - co en en ro eo *- oo ro oι vi o o o oι δo 4- co en o ro to Ol vi cβ vi co oo to o o ro S oo o oo oo eo oo oo eo oi S 3ϊ-k vvviii tccooo cccoo eeoo eenn ccn cn o en o

en en en en C e en 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k k 4 4k 4k 4k 4k 4k 4 4k 4k k k 4 4 k 4k 4k 4k 4- 4k to CO 4k J_ roo J- -- ω ^ p p α po po p io io oo v| 00 vi p oi p to ro ω 4- oi v| p p p o OO vl p p - vl CO v| vi en en 4k CO CO o o o "vi -_ b _.bbbjqb robbt b Ol fO k co - co σ> o i 4- v| *. cn en co co OO _k bo CO k Ol ω co - cn to oo co en cn vi eo vi o i o cn eo eo ro oo co -- en io -k O oo eo en o cn *. o eo en 4 oo co k oi - vi o eo _

-vi o ro oo o oo to co cD OO oo oo vi cn o 22 CO OO CO vl OO vl CO O en oo co co oo en oo cn -k to oo 4 ro en cn ro vj cn oo oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo O OO OO O OO O O O OO OO O OOO O

-_ _k f __ o 4 4k 4 eo ro ro -k to ro -k -k -k -' -k ._ _ _ _ _k _ _k -k - - - M M

. ro- v .i o_ cn ρ ω ro p vi p vi M p p p 4- ω vi to vi p -- p ρ ω p p ω ro pi v! 4k p -_ vi ~ ro co ro co ro p cn p 4k p -k oo bw Mωi) i M *i i^__ ^v| ii ^ i Jkvi eo co _ b 4k 4 b b 4 cn vi vi eo o ω _ 4- cn M -k W oω ffl α) M - -' ^ o - _ (Λ M - iv) r M 5 ωM< ι _ ω M ϋi co co co o co o ro o -' co co oi oo en en

en e_ eo t t en en o en

oi en en en en en en Sen oi oi oi oi oi oioi oi o cnieenn en cn oi en en en en cn cn en en en cn en co co co co oo oo oo Oo go Co oi oi cn cn cn cn cπ cn cn cn cn co ro -- o co oo vi MS vl M M M M M M M CD O en OO en en cn en cn cn cn en en en en en cn oι oι oi cn . .4- J_ . . co to -* o co oo vj en en 4k co ro - O CD 00 8 vl. OO Ol *. eo ro -k θ co oo vi en en *k co o -k θ co oo vi c e k

PPPPPPPPZ OPPPPP O P

Nrπomooro> oro > O P O o ro > PP NPrπPrπPσPσPoPcαP>ZOP to ro -> -- o -o _o roroP>Z O P O o P ro P > ZOPPPPPP o CD -k - ro ro _k ro --

--.^^^^^^d^rmFmrmrmrmF rmrmωπiwmωMmWWmMmω Wm(mΛ tmΛ ωr r rr r r r r T' "" '" "'' "θ''' TJ "u TJ ''' "t) "" TJ

737373737373737)7) 737373737373737373737373 m m rn m m m m m m m m m m

I rV) MI. M rO M M I I rJ f r I K} M M Mr Nl M r M M r MN M M M M M M M M M M M M M N M M M M M M M M M

_k _k _k _k _k _k _k _k _k _k _k _k _k _k _V _k _k _k _l _k _k _k _k _k _l _l _k _k _k _l _k _k -_ _k _k _k _k _k _k _k --k -_ -_ -_ -_ _- -_ -_ 00 eΛ eΛe cnen e cΛ c eΛ 4k k 4k k 4k 4 4k eoeo eo coe e M iθM M M ro -- -- -- -k -k _k -k __ o o o o o o oo o o o co co

M M M M M M M rO M M M M M

N f ω _ ro

vi o c vi αo cn ρ ρ o to vcoiM^ cωo esvM] o-Nooffl-* vϋii(cθ(vni tokωvi r„θ -r^* vMiϋSnc^ω^cen vri c-nneMθeo(vθiθo ^ p o vi co K e cjι en o cθN- bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb oooooooooooooooooooooooooooooooooooooooooooooooooo

_ αi

M w

2 ρo p p c3) en cn cn cn cn cn cn cn en cn cn cn cn cn cn cn cn en cn cn oo cn cn cn cn cn cn ccnn cn cn cn cn oo cn cn co coo cn cn en en en en en en k 4- 4- co co eo eo co co eo co co co ro ro ro ro ιo ro ro ro ro ro -_ -k O O O O O O O O O O CO CO CO tO CO CO eo ro -^ o eo oo vi o) Oi S eo to -k O co oo vi cn cn 4k eo ro -k O cD 00 vi C0 O14k CO fO -k o co oo vi cn en 4k eo ro -k θ cD θo vi cn cn 4k

P P P P P z o o o o o oooooooo OPZPPPPP m o o ro > o o O or P P oo o> R mS σ o ro > β mH o o ro > N m o o ro > OOOOPPPZOPO o α o α > ro -k

> > > > > > > > -H -) H

TJ TJ TJ TJ TJ TJ TJ TJ Λ TJ TJ

M r M r- r r iO M r N i M - _ - - _ - - _ - - _ - - - - - _ - - _ - _ - - _ - - - - - _ O O O O O O _ ω _ _ _ C0 _ ω _ CB _ 00 C0 _ 00 _ _ „ M M M M M M M M S _ _ 00 CI) _ σ) a m

k k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k k O 4k 4k 4k 4k 4 4 4k 4 4 4 4 4k 4 4 4k k 4 4k 4k 4k 4k 4 4 4k 4 k 4_ 4k k p vi -j n p vi -vi ρ p p vi p -- ro ω p k k Ol * to ro CO eo 4k oo Ol Ol Ol CO

_w O vMi ro co ro eo - r bb M u s- r - r. ω i - 4- ωb i - J- v| v| v| 00 cn v| cn vi 00 O O S S N - ϊk Co cD * en oo en ιo cD oι en o cn vi co o o -- oo vi co ιo oo p en 4k cn en ro ro v| ro n o o to 00 v v|l 0 44kk CCoOO CD vl cn CD S cn ro co ro -i -k 4k -- oo co oι o eo eo en co vi o fo eo 4k rθ 4- co o ro oι oo co o 2 Ol oo co __ oo c vl oo 2 cn co to o O o Oo ccnn rroo o ro eo -k

M M4k W Mto r-- Mp -∞ c_o ^vi - _ ^ J J ^ ^ Jvi Jp ^ rp rρ ro r^ ∞- - ^ Mp M- r-- M pr Mp W vi vi M pI-ι M Mp r Ico Up r rvi p N:fk M M.^ ω j u s ω _ b rθ vi * ^ - - _ j _ b ω i) ^ b r vi ^ b vi M ^ M θi ω M _ ω - - cD w _ . oo co - M θ -k θ θi - ro io -- vi ro eo vi o —o -k to vi cfi ϋi to o -Α ω oo tn - r cMD ni --ι ωJ. -^ o w ro c .o- e.o. o o .ro. e.n- „ co - mcn _ o -fi ω o ω en ej- o"o ro r -o. o-. o_ e.n 4.k oo co oo vi en

4k 4k k 4k 4k 4k 4k 4k 4 4k 4k 4k 4 010l 01010l 010l 4k OI 010I Ol 4k 4k 010l 01 010l Ol en en en en en en 4k Ol 4k 4k k 4 4 k v| vi pθ p pi p pi v| v| v| p p p p ro ^ -k -k p p p p p p p p p p p ro -k p eo eo to o o o oo o CO CO 00 00 CO 00 to v| _ b eo vi vi ro 4k bo bι bι bo α> 4k bo cp bo bo ω to '4k to b ro bι vi co -k b S CO -k CO O O 4k 4k CO en -k ro VI

_ oι tn _ _ p _ _ _ _ ri s to w M _ 5 θ ω M M Oi r- - 5 r- M _ p CO O M M en ro cn -- o ro co vl en 2 oo en e _n. k

O) I CO O0 Cn ^ vi 00 CO v| O04k C000 o vi co o cn vi 4k cn c o. co oo co -vi oo cn co co -_ cn co co J- vl ro vj 4k co en ro 4- oo o ooooooooooooooσooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

4k co ro -k -- ro eo co en 4k eo eo c ω co oi M cn eti Jk ω ω ω 4k k Ol 4k 4 CO co M ro co co co ro -k ro ro co ro co co eo co io ro ro ro ro t [θ. t *k vN| pω tn j_k O p p p p Jk po p ^ fΛ M M J M J * cpnΦeo tNo cWn J-k 4*k o weo tenn vi cn cn oo vi en 4k p p ρ p ιo p p p _k |o r- b i ω 4- b ω M '^ M r b b b ^ ω ω ω 'jk M - b i ^ |k ω ^ ^ bo ifo b- to bi co bbo bo cbi co M (o ω k θ _ _ n M <o c" -" (o ω o - M _ ∞ -' M r oo M ^ ω ω ω M θ _ s o N S M w -' 5 -' _ ω o _ w

c_o cn cn c3θ cn c7) cn cn cn ω _ co co oo oo α & oo co ro o — C -O- 0 -0- vi o5 c

co t"o o _ t .o- o -o. vi cn 2 en

Z P Z P P P oooooooz o o o o o o z o o o o o o z X N m o o ro > O σ o σ P o P r P P Z O P o o o P > N

IO O -kO CD > ro σ -_ o ro > O o ro > o o z o ro - to o > Z O — σ IO α -k CD o

> > > > > > > > ι_ r- r- r- r- r- r- r- r- r- r- r- r- r- r- r- < < < < < < < > > > > > > > > > > > > > > > > r- r- r- π OSO^OπOΛO^OπOπOroCiClimCrCπrCπrCnrCπrCπrCj^CrCπ^CrCπmCCCFr-r-r-t-r-r-zzZ Z Z Z Z Z Z Z Z Z Z Z Z Z co

M M M rO tO M M O tO ro M M M ro rO M M M fO M M M Kj tO tO IO M M M M rO lO M M M Kϊ M M

M M M MS M M S cn ro o> (θ) ffi c cn ϋi oι - ι -n -n αi ui * 4.4ι 4k ^ 4k 4 ω ω ω ω ω

4 k k co σ> iD b bo en CO vl 4_

vi to vi

4k CO CO CO CO C0 4k 4k 4k 4k 4k 4k 4 CO co eo eo eo eo co eo eo co co eo co co 4k 4k 4k k 4k 4k 4k 4k 4 4k 4k 4 o co co eo oo eo o o oi oi 4- eo ro CD vi co oo cD co oo vi oo oo oi vi co co o o eo 4k CO - — ' — _k - co co O IO CO p 4 co oι θ vi e oι eo cD CD cn cn ιo en 4k -k -ι oo ,'b k k b _, v ,i M bo 'v ,i b _ ^ 4 ,k en ro eo ro eo bo co 'vi oo oo o en co o co 4k vl o oo ιo σ> jS oo ω to cn c_ r co o o co 4k vi 4k oi vi o o co cn c-o cp cn oo -vi cn en co co co υι -k 4k co cn ro i) ϋi _ o S M Co i θ) - s cn c - vi - M oo co co co -* cn cn ro 4- o "o -- r ro o oo 01 -_ -v| O C0 00 C v| o ooooooooooooooooooooσooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo co ro ro eo ro to rroororo -k -_ -_ _- _- ro -k -' --ro --- --~rroorroortoo ---- rιoo ro -k -- ro -- ro ιo ro -k to _k _. _k _. _. ro --

^ t po j- p αi vi j p α po αu u M p ~n-ooo - ϋi - _ ω (D 00 -- N -oi i ^^ w

CO 4k k to Ol IO r ro - b ] b b b b i j ω io b b '-- κ> i b oi 4- oo eo cn eo e e-ι bo co oi vi bι co cn ro oι _k b b 4k oi io co ro ro 4k en co 4k co e oo 4- -k c 4 4k -o o co _k o i 4 vi 4- co o oo oo oι ro o vi ro -- ro 4k co ro eo vi coo 4k o ro ro en

1694 NH2 ARG 227 149.963 35.561 38.831 1.00 19.58

1695 C ARG 227 144.911 30.745 39.367 1.00 17.48

1696 0 ARG 227 144.475 31.894 39.402 1.00 22.08

1697 N PHE 228 144.474 29.822 38.516 1.00 17.49

1698 CA PHE 228 143.439 30.073 37.516 1.00 20.78

1699 CB PHE 228 143.184 28.770 36.741 1.00 17.58

1700 CG PHE 228 142.261 28.908 35.556 1.00 10.74

1701 CD1 PHE 228 141.685 30.128 35.214 1.00 18.32

1702 CD2 PHE 228 141.958 27.791 34.785 1.00 13.57

1703 CE1 PHE 228 140.819 30.230 34.122 1.00 18.76

1704 CE2 PHE 228 141.095 27.883 33.692 1.00 18.93

1705 CZ PHE 228 140.525 29.106 33.361 1.00 12.22

1706 C PHE 228 142.158 30.552 38.205 1.00 20.33

1707 0 PHE 228 141.585 31.580 37.834 1.00 17.12

1708 N ALA 229 141.746 29.817 39.233 1.00 15.85

1709 CA ALA 229 140.541 30.125 39.989 1.00 14.57

1710 CB ALA 229 140.320 29.069 41.059 1.00 11.49

1711 C ALA 229 140.572 31.513 40.619 1.00 22.21 1712 O ALA 229 139.606 32.272 40.505 1.00 26.82

1713 N LYS 230 141.683 31.841 41.278 1.00 17.14

1714 CA LYS 230 141.836 33.136 41.933 1.00 13.72

1715 CB L LYYSS 230 143.118 33.168 42.766 1.00 17.71

1716 CG L LYYSS 230 143.067 32.332 44.030 1.00 14.07

1717 CD L LYYSS 230 144.343 32.505 44.835 1.00 23.37

1718 CE L LYYSS 230 144.253 31.802 46.177 1.00 31.01

1719 NZ L LYYSS 230 145.477 32.021 46.994 1.00 32.57

1720 C L LYYSS 230 141.816 34.310 40.956 1.00 16.07

1721 0 L LYYSS 230 141.111 35.292 41.176 1.00 15.73

1722 N L LEEUU 231 142.585 34.202 39.876 1.00 17.93

1723 CA L LEEUU 231 142.646 35.260 38.872 1.00 20.80

1724 CB L LEEUU 231 143.653 34.911 37.775 1.00 18.38

1725 CG L LEEUU 231 145.141 34.870 38.116 1.00 16.32

1726 CD1 L LEEUU 231 145.920 34.518 36.863 1.00 14.82

1727 CD2 L LEEUU 231 145.593 36.212 38.658 1.00 15.83

1728 C L LEEUU 231 141.287 35.506 38.233 1.00 24.81

1729 0 L LEEUU 231 140.828 36.647 38.151 1.00 28.14

1730 N A ASSPP 232 140.648 34.427 37.790 1.00 28.52

1731 CA A ASSPP 232 139.344 34.503 37.139 1.00 23.60

1732 CB A ASSPP 232 138.878 33.104 36.736 1.00 20.22

1733 CG A ASSPP 232 137.737 33.137 35.742 1.00 29.93

1734 OD1 A ASSPP 232 138.019 33.223 34.527 1.00 24.38

1735 OD2 ASP 232 136.564 33.079 36.174 1.00 26.36

1736 C ASP 232 138.300 35.170 38.032 1.00 20.67

1737 0 ASP 232 137.622 36.111 37.612 1.00 15.86

1738 N PHE 233 138.203 34.707 39.274 1.00 12.27

1739 CA PHE 233 137.244 35.260 40.219 1.00 12.59

1740 CB PHE 233 137.355 34.549 41.569 1.00 14.20

1741 CG PHE 233 136.243 34.887 42.524 1.00 30.75

1742 CD1 PHE 233 135.130 34.058 42.634 1.00 33.32

1743 CD2 PHE 233 136.298 36.042 43.302 1.00 29.41

vl v| v| v| v| vl vl vl v| v| vl vl v| v| . M . . p p co c ∞ oo oo oo o QO Qo| ∞ Mcn oo| Mvi vi vSi j | M | M M M M M M M l M S S M M S M | S vl S S l M M vl S M M

S oa oo oo v| vi vi vi vi vi vi v| vi vi OT CΛ en c cπ p cn σo coo cn en oι oι oι oι c oι oι oι oi k k k 4k 4k co ro -- o co oo vi M ^ o _ ( M _ ω * ω r _ o _ M θ ϋi i ω N. - o _ ω M θ) tn t ω w - o _ _ M θ) -n 5

P P P z oopcopppz OPZOPPOO O O O O o o o O O O O O o P Z O P P P O O P O P o ro > m o o ro > m m σ o ro > to — - o σ o ro > o σ o ro > O O Q CO > N m rn ro -- to -- ro -_ t -

cccc_J(_^_j _4,_^-|_Jrzzzzzzzzzcrccccccccccccccczzzzzzzzmmrπrπrπ

M N r M M N N r M N M N rO M N M W M M M N r rO M M M N M M N M rO M M M M W M M M M M M M M ω ω ω ω ω ω ω ω ω ω c ω ω u ω u ω ω u u u ω ω ω ω ω ω ω ω ω ω c ω ω ω ω ω ω ω ω ω ω u co co ω ω u ω ω r_ ω ω _ oo ω _ oo oo cB ω oo M S M M i M M M M _ θ) θ) θ) σ) σ) _ cn cn cn cn cn ϋi cn

co eo eo eo co co 4k 4k co co co co co ω eo co eo eo eo e co co c eo co co co co co co co co eo eo co co eo 4k co - 4k 4k CO CO CO C eo c C

- to c jS 5 JS -- o oo vi oι _ι e ^ oι vi oι c cn S c~n c"o co k oi σo oo vi to co co to co to oo co -k co c O O CO ∞ p v| 4k θl 4k cn to co to co ro 001 r CD v| CO vl 4k -- CO o_ S o cn oi ro cn en co vi cp ro 4k θo O 00 CO v| - -- o oι eo co i b b i 4. _ f co co oeni -k fc o ω co cn vi oo vi oi cn cn io cn en vi oo oo o oi M M - ro to oi S ω o - -cn- o eni wcoio o en -k co en en αo oo co ctoo o 4- -* co o ro oι oι o o o o -_ -vi _k -M e -n - cn o -* CO -- o cn -k vi cD co ro vi eo ιo 4k CO vi 00 v v|i ocoo tro co vi o oi ro oi co oo

y to ω ω w ω ωto ωco ω ω 4 CO k 4k 4k 4k 4k C CO CO o co c . 4k k 4k 4_ . -Ik k

55 θl O) M M 00 M 00 i 0000 O CO 4 co co ro -k p vi vi ωωωωωωωωωω c e co e _ ^ e c -vi en vi cn e eo ^ 4k en vi oo co co co co ro -- o O O O

- vi ^ '^ ^ ^ vj b A ro- i _ b e 4k k oi b e cn _k 4k ro vi i co '4k io _ i θ vi ro co ro ρ oo o oi co en vi co oo o *. σo vi -M -k co t. eo vi oo eo S o c _o. o δ ϋi M . CO r IO ϋl Ol U O O CO M M ID O S M O o oo o to co ^ o oo ^ oo oo o ro oo o vi ro -- oι vi co oo cn co vi -. oi ro cn oo ro 4k O vi eo ro cn co oo eo eo o ro 4k vi ro ro ro oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ro -k to ro ro ro ro co ro ro ro ro ro ro _ _ _ o o _k p o p ω o pω ∞p ttoo 44k oo troo rroo ro to '-_ v| CD 004k CO i vir | M M o ro cn vi o to eo ro oo to cs to 4k eo oo c3) -k io

m Q0 C m 0000 C_ 00 p3 O300 O300 O30000 C- 00 O300000000000000000000 O000 O000 oo oo oo oo oo oo oo oo oo αi co vi M S v| -M

555 S ω ω ω ω ω ω ω ω ω ω r r r r ι rv) r t ι ro - _ - _ - _ - _ - -k o o o o o p o o o o co co co co co to co ιo -k θ co oo vi cn oι Φk ω to -k θ co oo vi cn oι 4k eo K5 -_ o co oo vi en en 4k eo ro -k o co oo vi en oi S co ro -k Oo c cDo oooo vvij oooo en 4k

ZOPPpPαPoProO>ZOOOmOmOoOCDOroO>ZOO mZOrnOαOo rO >OZ OOZOPPPPZ

N m o a co > OOZPZPPPPZOOPP

ΓΠ ΓΠ O O O CD > αo ro t o ro -_ -k ro ro -

cccccccc_cccccccc_zzz____zwωwwωMwωwωWMWt,lt')t')cccc

M N) M M N) M NJ N) M r M N I r r I N) I M N) N M r M rO M cn k coeocococococococotororororororototo O O O O O O O O O O CO CO CO tO

O ro to ro ro ro ro to io io ro ro ro ro ro ro ro co co co co eo co eo co to oo e v| vi cn vi vi v| vi o) vi oo vi vi oo vi o o σ -k - -k - - eo co to vi o - oo o vi eo ro c cn cn cn vi ro to -_ oo ro v _ to i v| __ Ol CO . e cno c coo o J_n oo _k oo co ro o 4.4k en oo eo o oo ooeocn-ko 2ocooo

- co i en to oo _ θo

C p0 4pk 4pk 4ωk 4tok 4fok 4-kk 4pk CpO CvOi CvOi Cj& bo bo co to bo bo 4k lo b bo bo b eo en eo o oo co en eo ro -- o co oo eo eΛ θo - ro vi -- ro -' θo ιo

oooooooooooooooooo _o_o_o_o._o_ooooooooo oooooooooooooooo ooooooooooo o ooooooooooooooooooo ooooo oooooooooooooooo co ro o ro -- -- -k _k_k o- - - - -kroeo4 c eo4k4keoror ro-kro4 4 ro- - --rios) tro ro - _ _k _k _ _ι _ | - -k r* v| to p 4k tO IO roppρρp ropoωtoootopppθ4kpρωpρ to4kc p -k ro ro p 4k p vii-vibbbub A b b | j ύι ^ b ω - b i b ω ik ( ω b tn oi ^ vi to cn rocnooencoroJS-k vi -k CD C0 -k 00 O C0 *. O O O 0> 00 vl 4k 00 4- O -k CD S cO CO -k -k 01 00 - eoo o oi vi -_ o oo co vi eo e en cn

00000000000000000 ,0090 -0.0000000000000000000000 000000 oo oo Qo oo oo co c- cs ∞ co co cs c oo co cn ∞ c- ∞ cn ∞ c ∞ ∞ p p p cρ po go o o 01010 —00 ^0 δ 00 Op S . Mv| Mvl --g' --M' -v|' --v'| --v'l 'v'| -vi' ^cn SJ σj σό oo p oo coo en cΛ CΛ en eΛ en cji oi en en en en JS J^ *: *. *. eo ro o CD 00 v| en C t0 -k O C000 v! 000l 4k C0 rO -- O C0 e vi oo oι ^ eo ro -- o co oo vi cn oι 4>- co ro -k θ co oo vi cn en

PPPPZPPPPPPP ZOPZZPZPPPPZ P χ toN CONrπσr coηm rop tooro> x tox -■Nmooro>

<<<< <

73737373737373737373737373χ 073737373737373 37)mrnmmπ\tn >>> > > OCDCDOCDCDCDOCD>> >

TJTJTJTJTJTJTJTJTJTJTJTJTJCDCDPOCDOOOOOO^I^Λ^Λ3JΓ" Γ- Γ" Γ" ,~Γ' Γ"ZZZZ ZZ ZZZ

ro ro ro ro ro to ro io io ro ro to ro ro ro ro ro ro io ro ro io ro ro ro io ro ro r roo ro M M M ro to ro ro ro ro ro ro ro ro ro ro ro io ro ro ro cn cn cn cn cn cn cn cn cn C _-n. _i. e_n. O_l.4. 4.k 4. 4k 4 4k 4k 4k 4k 4k 4 4k 4 _k _ 4k _ 4- _ 4k _4k _4k _k _4 _4k _4k _4k Λ4k A4k _4 A4k _ A Λ _ _4 _4k o σ o o o σ o o o σO oO oO oO cCDO cCoO cCDD CO CO CO CO CO CO CO CO OO OO OO CO OO OO vi vl vi vi -vi ^i -vi oo cn cn coo coo coo cn cn cn en en en en

ro -v ro ro ro M U rO rO W M rO rO M M M M rO W M N M r rO r M I M M M M rO M r O M rO M M M M o cn vl cn vl OO OO vl OO CD ' to β eo o oo co co vi oo υi 4k 4k p eo oι oi 4k 4 ro co ro to eo co 4 4 en 4k vi oι oι cn cn vi vi vi co oo ιo en vi 4k en co oo cn vi cn ro en 4 b vi k b c to 4 ι ro to 4k 4k _- ro b ro eo o eo -vi ro 00 O CD cn en k o en co en _ oi vi __ oi eo en -- 4>. eo 4k o _o o _ en o co co oo eo -k vi cn eo oo scJ) oo pi vi co -k 4k vi co cn cn -* co 00 tO v| oo ro —k o oo co oo oι vi o -k θo -k vi cn cn en vi oo ro ^ M tn - en cn i ϋi M - oo ω ro δ ω - r Jk O O CD O CD vl 4k vi c O 2 o en co oo o en en en en en en en e enn ecxni ecjni ecjni ccnn ecjni eenn ecnn en cn en en en cn en en cn en cn en en en en en en k 4k k en cn en en cn cn cn cn cn cπ cn cπ cn cn -k eo eo M M ω ω p vi ^ ^ - ^ ^k j&. -k r fo .-k -- co oo co o o ro o -k O -k - to -k - -k

^ _. to vi L_ OO CO 4k 2ω cn o o o o _ ϋι co M en r _ (θ cn _ _ ω σ) s co ω cn cft (θ - (cjn) vi o) vi cn ro ro co vi ro c_ cD 4k — k eo en ro vi en vipjO M e o eo vi oi 4k vi ro eo o co ro o oι vi cD cn p ceoo vi eenn o rroo eo eo c n co c n 2 M ω ^ oo uj n p φ M

_ (O - -(DMCO cn en ro o o ro oo en o 4k -_ _. ro vi _k co cn en oo ^ en ro v oi cn 2 oo -_ ro vi ro co vi cn cn vi o cn vi

Co eo eo co eo co eo eo eo co eo co eo co co eo co eo co co co co co co 4k 4k 4k 4k 4k 4k co eo eo 4k eo co co eo co eo co co eo co co co co ω ffl ffl ffl S fn W CO ffl S p p M CD p ffl M tn p M M M M p p - J U eo M ro J p p p s p B p s p vi co o -k 4k CΛ e eo oι oo σ> -k -- oo o vi m vi oι vi ι 4k to^, v „i o _. b _. e „o o vl co co -■ ro oo ro co 4 co eo ca co coo vi _k c oi S eo en -- oo ro co oo eo K -k en 4k co ro vi oo cD Oi en 2i co to cn b vi 4k CO , co oo o en 4.k 4k t ,o_ C .O k oo - o co eo c ro co cn en

-_ c oo vi cD eo eΛ M ^ -k -- eo ω vi θ vi vi o co eo vi o - 4k eo eo vi ro en σ oo vi co co ιo __ ro to -k co co ro o oo co cn co en cn

2 CD CD CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO CO co co cD co co co co co co oo oo co oo oo oo

S ω ω ω ω u ω ω ω u ω N r M M M rJ M M M M J o o o o p o o o o co co co co co c

CO2 to -_ o to oo vi co cn eo to -k θ co oo vi oo oι 4>. eo ro o co oo vi en en 4k co ro -' θ co oo so en 5 co to -k o - co- o-o vi c - o n en 4 -k pzoooooooz oooooo o o o o o OZOPPPP p p p p z > o > σ σ o oz P O P O o o o O

N

IO o _k o ro to -- ro > o o o r > O ro o -k oo m α ro > iNNm ro to ro _ o m m o Q oo > -k co ro ro

T xJ TiJ >co>c >w>ω>w>ω>cocorπ- |m- r- |r—π Im- Γ- I- !- > > > > > > > > r- r- r- r- r- r- r- |— r- H H -H H — I — I H H H H H -H H H H mmτjτjτjτjτ τττcccccrcπcrπccτΛϋτiJωTJωTjτjτjτjτjcoωw

M M M I N M IO IO M N M M rsl l M I M M rO M r rO M rJ N rO M N ae cnnccjnιccΛnccnnccjniccnnecnnccΛnccnne4n-e4n-e4n-e4ή-e4n-e4n-e4n-e4n-cencncncnencjicneΛenenenenenencnenentJoentΛCΛ eocoeococoe .o.e-o- rototo .ro. r.o.ro. rororo _

o ro ro ro -* _Λ ro _ι l I roW rO I M Is) - - - - - - - - - _k _ ro to -k

4k e p4 e vivivic 4kθ enencnenenvivioo _k K5 -k to co o co p 4k ω ω to ro p p p p p p ρ co σ) vi vl co o co o co p - oo *> o coro _ s i όooos vi booo iro boo)O ovi , '- σ> k _- k co oo to en -* b vi b - s b b io b - ik i- b co ∞ - b bo ro ^ to e vi c vi ω e e eo moo fflp _^ v)j cO v] "o fθ * '

. to _ vi : c _o; : ro: M M - ro oo ro co co oι oo en vi cn 4k -k eo co to cD -k coo 000 -0. vi σ p o eo en vi s 4

4 - co o

OO v| 2 0) 04- 1000 ro o 4- o M ϋi - - o oo ω s - c—o o — o -o- o —o o -o e -n OI -k O) v| D C -k 4k eo 4 -k - O v|

4k 4k 4k 4k 4k 4k 4k 4k CO CO C0 4k 4k eO CO CO eO CO eO CO C0 4k 4k 4k 4k 4 k 4k k k 4k 4- 4k 4 4k 4k 4k CO CO p 4- en 4- en p p p p ro -k -k vi oo o p cD p co p vi vi p -k -k coo en ώ ιo ιo - io - co ro ro k co co ro - co oo ω ro σ> ω - '- _ b- tn b vj _ r i b is) ro ^ ω b ω ι 4k b r ω s to cn co co 4k |o cn ro -k θ θ θo cn o o o tk - to r M ro 4- - θo o co eo en oo co o 4k CD 4k eo en eo 4- 4- o ro -' vi oι co eo o o c~o- 4k vi ro co 4k vi ro co o -k θo co oo to co o 4- o eo eo oι ro co co oo ro o OT Co vi vi co o vi o ro -^ eo en oo vi eo co en -k Oo en co co co 4k -- oo cn cn 4k coo co vi --k eo ooooooooooooooooooooooooooooooooσooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo en en tn cn M M M Cn 0l 01 4k 0l 4k 01010l 0l 0l 4k 4k 0l 0l 0l 4k 4k 4k 4k 4k 00 v| cn cn 4- 4k 4k 4k co ro -- ro ro ro ro co ιo ro ro ro ιo co cn cn 4k oo to o o U ^ ffi p 00 p M - I N Φ p j - p U N U v^i rιuo rro. eni tvιi cωo cωn vi oo co ro o oo vi 4k oo co oo ro vi to _ι — 4k -k . vk -vi. o_o. cn. -4_k -.k v-i. o_. ιe_ 4k o _o. e .o_ v4 i rθ b r c b 4 4 to ^ b -k to ω 4 o o o ι ^ i^ 4k ro w oo oo vi o 4k vi oo ιo co co oo oo oo eo co vi co to cn eo oo M e o ^ 4k M θ vi -k M e ro o e oo to o o -- cn c -k vi 4- co c 4k ro

x . < < < < < < < TJ TJ TJ TJ TJ TJ "O TJ TJ J 7L3Jr >>- f>> f>> J>>>>>xχ χxχ χ χxχ r- mrnmmmmmmm

M rO M M M M M M M M M KI N I I M rO r r r I rO M M r M rO M M M M M M M M rO M M M M M M M M M M M M M M cn en en cn coo eπ c-o eπ en OT eΛ en en cn en eπ en en en en cn cn en eji cn eΛ en en en cΛ CΛ Cji cji ci cΛ en

N r M M N) J J J J ^ J J θ O O O O O O O (0 t0 <0 _ l0 (0 _ 000000 Cθ 0000 K M N M M S M 00 uj m 01 Φ

oo vi vi cn en co 4k ro -k ro ro co co co O vl CO 004k ro -k o en oo -k co o en en oo v| C'O 4- co co ro oo cn oo cn ro cn

00 CO CO 4- ro ro cD oo vi to oo cn 4k cn eΛ cn en en en en en en en

C 4- OO vl vl O c ■n b oo b b b b b b b v vϊl roδo 4k vi ro co en vi co

-- co

ro vi oo -k -- co eo en en en en en en en cn e _n. e oni en en 4k 4k 4k k 4k 4k 4k 4k k k 4k 4 4k 4k 4k 4 k k k oi 4k 4k en 4k 4 4k 4k 4k 4k 4 4k 4k 4 o o ro ro -- co ro -k ttoo -k o o U c -o c .o o UiI 4 Unl c KJnl v vli cUoJ oUϋo cl-oJ vi oUoJ cUoJ UboJ Uo l CUO v| OU o-o l p vi vi p p ^ -k ro to p 4 en -k 4k bo '-- ro to 4k bι 4k 4k k UCI O UOJ v| v| v| vl 4- 4- c k

8 u - - vi n όι ' to 4k c c e ω e cn v| J o -^ c i co vi -_ iM ( bo ) bι bo vi σ) ro to bi 4k b3

_. co oo cn en 4k en vi cn oo vi oι cD _ oι - - ω s ro is. - 5 ϋi M vi o - ω M co cn ( o o cD -k CD Oi co en co o o ro en vi en co co en ro ro ro 4k 4- M eo en eo -k oι Co ro eo oo vi oo ro eo e 4k cn ro eo o cn co -vi co 4k vi vi < en co cn ro en cn cn en vi vi cB ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooσσoooooooooo coeo4kcnencne cnnccnn oι ooooorooi4-cn-- o en en vi to (OO) COO) co oo ro 4k oo 4- vi co

O O O P P Z OP z z P P P O O Z Z Z P Z PPP P Z O P P P Z O P O PO P P O O D > X X m oo ro > o σ o ro > xχNmooro> ro > i N m o m

IO -k β Z P O P O O P P P ro - ro -* ro - to ro -k

< < < < < > > > > > > <:<>>73>73>737>3 373XX73>73≥73(>Λ(^nW>^Λ>ωU>i >73>737>37>3>73>73>73>737>37>37>3>r>>>> r" F" p"OOOOOOOOOOO"D"0"0"aTJ-DTJTJOOOOO OOO O > >> 73737373737373

M ro roro roro M to to M M M roM MM M Mro M M M Mro to M to toto io ro M cπcn cncn cn cne7> cn cn φφcn φcncn encncn cncn cn cncn cnoncn ρpρρpρρpp pρen eπ cn o) encnen cn σ) cn cn cn c vi -o vi vi vi v| vicncn OTcnroOTcnccncnccncncncncflcncncn4-4- 4- 4-

o ro ro ro ro ro ro -k -k - -^ -k _k vi p p vl p vi p v|ppp -vi o o o o o o o o

O - - - 0 - 0 (O CO C0030) N vl p 4k 4k p p p -■ ro ro eo ro ro o o p p co p p p p oo oo ro o ro eo eocneocoθ34k oιbώόιco botocovibovico S' 4k eo vi to v| CD 4k bl CO k 00 v| tococo to iocn toro oo eo cn co Qo 4 2 co - vi ro roro - o rocnro ϋl MOO - n to -■ en o en eo oo vi oo 4k 4k cooo ro o oo vioo eocn oi 4k 2" vi en roco cD Co cn vi o cn en co oo co -k ^ co co -* oo ro 4- eo e to o 4k co to co oo co i o oo -k θ 4 4k <-n

4k 4 4- en k -tk 4k 4k 4k k 4k 4 4- 4- k 4k en en e en cen cenn eenn cenn 4k 4 4k 4k 4k en en en en en en en en en en en en en en vie5θ vjco o co ce_ en vi eco vi cΛ cnen <ι> vi e_ co p eo roro ro p —o —p — 4k 4k pi p p D o o ro -k ro ro co ro co 4k p co eo ω ω4kN r k ω4kbb jc | M _ . to to eo to 4.k - -- booo 'f en vi bo b b cn

4- - eo ro p -k en eo Q ro to cn enoo co-v] vi co vi 4-co vi cnoι -k p ~ vi i_ -_ ωco ^ b^- - vibb ωcn b ejιe 4k o eo go vi cp go eo ^ M c cn ro -- MO- toco vi en coo 4- -k vi -k o co vicoo c_ -- eo -- 4k roco en eoroeocn oo 4- vi oι 4- o co oo o cn cn co vi cn en ro 2 en co en co oo oi oi en cn en Oi oi oi en 4k 4k 4k 4k 4k ro o o o -k o o ro -k cn vi oo cD oo o UoJUo v —ir IoJc VJnI — . v -vii c _nJ to oo to oi co c c_ c co oo ro 4k c tn vl 00 CO

oco ro vi -j o oo oo bo 4k - cn oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo co eo ro ro to ro ro ρ vi p rk p

V| ω ω bbb

cn ro o c-oco vi cD -^ coooeen viee co oo eo vi eooo oovicn coooico 4- viro cnro co 4- vi eo o 4k 4k -- O

M ro rO M IO M tO M M M M M M t ro ro ro rO M M IO IO M M ro M M rO M M ro M ro i M M O O O O O O - O - O OO OOO OωeOβ OOO OCB OW OM OM OM OM NO OM O O O O O Q O O O O O O O O O .- O- O- O O O - O O O O O e e e cn - O -- O - O - O - -

CO CD CD CO 000000 M M vi 'M Ol Cj '" eo ro -k o co oo i C CO OO CO j l l vl S vl vj O CD CDώ O) cn en cn en cn cn en en en co ro -- o co oo vi oo oi 4k co ro -k o co oo vi cn cjι eo to -k o eo oo vi cn en 2 4 24k 4k k

CO tO -k O CO OO vl OO Ol

P P P P P O O O O O O O O O O m o r > Nmmσ oo ro ro oo roαoro> oooχNmoooooo P O CD mO mP αP oP co > z o o o o p Q oD o > roo rom -*■σ --oro> Z O O o p p O P O > ro -k ro -k

H H H H H H J TJ TJ TJ TJ T TJ TJ TJ TJ T H -H H -H H -H H

2 τj-τ2)2τ)T2)2T)T2iιIιιπIπιιm:r:ιιι:ιπ:3i:ιππ:ιπι:π:l:ιπ:rιι:ιι:ι^ΛΛ5S5Λ^Λ57^i^SΛ5S^Λ^5ΛΛ^o-<)-W<-ϋ<i(^-w<-(flrC"Cr"cr~rc'cr"rc"rc"rc~rc"rrr>r>rr

roro io to

SS M i C CS Cn ro C Q O0 Cnro O)ffien O) CI) UωωW

_(0(0(D _ _ - . COffl

ro ro ro to ro to ro ro Mf r M N N | N I I r rO M I I M I - M - - - - M I r M M M N M M M M M M M M en vi vi oo o -* to K34 ro en to 4k p ω p to vi 4k p ro :-k p p ρ r- rk r- o o -k - co o 4k e p eo ι 4 ∞ oo ro ro to en ^ ro to vi b ω to eΛ i o ϋi ι vi 4k ω -k co ro e o 4 vi 4- en oo -^ eπ co ro eβ eβ e -k vi ro - c rθ c eo -k -k p c o ω N3 θ 4k -k ro p p co co o - co c 4- o co -k co co c K5 -k 4- vi oo eo ejι en vi -k 4_ M cjι en 4- M ro -k eo cjι 4k 4k eo 4- 4- vi coo c^ eo eo eo eo eo eo eo co eo eo eo co eo eo 4k 4k 4k 4k k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4 4 4k 4k k 4 4 vi co co co oo co oo co oo cn vi co oo oo o o -k - - ro to ro co ω co p ω ro co p 4k p p -k co oι pι to co p o oo co oo ro co co cn cn ro ro 4k cp -- to ro O Ul ^ CD Cl - N W ffl CO ui en o αi -

CO o CO v| __ vl _- Cθ r r b 4k bo vi b ^- vi co ώ σ> bι bo -k bO eWo bO Itoo rbjιl c O C eo eD p v-i -—v c_n.e_- co o _ o o vl O QO O vl -k cp c _O . _ ccoo eeoo ccoo oooo oooo oθ ccoo --- o—o e-o cD- v| vi- 4-k θ--i o--ι o- o- σ- o en en cn en CO 4k -k co to CO 8 t e vl 3 O C04- 014k 4- 0 o 2 co oo co en vi vi vi. o—ι c—o -k θo eo cn cD ro co oo 4k θo en -k 4k co

4k 4k k 4k 4k k 4k 4k 4 4k k 4k 4k 4k 4k 4k CO e04k 4k C04 4 4 4k 4k 4k 4k 4k 4k 4 4k tn e 4k 4k 4k 4k 4k k 4k k 4k en cn - 4 co co eo co co vi vi vi vi OO OO OO 4k CO -k to co eo o -k co o -k |o to eo ιo eo eo cn p en p -k θ co oo v| vi eπ cn vi vi vi σ vi cn ro vi oi co oi co o _o.o _o.-k oo cn o cn co oo oo vi cn p 4k to co K to -* p ejι rk eo p - ro ω ro ep en 4k -- en b to — to oo co ro p o "o oi vi oo co oi oo co ro co o co to co o 4- e „o 2. n .-. . e _o- vi eo cB 4 oi 4k co o cn - o 4 cn ro o ro to o cD O -k Oi eo o vi o c ro to 4- oo oι co ea en cn o cn vi vi vi eo en 2- c -k co c54- e b o ω co vno oι vϊ i cn 4k o r 2o oo coo o eo cn co cn o oo o o o o o o OOOOOOOOOO o o o o o oooooooooooooooooooooooooooo o o o o o o OOOOOOOOOO o o o o o oooooooooooooooooooooooooooo

-k -k ro ro ro ro ro ro -k -k -k -i o -k to -k - ro ro -- -k -k -k ro to ro -k io -k -k -- ro to ro to ro ro -k ro ro ro ro eo co eo co

00 IV) r O 4k CD θ r UI (0 θ α p vi is) ω (0 ^ Φ Q N p ^ p | p p ^ ^ Ui vj Lι l_ o bι ω w vi ^ ro όι viM l_ to b 4k b to e vi j r r ω ~g c -k i o - θ - - c o o 4k 4k vi co ι i vi vi 4- co c c σ) co - M 4- co M cn -k c to ro co cn ∞

rO M N M M M M M M M r M N M M I r M M M M M M N - - - - - - - - - - - - - - - - - -' - - - - -' - - - - - - - - - - - - - - - - - - - - - O O O O O O 4> |k ^ U ω u U ) ω ω U U U N rO M M M N M M M r ^ ^ - ^ - - - - - - 00000

CO IO -k O CD 00 -vl eo ro -k θ co oo vi on en 4k co ro -k o co oo vi σ) en 4k eo fo o co oo vi cn oι 4k co ro o co oo vi cn en 2

P P P P P z O O O P P P P P P P P Z O P P P P P Z O P P O P P P P P P O P P P Z O P O P P Z O O α o o ro > χNrπomooro> O o ro > > o σ o ro > CD > x N fsi rn σ rn ro -- ro -- ro - ro co ro — . _k eo r- r- r- r- Γ~ I — i — i — > > > -H -. H -I H -ι -. -l rπrπrnrπrπrriiTirπ mmmmmm7)737)737373737373737373r-r-t-r-r-f-r--<-t -<-e cccz ccc c Γ Γ Γ 73 73 73 7) 73 73 73 73 > > > TJ TJ TJ TJ TJ TJ TJ TJ

rO M N M M M M M M M M M M N M M rO W rO M M rd M M M M M N M M M M M M M M M M

S M M M M M M S M M M M M M M M M M M M M M M S M M M M M M M M M S vl vl M M vl M M M vl N M M M co co co " co co co co oo oo oo oo oo oo oo oθ oo oo oo vi vj vj ^| v| ^| - O -) c-n e-n c-n c-n- e-n e-n- e-n- c -n en en en 4 -k 4 -k 4k 4k 4k eo co co co eo co eo co

ro co ro ro ro ro ro ro -- ro ro ro rroo rroo ro ro ro ro ro ro -^ -* -k ro ro ro ro ro ro ro ro to ro ro ro ro ro ro ro ro to ro fo to -k ffl p ffl M α w pi p p p ' --^' t"θ r C04k rO -k rO OO CD CO O -k rθ θ ω ω 4k vi vi ρ pi 4k ω to ro p p o ρ ρ σ> oi p Vl vl ω i b k 4k b r ω ω υι > w ^ o to oo o to roo tocD toco σo oϋii 44kk bθ ccoθ --k Cc oθo kk Ccθo eenn 44kk -- tc ^r'' itno eton ii kri ' 4k 4k to ro b to

C0 VI O0 v| O0 Cn ro C 4- v| CO 004k p 00 00 CO v| o 4,- eeoo eenn ccoo ccoo vvii ttoo ccDD ogiι eeoo eenn --kk --vvii ccoo oo oooo oooo pp 4k ro ro o co ro o cn cn co 4 vi oo eo 4k cn 4- 4k cn -k -ι ro -- co 4- oι ro ro to eo en c ~no ro eo 4- co oo oo o -k to oi vi cn vl . C-O. 4-.-- o- vi en en co co co o cn to co co eo co eo eo eo eo co eo co to to to co ω to C _O. co eo eo eo eo eo eo co co co co eo co co co 4k co co co co co co co co eo co to co co i l en en vi vi en vi p p 4k ro eo en 4- &. w i co cn cn vi co bι bo b b cn bo co 4k bo b vi to 4k o eo 4k 22 w vi bo en en t mo omo moo tro *v-ji renn e con κroι -k vi p oo oo en o) ro 4k ro co eo eo vi vi en vi ro o ep co en oo o ro ro - p en όi co p vi p -k o . -v .i o _o. eo 4k ro oo o cn co co oo en cn vi -_ 4- co oi eo ro cn ro eo c_ co en en co ro oo eo o J- cn ro eo co eo o ro to to 0000) 0) -k vi 2 to ro o oo cn o co cn en cn -k o co o vi coo ro cn 4k θo oo ro vi 4k CD co cD -k θ 4k ro to

ooooooooooooooooooooooooooooooooooσooooooooooooooσ oooooooooooooooooooooooooooooooooooooooooooooooooo ro ro ro - - - M _ M - - w - v| vl p vi cn c o cn ω to e uni ubιi ώ- coo o vi

M ro ro rO M t rO M I I M M rO rO M M M M M rO IO M M rO M M M M M M M M I M M M M M M

CO CO CO CO 000000 m p p pρ oo eβ vi vi v| vi v| v| vi vi vi vSi pO)ρO)Ocn)cpi)enJ)cOoo)cOn)ccnncσD) c0n ooiι ccΛnCtΛnc onic onie Cnn cn cn cn cn 4k k 4k 4k 4k co ro -k o eo oo -vi oi 2 00000000 vl viMviMSSM co ro -k o co oo vi cn oi 4 eo ro ocooovicncn4-coro-- ocooovi cn cn 4- co ro -k o co oo vi σo en

P z O P O O P OOOOOOOOOOOZ oozooooo O P P P P P OP O O P P P P Z o o o o o > O CD > χNrπorπgoro> m m N

IO —k σ o ro > o cα > σ m m o o ro > m m ro -k IO -—

CD Q CΛKCO CΛ CΛ CO2CΛ θ TJ TJ TJ TJ TJ r- f- π Kimπ^iπiπKiπi-<JJ-<_2JJiJ<J_J5JJ2JrflrrΩθrrθθrroorro2323JJS2231τ3i2ΛCr)orcrθrroorrooror X X X X X z z 737373737373737373737373737373737373-ZZZZ2ZZ^^OOOOOOOκZ:CZC(Z Z ZCl( : m m m m m

M θ3MQcN N 4-ffi4-αM 4-ιIc4oM M M rO M M M M r rO M M N M M M N M rO I. I I M M r M M M M I M M M M M M M M M M M M M M en en -m4-i49-- e"oθe"ooceoo eGo9θeo)oeooceooneooeo)Cc9omeo co ro ro ro ro ro to ro ro ro . O_ O_ O — O _ O_ O_ O_- O_ O_ C —O t .O- C.O- CO - cO

4 4k 4k 4 4k 4k 4k 4 co eo eo co e co co co eo co co co co eo co co co co co co co co co co co co co co co co co co co to to eo eo eo eo co ro ro ro eo ro -k o co co -k co jk en co 2 co eo en en vi vi co vi eoro eo Jk p vl i p p p M J ϋl ffl p i O - M o S k p cn -k - ro

-ωcoω 4k - 4k -cnι ooo-4k θ ωcn ootθ ui o oi eo vl oo -k co K34k to to to vi ώ M oι en bo bo to bo vi ro ro co

S <O CO - -k O O) 0 (000 - I M O _ ω θ tn - M M ro en - co p ro oι -' vi 4k θo 4k θ en vi 4- oo o to eo o cD θo to o oo cn coeo rocnoo co -- oo co vivi oo co ro coco oo eo o -- -k 2 O 5 -k co -v vi ro 4- cn ro co co cD Oo ro to oo cn cD -k Oo ro io co co -k vi ro eo co

oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo

2194 CB GLN 285 123.313 43.138 28.339 1.00 36.36

2195 CG GLN 285 122.119 43.974 27.883 1.00 42.33

2196 CD GLN 285 121.887 43.913 26.382 1.00 47.38

2197 OE1 GLN 285 122.208 42.919 25.727 1.00 45.82

2198 NE2 GLN 285 121.321 44.981 25.832 1.00 47.01

2199 C GLN 285 122.328 42.638 30.588 1.00 40.35

2200 0 GLN 285 121.503 43.413 31.076 1.00 46.67

2201 N ALA 286 122.242 41.312 30.686 1.00 38.34

2202 CA ALA 286 121.136 40.637 31.356 1.00 27.14

2203 CB ALA 286 121.252 39.136 31.170 1.00 34.43

2204 C ALA 286 121.067 40.983 32.837 1.00 24.71

2205 0 ALA 286 119.996 41.319 33.346 1.00 32.18

2206 N ARG 287 122.203 40.891 33.526 1.00 17.67

2207 CA ARG 287 122.261 41.212 34.951 1.00 17.77

2208 CB ARG 287 123.680 41.046 35.504 1.00 14.04

2209 CG ARG 287 124.013 39.659 36.008 1.00 21.57

2210 CD ARG 287 125.294 39.673 36.828 1.00 20.38

2211 NE ARG 287 126.451 40.078 36.033 1.00 14.48

2212 CZ ARG 287 127.080 39.293 35.162 1.00 22.09

2213 NH1 ARG 287 126.670 38.049 34.959 1.00 17.96

2214 NH2 ARG 287 128.132 39.749 34.497 1.00 25.61

2215 C ARG 287 121.802 42.642 35.207 1.00 24.30

2216 0 ARG 287 120.942 42.877 36.046 1.00 22.53

2217 N VAL 288 122.358 43.583 34.449 1.00 32.79

2218 CA VAL 288 122.031 45.001 34.586 1.00 35.93

2219 CB VAL 288 122.800 45.853 33.543 1.00 42.80

2220 CG1 VAL 288 122.484 47.329 33.718 1.00 45.42

2221 CG2 VAL 288 124.294 45.622 33.682 1.00 39.26

?777 C VAL 288 120.525 45.246 34.470 1.00 30.79

2223 0 VAL 288 119.927 45.888 35.339 1.00 27.62

2224 N MET 289 119.914 44.698 33.422 1.00 25.59

2225 CA MET 289 118.473 44.837 33.202 1.00 20.40

2226 CB MET 289 118.055 44.123 31.908 1.00 11.02

2227 CG MET 289 118.675 44.684 30.646 1.00 17.69

2228 SD MET 289 118.236 43.769 29.151 1.00 29.61

2229 CE MET 289 117.076 44.873 28.424 1.00 23.00

2230 C MET 289 117.692 44.246 34.383 1.00 20.89

2231 0 MET 289 116.762 44.861 34.901 1.00 25.06

2232 N LEU 290 118.104 43.063 34.825 1.00 20.72

2233 CA LEU 290 117.448 42.379 35.935 1.00 15.74

2234 CB LEU 290 118.020 40.969 36.078 1.00 14.98

2235 CG LEU 290 117.497 40.044 37.174 1.00 16.12

2236 CD1 LEU 290 115.981 39.981 37.142 1.00 16.37

2237 CD2 LEU 290 118.098 38.659 36.964 1.00 19.76

2238 C LEU 290 117.530 43.139 37.261 1.00 21.50

2239 0 LEU 290 116.561 43.172 38.019 1.00 23.53

2240 N VAL 291 118.675 43.761 37.534 1.00 24.67

2241 CA VAL 291 118.858 44.518 38.773 1.00 28.92

2242 CB VAL 291 120.280 45.113 38.893 1.00 30.77

2243 CG1 VAL 291 120.439 45.822 40.234 1.00 27.10 2244 CG2 VAL 291 121.324 44.033 38.742 1.00 35.91

2245 C VAL 291 117.872 45.679 38.826 1.00 33.69

2246 0 VAL 291 1 17.266 45.950 39.867 1.00 38.64

2247 N LYS 292 1 17.722 46.360 37.693 1.00 32.65

2248 CA LYS 292 1 16.819 47.500 37.589 1.00 29.16

2249 CB LYS 292 1 16.961 48.155 36.213 1.00 28.67

2250 CG LYS 292 118.314 48.814 35.986 1.00 28.14

2251 CD LYS 292 1 18.440 49.353 34.575 1.00 36.09

2252 CE LYS 292 1 19.765 50.059 34.370 1.00 37.49

2253 NZ LYS 292 119.962 50.417 32.940 1.00 42.24

2254 C LYS 292 1 15.369 47.102 37.849 1.00 25.46

2255 0 LYS 292 114.633 47.829 38.514 1.00 23.99

2256 N THR 293 114.984 45.922 37.365 1.00 28.08

2257 CA THR 293 113.627 45.401 37.536 1.00 20.11

2258 CB THR 293 113.385 44.183 36.617 1.00 19.93

2259 OG1 THR 293 113.325 44.619 35.252 1.00 19.22

2260 CG2 THR 293 112.095 43.472 36.972 1.00 14.44

2261 C THR 293 113.326 45.026 38.987 1.00 22.63

2262 0 THR 293 112.286 45.405 39.524 1.00 30.10

2263 N ILE 294 114.239 44.295 39.621 1.00 23.15

2264 CA ILE 294 114.058 43.884 41.015 1.00 22.01

2265 CB ILE 294 115.232 43.007 41.522 1.00 19.34

2266 CG2 ILE 294 114.962 42.546 42.958 1.00 19.45

2267 CG1 ILE 294 115.430 41.799 40.604 1.00 12.44

2268 CD1 ILE 294 116.564 40.876 41.017 1.00 23.70

2269 C ILE 294 113.959 45.113 41.910 1.00 21.14

2270 0 ILE 294 113.097 45.193 42.789 1.00 23.19

2271 N SER 295 114.841 46.075 41.664 1.00 27.23

2272 CA SER 295 114.879 47.310 42.435 1.00 36.44

2273 CB SER 295 116.063 48.167 41.979 1.00 38.02

2274 OG SER 295 116.508 49.015 43.021 1.00 50.33

2275 C SER 295 113.566 48.077 42.265 1.00 33.20

2276 0 SER 295 112.984 48.562 43.239 1.00 27.63

2277 N MET 296 113.083 48.124 41.026 1.00 32.18

2278 CA MET 296 111.843 48.816 40.685 1.00 33.20

2279 CB MET 296 111.659 48.829 39.165 1.00 33.02

2280 CG MET 296 110.820 49.978 38.637 1.00 34.84

2281 SD MET 296 111.653 51.571 38.807 1.00 40.22

2282 CE MET 296 110.937 52.162 40.336 1.00 31.58

2283 C MET 296 110.617 48.181 41.343 1.00 36.25

2284 0 MET 296 109.831 48.871 41.997 1.00 35.27

2285 N ILE 297 110.462 46.867 41.172 1.00 36.41

2286 CA ILE 297 109.327 46.145 41.743 1.00 31.22

2287 CB ILE 297 109.240 44.681 41.222 1.00 30.61

2288 CG2 ILE 297 110.401 43.850 41.748 1.00 32.13

2289 CG1 ILE 297 107.915 44.039 41.647 1.00 25.21

2290 CD1 ILE 297 106.681 44.725 41.088 1.00 9.77

2291 C ILE 297 109.362 46.151 43.266 1.00 28.01

2292 0 ILE 297 108.333 45.964 43.914 1.00 33.37

2293 N SER 298 110.544 46.369 43.834 1.00 26.49 en eo eo to to o en o en O en o

M rO M M N rO N M rO M rO rO N rO M M N M N M rO M M N M M M M e e co co co co co eo eo co co eo eo co co co co eo co co eo co co co co co eo co eo eo eo co to to eo eo to to to eo co

4 4 4 4k c c ω ω ω c c ω c co t ro ro M W M M to r ιo -k -' -* -k -k -k - _k - _k θ o o o o o co ro ^ o co <-o vi cn e 4 e M -k θ co oo vi en en 4k c ro ^ o cD c vi cn e 4 C M -k θ o oo vi cΛ cjι 4k eo M -k θ o ω

PPPPPPZOOPOOP OPOOPPPZOPOOPPP o O P P P o o o P P P o p O O O P m σ o o ro > ooro> oooro> oooro> O O ro > σ o o ro > O cα >

-k ro -J- ro -k ro -k ro -k ro - -k -k. ro

TJTJTJTJTJTJTJHHHH-JH-J>>>>>>>>>>>>>>>><<< <<< <FFFFFFFF ωcΛωcΛ x mx mx mx m rxnx mx mx 7)x 73x 737x3x 73x 73x 7)w τ>ω TJc ToJc ToJc ToJι T7)JC ToJc TΛJC TΛJC To>ω TJc ToJc TΛJW TJM TJM TJ> Γ-> Γ-> r-> t-> r- r>-> r-mrnrπrnrπmmrπ 7373737373

ω ω ω ω ω ω ω ω ω ω ω ω ω ω u ω ω ω ω ω ω ω ω ω M N) M to M M M isi ro is)

S p p P p P p O O O O O O O O O O O O O O O O O CO CD CO CO CO tO CO CO tD lD 4 4k 4k 4 4 4k e e eo e e e e M i M M ro N3 M M -k -k

co cD co co cD oo c

_-. tO -k -k -k -k -k _k _k. _k _k _k _k _-. _k _k. _i. _k . oeooooooooopooooo_*ooo 0 p o o o 000 pj-,-'prkr- o -ιoro.kωω ρppp α cn en vi en vi 8 o o p o en en cn 2 o o o o _k O O O O O O _k -k _k

Ol O) 5 Ol Ol M M vl -k Oo cD co co co co ro ro o vie ro^b-'bto tovitob-k eor e -' ovi o α oi co oo - K) co -k -k i to o b vi b -k b coo ro to co to ro -k toooc e oe o)e c 4ke 4k Ooeo-k+k e en vi vi ro -vi eo oo 4k o o- envivioroc cjie c -keco4k4Ok oor4oooivi 2vir -o- e- r-o- c-o- c-o- vi C vl 4k co o co oι vi o eo en eo o 4k eo co eo ro oo en oo co o oo oo en vi oo en cn en co oo co ro -k -k -- ro ro

4k k 4k k 4k 4k O cn cn c c cn cn c 4k 4 4k 4 k 4k 4- 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k k 4k Cn 4 e l i en 4 4k 4k 4k

00 vl vl vl vi ρ _ θ o ro _ -k p p p ∞ p vi i 4 p k Ol p v| vl CD v| p p p p ρ ro -k io -k p p vi vi ρ ρ ρ

-k io to en to 4 ro o 4k cn o cn ro to bo -k vi cβ to to b co ro -k ^ to b ro to bo bo b bo -k b vi k co eo b to b) bi b) bi bi 4k eo en o o co v -_| _k _ι . t/ O.l. v -|. — σϊ vi eo vi o vi cn ro ro vi p co αo vi oo ro o vi _k eo co ro oo ro co oo _k co -k -k ro ro -k co 4 oo oo c_o cn e .n.. c.n_ 4..k 8c .o_ e.cD_n. cn eo eo o cD tn -vi. - o __ oo o eΛ -- o oo co vi eo -- cn ro 4k θ vi cn O 4k _k ro o oo o cn cn co co vi en co -k o

4k 4k k 4k 4 4k 4k 4k 4 4 4 4 4k 4k en 4 4k C k 4 4k 4k 4 4k k 4k 4k 4 4k 4k 4k 4k k 4k 4 4k 4k k k 4k co en p σo vi po co p p p p p oo po o p p o CO CO CO 000000 CD v| p p p pi pi pi -k to ro 4- 4k cn co k 4 4

-fk epn en σp> 01 vvii i p i) N - 4k όι - - t ik k b | v| CO c CoO ttO 0000 Q - 000(000 b) vi to 01 4k 'vi o ro ro eo vi cn vi 4k co b bo bo -k bo ro eneneocooιco4kioroencncnro4kCD-krooo c -n - ,m CO OO 00 v| o v| -k _- oococDcoeorocoen4k4kθooeoeocoσo4kθ cn cn cp o co ro co -k o . c cp o ∞ - o ώ co co 004k oι co cD vi en 4k 4k ro 4k co vi 4k θo cn vi c 2n co ro o co 00 o coo ro o o 00000000000000000000 00000000000_ ooooooooooooooooo o o 0000000000000000000000000000000 ooooooooooooooooo ro -- -k _k ro ro co 4k co 4k c 4k co co 4k 4k ι oι oι 4k 4k 4k eo eo eo eo to to co ro co ro ro ro ro ro to co eo oι 4k 4k o oo cn 4k co co co 4k o 4k to _k co oo 4 p to ω -k ω |θ ιvi -k >4k p p p p t ω vi ro --k -k oι

0 _1.00 cn to ep ro ro to ro co 4k -- ro oo -k 4k v| c 00 4k eo σ> io to ~4 cn cn eo en ro eo en co o 4k '4k bι σ> 00 k 4k cn k oo - _k oo co ro 4k o oo oo CO 4k 4k en o ro 4- oι oo en en -k CD -- vi -k cn co ιo oo oo co 2

M rO N M M M I M N NI M N M N M M M M N M rO M M I rO rO r M M M M M M M M rO r M M M M M M M N M M M rO M Oi Oi Oi i 0i 0i i Oi 0i 0i 0i i i i Oi 0i Oi Oi Oi 0i 0i 0i 0i 0i Oi 0i 0i Oi 0Λ i Oi i i 0i 0i Oi 0i i Oi Oi i i Oi i i ω i ω κ i CO CO CO CO ∞ C0- C C C Ctt tt C C v| v| v| v| vl vl v4 v| v| vl OT Cn OT O0 Cn p OT c t -kθcooovio>cn -ωM -o co∞vic c 4kC M -kθcoc vi c c 4 co ro -^ PZOPP or > o ro

> > > > > > > > TJ TJ TJ TJ

-<- >>r-7Jχ7Jχ-7Ji73χ73χ73χ O CΛ CΛ CO CO C C ω X X X X ωυ<i^ω>r->Fr->r-F 73<r^r^r^-7<3-7<3v73i-7<3^73-7c3;^73^73^73^73^73-7<3;r>-r>-r>> TJ TJ TJ T TJ TJ TJ TJ rn m m m

co co eo co eo eo co co co eo co eo co eo eo co co eo co eo eo eo eo eo eo co eo co co co to co co co co co co co co co co co eo eo co co co eo t^

__ _-. _k _-. _k -_ __ _k _ _- 0000000 0000000000000000000 00000 0000 0 000 0

-k -k _k θ o o o o o o to co co cD co eo co e e e e vi vi vi v| vi vi vi vi vi vi v| vi en cn en cΛ C3o en en en cn cjι en en en 4k 4k 4k

to CO tO CD CO CO CD CO CO CD

--roroι -o-roω 22 to to

CO 00 oo o 4k co vi cn vi c co e_o co en

M Co co cn eo co cn ω co co cp co en ro

- M 00 (0 O M M O M - 0)U en i

oι oι ρι p co to o M

-k cn

4 4k 4k 4k cn 4k Cn 4k cn 4k 4k CJi 4k cji en en c^ cn 4k en cn cn cn oi oi oi oi oi cn cji c-n ci cn ci cn cji cn c^ cji cn cji tJi en tji t-n cji 4k 4^ vi C vl OO vi -k p p p - - - - - - - - - - p o _ ro --k p p ro o -k _ o ro p p k p o - p ro o - -k -- o o co _. vi to to to 4k co b ro -k 4k CD - CO CO OO -k co en co eo en o oo en 4k vi en eo -k _k cn co 4k oι boo boo bo bo b b b b b b vi 'vi o oι vi p 4k co oι en co O -- O _k 4k 00 o o ro eo o to co o o o -- oo oo cD co cn vi cn cn -- vi co ro o v| Ol CO v| -vl CO CD cn 4k - cn oo _ co teoo 4cnk cco c i ro ^ vi oo -k CD Oi - 0) 0) vi O M co - oo -- co -' ro en cn cj) tn ro oo cn - is) - coo o en oo -k cn ro o oooooooooooooooooooooooooooooooooooooooooooooooo o o oooooooooooooooooooooooooooooooooooooooooooooooo o o vi αo oo oo oo oo cn en cn cn en cn 4k 4k en en o) cn oo oi cn cn en cn cn cn oi o cn en 4 cn en en en cn en cn 4k k vl -M v| n 4 4k eo to - -. p oi pp ω ^ p t M p oo co oo vi cn vi o -k O CD Co oo co oo to co oo to co oi oo co co co vi k ro c i cn cn o oo cn o oo 4k en co

4k bo 4 ) vi bo bo o ' S oo to o cn en -k O vi co ω σi o eo ro en o ro vi oo vi co co 4k -- 4k en ro ro oi - O ϋi Jk i o ω o -k oo vi to co vi ro 2 ω - co oo ro cjι oo en en oo co en oo co co co co co ro co o 4k O) co to -k o ro co oo eo vi oi co o 4k. co oo ro co cn co oo 4k

r -o-. r-tok r-o ro ro ro ro ro ro ro ro ro ro ro_ r4o_ ro_ io_ ro_ t4o k 4k 4-k. -4tk -4^k -4tkk -4-k. j--, _ _ 4_ 4_ _ 4 _ r tjoo-. ro M ro ro M M to M ro ro ro ro to ro ro io ro ro ro ro ro to ro ro io to to to to ro 4k 4k 4 .k to co co eo eo co 4k k 4k 4k 4k 4 4 4k 4 4 4k 4 4 4k 4k 4k 4 4k 4k 4k 4k 4.k 4.k C_O co co co co eo co eo eo eo ro ro ro ro ro ro ro t ro ro -k -k _k _k _k -_ _i. _k _k _k o o 0 o co ro 00o o0 (c0o (010 (010 " o co oo vi Oi en 4- co to o co op o oo vi oo υi 4- eo Bo ooooooo o co oo vi σ> cn 4k co ro o co oo -vi cn cn ? co ro -k O co oo vi cn en 2

OPOOPPPPPPPZOOOO O O O O O O O O O O O O O P P OPOOPPPP o o z o p o χNmomooro> ro> o o ro > ro ro -* -- IS m σ o ro > o m m o o ro > ro -k N rn o o to -

OOOOOOOnorrrrrrrroooOΩOOOOrrrrrr rrrrrrrrrMppp55mrrrrrrrrr^^^

73737373737373737373737373 ccccccccccccccccccccccccccco nωcoωco

ω ω ω ω ω ω ω ω ω ω co ω ω ω ω ω ω ω ω ω ω ω ω u ω ωω ω ω ω ω u ω ω ω ω ω ω ω ω co ω ω ω ω co ω co co co M θ) ffi cn o) θ)θ θ) θi θ) ffl uθ θθ ϋo t tn c oi k Jk 4 k k k k ω ω ω ω co ω c t r M r^ co CO CD CO CO CO CO CO CO CO CD CD CD CO tO CO CD CO tO tO OO OO CO OO * vi vi p p p vi vi vi oi cn en ω ro ro vi vi co co _k to '4 to ro eo o v| -- vi n ω b to ro _k to c bo ro vi -k bo cn eo oo to cn c3o co oo eo oi *> co ro o oo co oo 4k oo co _k vi co cn o o vi cn co -- θ vi eo o 4k cn 4k θ co en -k θ co to co eπ cn

ooooooooσooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo

C0 ro Cθ 4k 4k Cn θl 4k Cn 4k 4k CO CO 4k CO 4k C0 C04k eo 4k e e oι 4k 4k 4 eo 4k ro ro co co 4k 4k 4k en vi vi cn cn en en cn co CD v| v| v| vl ^- p -k p vl p vl f vi p vl -k vl vl - po co pi σ> -* n -- co ffl CO M UI p en eo O -k CO C00 (O v| O 4k Oi 00 Ol v| 4

4k to ω ω cp n b co vi vi cn 4k vi . b _ι b _ b _ e'n vi b ^- ω ω ^ b ω - - - 4k -_ όι ro r 4k fo co 4k to vi 4k - bo -o σo o co -k oo co co oi o cn o vi ro -_■ to co oo vi *> en cn en en en e ro vi -- cn 4k 4k io o o co eo co oι vi oι co 2 vi o oi cn oi

2444 CA THR 317 96.731 48.752 39.839 1.00 33.58

2445 CB THR 317 95.811 47.831 40.671 1.00 29.35

2446 OG1 THR 317 96.347 47.676 41.990 1.00 30.19

2447 CG2 THR 317 95.691 46.460 40.020 1.00 28.64

2448 C THR 317 96.125 48.922 38.448 1.00 38.84

2449 0 THR 317 96.624 48.363 37.470 1.00 37.70

2450 N ASP 318 95.070 49.731 38.369 1.00 39.63

2451 CA ASP 318 94.385 49.987 37.110 1.00 43.25

2452 CB ASP 318 93.115 50.806 37.351 1.00 53.81

2453 CG ASP 318 92.282 50.972 36.094 1.00 64.26

2454 OD1 ASP 318 91.830 49.947 35.538 1.00 68.93

2455 OD2 ASP 318 92.088 52.126 35.656 1.00 69.91

2456 C ASP 318 95.292 50.706 36.118 1.00 38.89

2457 0 ASP 318 95.280 50.406 34.922 1.00 35.65

2458 N ALA 319 96.081 51.651 36.622 1.00 39.85

2459 CA ALA 319 97.001 52.409 35.783 1.00 39.48

2460 CB ALA 319 97.716 53.462 36.610 1.00 45.21

2461 C ALA 319 98.007 51.469 35.123 1.00 36.47

2462 0 ALA 319 98.261 51.564 33.920 1.00 28.06

2463 N ILE 320 98.547 50.541 35.912 1.00 36.88

2464 CA ILE 320 99.514 49.560 35.422 1.00 35.98

2465 CB ILE 320 99.994 48.620 36.561 1.00 43.40

2466 CG2 ILE 320 100.784 47.443 35.991 1.00 44.99

2467 CG1 ILE 320 100.834 49.397 37.582 1.00 45.58

2468 CD1 ILE 320 102.173 49.891 37.054 1.00 39.26

2469 C ILE 320 98.911 48.712 34.307 1.00 31.85

2470 0 ILE 320 99.544 48.506 33.271 1.00 32.45

2471 N GLN 321 97.680 48.245 34.518 1.00 27.13

2472 CA GLN 321 96.980 47.414 33.538 1.00 29.80

2473 CB GLN 321 95.592 47.021 34.053 1.00 37.41

2474 CG GLN 321 95.581 46.336 35.422 1.00 37.33

2475 CD GLN 321 96.510 45.136 35.508 1.00 42.33

2476 OE1 GLN 321 96.690 44.398 34.536 1.00 43.16

2477 NE2 GLN 321 97.108 44.938 36.679 1.00 35.06

2478 C GLN 321 96.856 48.101 32.180 1.00 30.46

2479 0 GLN 321 97.066 47.474 31.139 1.00 25.13

2480 N ARG 322 96.519 49.390 32.199 1.00 36.61

2481 CA ARG 322 96.384 50.171 30.971 1.00 40.97

2482 CB ARG 322 95.779 51.549 31.264 1.00 48.13

2483 CG ARG 322 94.261 51.612 31.176 1.00 58.29

2484 CD ARG 322 93.581 50.836 32.290 1.00 66.64

2485 NE ARG 322 92.125 50.822 32.134 1.00 76.38

2486 CZ ARG 322 91.326 51.868 32.344 1.00 74.78

2487 NH1 ARG 322 91.827 53.035 32.727 1.00 73.98

2488 NH2 ARG 322 90.019 51.751 32.157 1.00 73.84

2489 C ARG 322 97.737 50.347 30.290 1.00 39.65

2490 0 ARG 322 97.848 50.233 29.067 1.00 46.16

2491 N TRP 323 98.757 50.635 31.094 1.00 37.39

2492 CA TRP 323 100.118 50.828 30.607 1.00 35.58

2493 CB TRP 323 100.663 49.535 29.990 1.00 36.83

NM M rO rO I rONr N r rOM M M M N M NM M rO M rO N N M encn i-ncn cΛcnoioioipoioioioi oi υi oi oi oioioi oioioi oioi oi oi υi oi oi cn cn cn cn cΛ cncn c-n c^ 4 4k 4 4-c cocotoeoζjc c eoc MMMt r MM roro _k -k _k _k _ _k _k -_ _ _k θ o o o o - O — O - O - O - C O- C -O CO CO CO CD co ro - O CD 00 v| Pcjι 4 Co ro _ θ cD oo vi cDCJi 4 co ro _kθ<o cx) i c cΛ 4k co M -k co cD i σo oι 2 eo ro -k θ co oo vi coo en 4k

P P P P P OOOOPPPPZOO Z O P P P z O P P P P P P O P O O P P P o o ro > Z O P P P P Z P O P P P m o o ro > α σ o ro > σ o oro > O O O CD > X N N β m o m m o o -- _k ro -k _ ro ro -- ro eo ro -k - co ro ro

FOOOOOOΩΩO J> > > . . = FFFFFF>>>>> >>>-l-.H-IH-I-.-l-l-l-l m m m m m m r- f- r-r-r- r- C CO GO oo G MO cWoω GO G-2Om πιιηmmmπιMMMCocouiωω50?-i. ) JΛΛΛΛΛS cczccccccczz z- z z z z z z TJ TJ TJ TJTJ TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ

eo co co eo co eo co eo eo eo eo co eo co eo co co co eo eo eo eo eo eo eo eo co eo eo eo eo co co eo co eo eo eo eo co eo eo co co co co co co co co

MM MM rO MM M rON M MM MMM MM M O tOMM MM MM MMM M M MM r MM MM .. M ι Mιu tO ls) I Is) M ls) r rO M e c oo cβ oo e> vi v| vi vi vi vi v| vi vi c e en c_ c-o eΛ e eΛ eΛ eΛ eΛ e en c en e k 4k 4 4 4k 4k 4k co co co co co co co co co co co _k _k o o ω N) b -k - oo

vi co coo cD OT cn eΛ CΛ en enen en enen cn cn encn oι oi cn enen en en en cn cn en en cji cn e cΛen cn cjι en cjι cΛ C_n cn c^ o o -kO co coo vi ccnoioioioi vi vito co co _k Oco coc_to cco co co c_ vi cnen en cn cncn 4k 4k W

4ko r e)3M v| vi op | vi co e)aeDθ e k M-k e kω e ecnn --kk θoiro een 44kk eenn eenn __- vvii coni cejnι eeo __-k v-vii o co ωco to vien vi cn o o N>r4-_ _. ^< f ^-θ-P?w^N ω0? - Cnw kc _n. . ooorroe cnvioo — coQ -k vi4-ro ro 4- oocn cnoo vi viroeno _k enoo 4k

4k co en M UOioωoo -r ω O O v .|2 k CO en v| CD Ol o co oι eocn *.4k -- co o 4k vi cncn vi co σo 4k ro co o 4k cn co oo vi co eo e eo eo eo co c eoeo eo co eo co eoeo eo roro rotoeo Meo eo eo co M ro eo M eo eo ro M M ro M co M ro to co co co ro enen44-cn4-ui 4-pro _k _k pp -k _ -kppvippp -kppppppp -k p vivipopo to ioto — c p po to p -k CO

4 cob vi j _ n _ i ω to ro -ktoe)o ω e - o bto v| viM rθ bι _o _n ro b 4k bo _ 4k ro to eo bι b to oc3 c3) M p co o oo{De cDe -k C vi vi - e eΛcD vi _ M covieπ k C(o roco en M vi 'e- e" 4j-k ccnn ωeooioio oooi i-xo cn vi COC CO C0 - C0010 — en -k co cne504k eno o oc -k eji - eoo eo oo tooo en eo o oi ro encn vi c coo oooo vvii oooo --kk iioo rroo ccn ro o 4k co co oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo vi cn p cn enen cn cn vi vvii co 4k to co co co co eo 4k co co co 4k

- r pp s tk iϋfόω isj pΦ co ops 4k θ co o cn co oo _k ik α iω M u i- 4k-.eo

vi b bo ώ b bo eo ro ro ro co 4k v|C001OO4k — vi _kcoc cooooceoooooooenortooccooooencnencocncovieoo4-oooorroocennccDoccoo44kkθθooeeoo ccnn vvii -k ooo rocnovioi vico vi vi

r r N) M N N) N N M r M r M N N) M M M N M M rs) M M rO M r N M cn oi oi oi oi oi oi cn en cji CΛ cnen en cji cn cn en en cn c-n cji cji en e cn en en en en cn cΛ tn en tΛ en oi oi cji c^ co cD eo co c eβ e)o m α> p oo oo oo oo v| vi vi v| v| vi v| vi v| vi cn σ) en cΛ en cn en cn cn OT co ro — o co oo vi oo cn 4- co ro _k o co c vi _o c 4 c M -- o eo c vi c cΛ 4- c ιo -k θ co c vi cn c 4k Co M _k θ co oo vi σ> cjι 4-

PP P P P O P O O P PP z o P P P P P O P P P P P P O P P Z P P P P o P o O P P P mo o ro > o o O ro > o ro > o α o o ro > x x N m σ o ro > z o P o o o co > to -k ro _ ro -

^ ^ <(ΛUiυi nθiCΛ(/iUi737)7373737J73f}2 l π } UiUiUl73737373737^

Λ Λ Λ Λ Λ TJ TJ J T T T TJ OO O O O O O C- C C C O O Q P O P Q Q — TJTJTJTJTJTJTJ rn m

eo eo co eo eo co eo eo co co co co eo co co eo eo co co eo eo eo eo eo eo eo eo co co co eo eo co co eo co eo co eo eo co eo co co co eo co co co co co co e i^ co co co eo eo eo eo co eo eo co co co co co eo eo co ω co co co eo eo co eo co to eo co co eo co co co co M 4k 4- 4k 4k 4k 4- co eo co co co eo ω eo ro ro ro ro ro ro ro --k _k -- -k -k _k _k _k O O O O O O O O O O O CO CO CD CD CD CO CO CO OO OO

_, -k _ -k _ _ — _ — — _ — — _ — — (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 O CO CD CO (0 (0 (0 (010 (0 (0 (0 (0 (0 o o o o p o p o o o o o o g ρ o oo oo oo vi oo oo oo v| tD θo oo vi 82 CO CO CO CO t

OI O O O - N U U 2 (0 Ol Ol p vl vl vl p p vl p p

P ^ fd r r ^ r r' ri rl N P P P ik b j b i M * i j ω ω vi 4k ^ - ro to vi vi en co oo - - - -- o -* vi M vi co o cn oo - en en en c 4k eo c)o oo -k eo M co cβ 4k ejι o eo cDθ cn co 4k Co -- co eo vi to σo

(Ol oi ω Φ ω - i Oioωooi ω - MΦCO -cn N -co o o M t -ΦCO Φ t c Φ cn o M oi vi ro o oι co cD θo o o vi ro -_ vi vi 4k 2 — en _ en i

M O - U S

oi cn cn cn cn cn oo oo oo σo oo o cn cn en cn cn cn cn cn en cn cn cΛ CJi oi oi eπ σi σo σo cn cn cn oo cn cn cD oo eo oo p o -- -k -- p p pι 2 c ro ro o -- co o -- co co -- o oι i p vi v| vi p ρ p ρ ro - co 4k co ro ro -- p o to -k co to ro oo eo e eo ro oo ϋi co ro o en o co co o vi 8 t 8 en oi en cΛ Oi oi oi oi oi p p p p p v oo b r - ω ^ b b b b b M ω ω b - ϋi b b - b ω )

4k eo cn o e p v| v| 4- ep o vi o Qo ep cp vi vi vi oo 4k 4 M c co oo — 4_ eo cn cn eo _k 4k p ro oo to oo 4k to

C -O- CO- 0-0 O- n vi- K cn C-- r O 2 e -o - o —o e 'o* O) O O) O O) k o oo o o ro co 8 ω - o _o o_ (θ eo M 2 en eι v| vi ro ejι eΛ 4k 4- ro co ro oι en cn cn ro -k θ *: o vi oo ro eo oo k k 4k 4k 4k 4k 4k 4 4 _4k „4 _4k _4k _k _4 _4k 4k k 4k 4k k 4 C C C C C 4k CO co eo co co

vi oo oo p 4- 4k ro ω co ro co ιo eo ro ro 4- 4- eo eo ro o -k Cθ oo oo co o cD o co ro 4k eo 4 en cn vi co vi oo vi ro 4 k cn oo cn vi en b 4 b e ro ro -k ι 4k vi 4 3 - ω c_ c c ro ro e 4k c_> co eo vi ro -- en co eo cn co o o _k ro co 4k ' 4k oρ ocoo c coo oo co oo cJi o -^ co p po co c oo -M o 4- o cn co Qi cn o eo cn eo oo o co co ro co ro co -k oo en — vi oo ro c cn oo cn co 4- o o co 2J- en o oo o co to oo o eo oo en co 2 ro . c en _k to _k c —n co eo to oi co cD o oo co 4k 2 io co en o to o o o ooooooσooooooooooooooooooooooooooooooooooooooo o o o ooooooooooooooooooooooooooσooooooooooooooooooo vi vi -vi oo oo oo po oo v| v| v| v| v| vl cn en cn n cn cn cn o | v| vl v| v| v| vl v| v| vJ OO Cn

4 'k 4" -k vl 4_ Ol 4k CO o cn ω oi M O cn co 2 c i vi cn vi vi oo σo cn cn O CD CO OO v| v| v p p 4k ρ — o o co co 4k en en ω ω ρ -k p 4k jo bo p _k cn bi 4k bo co b co bι bo b to ω - ω - ω - M 4k b | - - ι M b ω ^ ω ω vi _ k 4- 4k cn co en ω cn ro o o 8 oo eo cn w oo σ) vi c ejι θ) e!o e e -k e o o θ 4- 4 -k co cD Co vi 4k c ro cn co 4 4k θi co vi

ro ro ro ro to io ro ro ro w w ro fo ro ro io ro M M io io io io io ro ro ro fo ro M M

2 cn coo co cn cn cn cn (-n o coo cn cn cn cn cΛ ( ) C-o σ) σ) σ) σ) cπ σ) cn cn coo cn coo cn c7) c^ { l i e_o ωeo ωeo ωeo ωeo ω ω u u ω N M i M M r M M M i - - - - - - - - - - o o o o o p o o co e -o - -ro - o - e -o- o -o- vi o —o c -n r ^ o eo e vi e eΛ 4k e M -k θ co e vi e oi 4 co ro _k θ cD oo vi cn e 4- e"o " ro o - CO- 0-0 v| o -o cn 2

OOOOPPOOOOOZOOOOO o o o OO o o OOZOOOOO o o o o p p ιNm roσ rom - -o - -oro> oro> o _- o_.oro ro > N rn o o ro > m σ o ro > o P

CO 7 7373737373737373737373737373737373 ' ' ' ' ' ' ' ' ' ' ' ' ' CO CO CO CO CO Ui M ^ ^ '] \^ ^ ] lj 737) 73737373

co eo eo co eo co eo eo eo eo eo eo eo eo co eo eo eo eo co co eo eo eo eo co eo eo eo co co eo eo eo eo eo eo eo eo eo eo

4- ω co co co co co co co eo eo eo co co eo co eo co co eo eo eo eo co co co co eo eo co eo co eo eo eo co eo eo eo co co o co cD co co (D co co co co eo eo co e e c co co oo vi v| vi v| vi vi vi vi en en en en en coo cn ro en cji en oi en cn

(0 (O -i - - - - - - _ _ - - - --. -_ _. _. _ --_ --. o o o o o oooooopoooooo ooooooooop co co o o o o o o o co co o o o o o o o o o o cn cn cn o o -tr o--roco4-cnv]cocnccn oo vi vi vi to vi vi cn cn - -- — u u ω ω ω ^ y -i i i ik p J i ω cp oi 4k -k c cn ro cD O co ro oo ro ro 4k co _k co vi cn oo cooocoeoooocn-koooorotooio eo o to b vi co to eo vi to -k -k co ro σo tn 4k co -k θ 4k -k vi ro co cn c3 ro eo — en eo ro ro en O CO U O O M ω OO - O O IO r -O- p--- e-o C _O C^Λ. oo coo vi vi 4k cn co oo 4k oo co ro 4k _ -_ k θ oι oι o 4k tθ vi 4- ro co 4k θi co o oo cn o o oό o co en co oo vi o ocoo 44kk 44-- ro ro 4- ro (o o r ω - ω oKO O ro en en en cn en oi oi oi oi oi oi en -e.n en en en en en en en en en en en cn 4k en co co 2 pi to ω I o—, ecDn econ roro. vi1 reo.. rcnti rcnti rcnr, -v.i1 rcro, mco mco rori. renr, roro, e --n1 bi bi eo fo vi to cn -k vi eo 4k θ oo v| co oι co oo 4k cn 4k θ co co cn oι eo o o co p vi co 4k θ oι oo -- ro ro p o ro oι o vi oo — oo co vi co -- ro eo oo 4- en o k co "

co en eo oo vi 4- ro oι en c _n 0.1 r .o r .o . o _ co eo co eo co 4k 4k k 4k 4k ui p ω δ CO CO vl v| vl cn cn ro o c -vl O 00 o v| 00 00 00 4 4k — O O 2 -_ 4k n _ _ 01

N rO W M N N tO M I N rO N M rO M rO rO M M M I M rO M cno)cncncnc c OTc <- c a)c cno)c c)OT(_ncDC)05C)coococ- OT (o cD co co oo eβ c e e)o c c cβ oo co v| v| vi vi v| vi v| v| vi vi cn cn oo coo <3) p en OT u r - 0 (O oo M C c t i ^ O (o a M CJ) c k CO N) - o (o oo M O) c 4k U - 0 (o a) M C5 oi t

P P P P z p pp p p p o o o o o o o o o ro > o r > O O O OO O O o o ro > O P P P P P P O P P P OPZPOOPP O O O D > CD > to o -- oo r > N ro -k o ro σ _- oo m a o ro >

-* -- ro

r- r- |- r- r- > > > > > > > r- r- i- i— r- |— r- |-

33333_-- d> > > > > > ____^^ CΛCocoωcocococo

2 cn2 eo eo e eo co e eo eo eo eo eo co eo co eo eo co co eo co co co co co co to c co cn2coo2cn2cn2oi2o2222222222 X K 4k 4 4- 4- 4- 4- 4- 4^ 4- 4k 4- 4- 4- 4k 4k 4k 4- 4k 4- 4 4k 4k 4k 4 4k 4k 4k i oi oi oi oi oi oi J- Jk ik Jk 4k 4k to eo eo co co eo co co ro ro ro ro ro ro to ro -k -k -k -k O - O - O - O - O - O - O O

4k 4k 4k 4k cn cn oι oo vi p p o p p

-k ∞ bo eo eo b i -k O vi vi — eoo oo o ro oo ro -- oo cn

eo co ro ro eo co l - p o p c coo ob ttoo vvi| b ucni oo eo co co 4- _k oo eo eo

OOOOOOOOOOOOOOOOO ooooooooooooooooooooooooooooooooo OOOOOOOOOOOOOOOOO ooooooooooooooooooooooooooooooooo to c eoo eeoo eeoo eeoo 4k 4k 4k 4k 4k 4k 4k 4k cn c cn oo p e en 4k 4k 4k 4k 4k 4k 4k eo eo c ro - - - r io ω ω ω to ω ω co vi en σo en 4. o oo ro c e* vi ro ro p 4k p p vi p p p p 4k vi -k p p __ p co p — vi co ro p ro ρ p p _- co 4 θi oι coo cn 4k 4- ro co co 4 oo co

M rs) b 'jk - ω - r b ω - b b - * ω - b b b i M M A *. b M _ 4k vl 4k b v|

U C - - M (O U ω r σ) U 090 (θ k O) σ) Q O) n θ) - N) _ M O M - O S 003 a) - CO (O _ r M u1 U _ 4k k v| — oo

MioioMio roioMMMioMMioroioroMrotororotoroiorotoMioM to ro ro ro v| v| v| vl v| vl vi v| v| v| v| v| v| v| vl v| vl vl vi vl v| v| vl v| vJ v| vl vl vl vl vl v| v| v| vl vl v| v| v| vi vl vi v| v| O0 cn cn oo oo oo

4k4k4k 4keoeoeoeoeoeoeoeoeoeoroMMtOMtoMiOMro-k-k_k_--. ___k_-,_koooooooooo{oco C _D o co to coro-kθeooovicne 4-e ι -kθ(Devie c 4 eoi -kθcoevic- c 4kcoM- θcDcvicncjι 4keoM o co oo vvii oo en 4

P P P P Z OPOOPPPPZOOOPPPPPPPP O O O O O P P OOZPPPPP O P o o o o o o o ro > G mooro> χNmorπooro> o o o α > N to IO -k m σ o ro ro _ i N m to o ro m --

co co co ω co ppppppppp^ :^^:^:^>&&^^

C C C C C C C X Λ Λ Λ Λ Λ Λ S Λ Λ Λ 50 X T) TI T] η T] τi tΛ W Cfl M (Λ tΛ{n W (n 3) 3D j) θ] TJ 3) i

Oi

oo

-_ __ _- _- _k _k _- 000 _- _k _k _k O O O O _k -k -_ _k o o o o o cnσoooen4k4k4kcooocoo -_ p 4 4k 4k p p 4k eo 4k 4k oo en oi cn en en ω p ro vi vi p p p -k p o co co co co oo r co o o3 i k -> r - M cn Vi o 4k co bi to (-D cn co 4 ^k_ — oo vl en eo to i O) to bi ro vi _-.4k to eo vi ro to o co ro -k 4k oi oo 4 - oι K θ) co o tn - θ ω oi - O r oo oi enenooto-kv o6ooδcD4k" co vi ro o en ro vi oi -k to oi co o ,o cn to cp co o co vi cn co -- eo _ ro eo 4- co 4k co _ θo o o 4k cn oooo-kooeoeocncncoeo 2 Ol O vi 4k -k θθ co _k co co vi oo cn cn oo to co en

Cn e CJi en 4k 4k en 4k 4k 4 4k 4 4k k ω is) -- O (00000 O 00(000000000 M ro co cD oi oo ro oo -- 4k o ro co -k io _ op ro vi eo p 2p2-k p co p vi ro co cό co oo oo _ to o co co

M M N MM M M M M M M M M M MM U U ω U ω U MM M M M M U M to U U U ω

-' Co c eo eo ro eo ω 4k 4k 4k p 4k ω ro -k p ro p _vi vi vi p ∞ v| o oo t.o co eo co oo oo eo cn eo ro oo tL - _ _ i.4k - vi _ * -. _ _. ω- vi.

4kCDoσovico - eo en r roo ooc coroco4kθooo4 en4k ecoovicooo .ro.4.kc —X)Q _ roroeΛenp ._ vi. k o o en o4kθcDro4- -k -k cn to co envieDCD4keoo<3ococΛeoco4kroenencovieooi4-encn4kθoco_σ ocn co<-oo4krooo oooooooooooooooooooooooooooooooooσoooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo vi vi oo cn cn 4 4k P vi _ co oo eo en oo 4 to vi k — b oo "φ M i M t 4 co 4 tD _k

en eo eo to t o en o en o en o

N M M rO rO M M N N M M M N M M M N N r M M M M V| M VI M M M M M M M S M M M M M S M M M M M M M M V| M M M M M M S V| V| M M M M M M M S M M M co co co (D θo c c e oo φ p oo eβ Qθ vi v| v| v| vi vi vi vi v| vi oo cn cn c-θ cn cn cn c- cπ c o -k θ co e vi eΛ eΛ - ω M -k θ co oo vi c eΛ 4k e ι -k θ (θ θo vi c3o oι 4- co M -k θ cD C

Z P Z P P P P O O P z x m σ o ro > O O P P O O Oo P > O P O P P O P P P P OPOOPPOP O O z o N J> CD > o O r P P pro > O O O CD > IO _ m m σ o ro > N m to -k

> > ≥> > > > ≥G)Ω G)Q coωcoωcocoGocococococo 7373737373737373 r~ t~ r- r~ m m m m m rn m rn m m m m rn rn m rn m m rn o . o . ooooooo oooooooo-<-<-<-< 737373737373737373737373 :C CZ : (Z C(Z CC : c c c c c c c CO CO CO CO

cocoeoeo eo eoeo eo eo eo eoeoeoco eo eo co eoeo co eo eo eoeo eoeo co eo co eo eo eo co co eo eo co co co co co co co co co co to CO CO to encncn ϋi ϋi oicncn cn en cncnc c cncn cn cnencn cn cncnencncn cn cn cn en eji en oi oi oi oi oi oi oi oi oi oi oi oi o^ en en en en en θ5(X) CD θo oo oooooo vi vi v| vipcn PcΛ P cjι en cn cjι oιoι 4- 4- 4k 4- 4- 4k co co eo ω

_ _ _ _k _k _k --.

M

CO Co 4k 4k 4 4k 4k 4k cooo p p p vl vl 4k 4 4 4k k 4k 4k 4 4k 4k 4k 4k 4k k 4k k 4k en en p ω ω _4k 4k p vi _vi p ρ p vi o 4- vivi ωco c - - b

k bM- f - bω- MMtn w

CD IO co 4 viro o o c e _n. b- o ro en ω ρ co 4k co 4k p ro o to 4k cn co oo vl 4k C3 cnroMro ^ woo r ϋi *M oωcocΛθ) r o

-iό ϋi - ω δ θ) vl cn ro -vi oi o oi vi 2 oo en oo oo ro ro ro ro ιo ro ro ro ro ro ιo ro -- ro pto ω pp oo oo υi 4k 4k to eo to o ω itk r ω b 4k ω rθMuι b r c vi vi ooooro co o oo co co cn en

OOOOOOOOOO ooooooooooooooooooooo _ o o o o o o o o o o o o o o o o o o o oooooooooooooooooooooo oo oo o o o o o o o o o o o o o o o o o o o o o o o o

CO CO 4 4k 4k 4k cn en en cjι coo en vi o o cn cn vi cn eoo cn cn en cn en vi p cn cn 4k 4k c COo eCOo CO CO 4k 4k 4k 4k cn oι oι oι oι en en en en cD cx> vi eo 4k vi vi oi ro 4- O CO M p p i |O vl _k Co p 4- p 4- ro - o_ c_n.4.k 4.k. _o_ι. p_ e_o _v-i co oo o to cn en vi eo eo

CO 4k 4k — vl t s ω M i ^ r ^ vi b b b b r m b m - r b b b tt o _k to OO 4k vl O) o oo ro ro oo cn -_ 4^ -k to _k eo co c 4k en vi o o en ro co cjι cn (-n 4- vi co M CΛ cn (-o eo co _k θ co en vi 4k en o o cn o en v} CO 00

2794 NH2 AARRCG 358 116.684 37.905 24.583 1.00 43.78

2795 C A ARR(G 358 1 13.817 42.522 21.282 1.00 55.62

2796 0 A ARRCG 358 1 13.676 42.268 22.479 1.00 60.74

2797 N S SEEFR 359 113.286 43.596 20.699 1.00 54.17

2798 CA S SEEFR 359 112.440 44.548 21.419 1.00 49.75

2799 CB S SEEFR 359 112.373 45.887 20.671 1.00 46.10

2800 OG S SEEFR 359 113.659 46.424 20.441 1.00 39.24

2801 C S SEEFR 359 1 11.030 43.979 21.584 1.00 51.35

2802 0 S SEEFR 359 110.321 44.294 22.549 1.00 51.03

2803 N H HIISS 360 110.642 43.145 20.619 1.00 48.18

2804 CA H HIISS 360 109.339 42.484 20.566 1.00 49.55

2805 CB H HIISS 360 109.165 41.769 19.214 1.00 55.45

2806 CG H HIISS 360 110.191 40.706 18.955 1.00 57.94

2807 CD2 H HIISS 360 111.485 40.791 18.565 1.00 58.70

2808 ND1 H HIISS 360 109.933 39.363 19.134 1.00 62.62

2809 CE1 H HIISS 360 111.028 38.668 18.875 1.00 63.83

2810 NE2 H HIISS 360 111.985 39.511 18.527 1.00 63.77

2811 C H HIISS 360 109.105 41.483 21.705 1.00 51.67

2812 0 H HIISS 360 108.023 40.886 21.795 1.00 56.00

2813 N I ILLEE 361 110.115 41.294 22.552 1.00 44.35

2814 CA I ILLEE 361 110.005 40.352 23.659 1.00 40.02

2815 CB I ILLEE 361 111.217 39.396 23.719 1.00 40.34

2816 CG2 ILE 361 111.350 38.631 22.412 1.00 38.81

2817 CG1 ILE 361 112.490 40.174 24.052 1.00 45.99

2818 CD1 I ILLEE 361 113.742 39.324 24.096 1.00 38.31

2819 C I ILLEE 361 109.837 41.012 25.022 1.00 38.58

2820 0 I ILLEE 361 109.629 40.323 26.018 1.00 46.53

2821 N V VAALL 362 109.920 42.339 25.068 1.00 34.37

2822 CA V VAALL 362 109.784 43.073 26.323 1.00 36.05

2823 CB V VAALL 362 110.133 44.567 26.131 1.00 44.38

2824 CG1 V VAALL 362 110.157 45.290 27.474 1.00 28.09

2825 CG2 VAL 362 111.470 44.705 25.420 1.00 50.90

2826 C VAL 362 108.372 42.959 26.899 1.00 35.07

2827 0 V VAALL 362 108.187 43.012 28.113 1.00 27.77

2828 N C CYYSS 363 107.383 42.770 26.025 1.00 37.13

2829 CA C CYYSS 363 105.980 42.653 26.437 1.00 34.16

2830 CB C CYYSS 363 105.066 42.483 25.215 1.00 29.73

2831 SG C CYYSS 363 105.447 41.051 24.179 1.00 41.96

2832 C C CYYSS 363 105.730 41.520 27.434 1.00 32.61

2833 0 C CYYSS 363 104.887 41.646 28.325 1.00 25.38

2834 N H HIISS 364 106.481 40.429 27.292 1.00 28.31

2835 CA H HIISS 364 106.356 39.267 28.168 1.00 20.38

2836 CB H HIISS 364 107.304 38.159 27.713 1.00 19.91

2837 CG H HIISS 364 107.064 37.696 26.309 1.00 25.64

2838 CD2 H HIISS 364 107.777 37.887 25.173 1.00 29.90

2839 ND1 H HIISS 364 105.976 36.929 25.954 1.00 34.65

2840 CE1 H HIISS 364 106.028 36.667 24.659 1.00 33.79

2841 NE2 H HIISS 364 107.111 37.237 24.162 1.00 27.05

2842 C H HIISS 364 106.646 39.635 29.622 1.00 28.17

2843 0 H HIISS 364 105.942 39.200 30.537 1.00 27.54 2844 N ALA 365 107.685 40.440 29.826 1.00 30.22

2845 CA ALA 365 108.067 40.880 31.163 1.00 30.86

2846 CB ALA 365 109.427 41.574 31.120 1.00 34.60

2847 C ALA 365 107.007 41.822 31.725 1.00 31.03

2848 0 ALA 365 106.752 41.838 32.931 1.00 31.19

2849 N ILE 366 106.389 42.596 30.835 1.00 36.30

2850 CA ILE 366 105.347 43.550 31.208 1.00 36.55

2851 CB ILE 366 105.016 44.504 30.034 1.00 41.23

2852 CG2 ILE 366 103.857 45.419 30.403 1.00 40.62

2853 CG1 ILE 366 106.253 45.331 29.668 1.00 35.62

2854 CD1 ILE 366 106.065 46.231 28.468 1.00 29.32

2855 C ILE 366 104.070 42.845 31.667 1.00 30.85

2856 0 ILE 366 103.524 43.173 32.722 1.00 28.50

2857 N GLU 367 103.613 41.867 30.886 1.00 25.21

2858 CA GLU 367 102.404 41.117 31.223 1.00 22.77

2859 CB GLU 367 102.095 40.069 30.153 1.00 32.06

2860 CG GLU 367 101.926 40.626 28.736 1.00 41.69

2861 CD GLU 367 100.870 41.721 28.629 1.00 48.62

2862 OE1 GLU 367 99.829 41.633 29.321 1.00 48.68

2863 OE2 GLU 367 101.083 42.670 27.841 1.00 43.16

2864 C GLU 367 102.539 40.448 32.585 1.00 20.02

2865 0 GLU 367 101.555 40.297 33.314 1.00 20.91

2866 N ARG 368 103.766 40.057 32.923 1.00 21.53

2867 CA ARG 368 104.055 39.422 34.205 1.00 14.50

2868 CB ARG 368 105.406 38.709 34.159 1.00 17.59

2869 CG ARG 368 105.427 37.442 33.319 1.00 13.40

2870 CD ARG 368 104.602 36.338 33.960 1.00 17.58

2871 NE ARG 368 104.843 35.044 33.325 1.00 25.37

2872 CZ ARG 368 104.380 33.884 33.784 1.00 29.88

2873 NH1 ARG 368 103.641 33.847 34.887 1.00 15.72

2874 NH2 ARG 368 104.669 32.757 33.146 1.00 25.60

2875 C ARG 368 104.058 40.473 35.306 1.00 22.28

2876 0 ARG 368 103.674 40.193 36.444 1.00 25.28

2877 N MET 369 104.489 41.686 34.965 1.00 23.23

2878 CA MET 369 104.513 42.774 35.933 1.00 22.69

2879 CB MET 369 105.234 44.001 35.371 1.00 21.94

2880 CG MET 369 105.216 45.178 36.332 1.00 33.04

2881 SD MET 369 106.226 46.580 35.855 1.00 30.05

2882 CE MET 369 106.788 47.105 37.492 1.00 22.46

2883 C MET 369 103.088 43.138 36.329 1.00 21.30

2884 0 MET 369 102.794 43.316 37.513 1.00 25.30

2885 N LYS 370 102.207 43.230 35.332 1.00 22.42

2886 CA LYS 370 100.798 43.555 35.562 1.00 21.17

2887 CB LYS 370 100.033 43.596 34.237 1.00 18.37

2888 CG LYS 370 100.498 44.679 33.272 1.00 19.38

2889 CD LYS 370 99.724 44.628 31.959 1.00 22.90

2890 CE LYS 370 100.144 45.754 31.026 1.00 25.30

2891 NZ LYS 370 99.370 45.760 29.753 1.00 26.14

2892 C LYS 370 100.184 42.503 36.480 1.00 22.60

2893 0 LYS 370 99.433 42.830 37.404 1.00 22.82 2894 N GLU 371 100.540 41.243 36.233 1.00 20.87

2895 CA GLU 371 100.060 40.117 37.027 1.00 17.91

2896 CB GLU 371 100.633 38.805 36.473 1.00 17.04

2897 CG GLU 371 100.291 37.558 37.281 1.00 14.89

2898 CD GLU 371 100.951 36.307 36.737 1.00 33.96

2899 OE1 GLU 371 100.246 35.281 36.624 1.00 49.48

2900 OE2 GLU 371 102.162 36.342 36.433 1.00 39.35

2901 C GLU 371 100.459 40.291 38.491 1.00 14.70

2902 0 GLU 371 99.629 40.146 39.389 1.00 15.00

2903 N VAL 372 101.727 40.624 38.718 1.00 16.52

2904 CA VAL 372 102.246 40.830 40.066 1.00 17.45

2905 CB VAL 372 103.747 41.232 40.043 1.00 17.58

2906 CG1 VAL 372 104.258 41.453 41.450 1.00 3.56

2907 CG2 VAL 372 104.575 40.156 39.365 1.00 18.80

2908 C VAL 372 101.455 41.919 40.782 1.00 21.27

2909 0 VAL 372 101.101 41.767 41.952 1.00 23.46

2910 N VAL 373 101.155 43.000 40.063 1.00 26.12

2911 CA VAL 373 100.407 44.123 40.629 1.00 29.37

2912 CB VAL 373 100.425 45.356 39.694 1.00 33.84

2913 CG1 VAL 373 99.736 46.537 40.366 1.00 27.54

2914 CG2 VAL 373 101.861 45.724 39.335 1.00 29.76

2915 C VAL 373 98.962 43.754 40.969 1.00 29.64

2916 0 VAL 373 98.462 44.135 42.030 1.00 27.43

2917 N ARG 374 98.298 43.015 40.078 1.00 27.06

2918 CA ARG 374 96.916 42.587 40.315 1.00 22.92

2919 CB ARG 374 96.438 41.626 39.225 1.00 20.10

2920 CG ARG 374 96.101 42.257 37.897 1.00 18.80

2921 CD ARG 374 95.627 41.191 36.924 1.00 11.40

2922 NE ARG 374 96.410 41.194 35.692 1.00 20.17

2923 CZ ARG 374 96.956 40.112 35.146 1.00 19.94

2924 NH1 ARG 374 96.810 38.924 35.720 1.00 26.31

2925 NH2 ARG 374 97.655 40.218 34.025 1.00 24.45

2926 C ARG 374 96.835 41.858 41.646 1.00 26.89

2927 0 ARG 374 95.964 42.134 42.472 1.00 32.47

2928 N ASN 375 97.766 40.931 41.842 1.00 27.68

2929 CA ASN 375 97.827 40.133 43.055 1.00 25.57

2930 CB ASN 375 98.776 38.955 42.850 1.00 30.36

2931 CG ASN 375 98.299 38.009 41.756 1.00 32.94

2932 OD1 ASN 375 97.594 38.415 40.827 1.00 25.76

2933 ND2 ASN 375 98.677 36.741 41.865 1.00 30.37

2934 C ASN 375 98.213 40.958 44.279 1.00 26.96

2935 0 ASN 375 97.819 40.632 45.399 1.00 21.31

2936 N TYR 376 98.980 42.026 44.062 1.00 33.99

2937 CA TYR 376 99.381 42.920 45.148 1.00 33.87

2938 CB TYR 376 100.362 43.986 44.645 1.00 39.17

2939 CG TYR 376 101.823 43.579 44.628 1.00 42.30

2940 CD1 TYR 376 102.765 44.344 43.940 1.00 40.53

2941 CE1 TYR 376 104.111 43.997 43.934 1.00 45.46

2942 CD2 TYR 376 102.268 42.446 45.312 1.00 43.05

2943 CE2 TYR 376 103.614 42.088 45.313 1.00 42.63 2944 CZ TYR 376 104.531 42.868 44.623 1.00 48.37

2945 OH TYR 376 105.865 42.523 44.621 1.00 39.23

2946 C TYR 376 98.122 43.605 45.668 1.00 29.88

2947 O TYR 376 97.942 43.773 46.874 1.00 27.89

2948 N ASN 377 97.252 43.984 44.733 1.00 29.64

2949 CA ASN 377 95.987 44.642 45.043 1.00 31.75

2950 CB ASN 377 95.304 45.094 43.748 1.00 34.90

2951 CG ASN 377 94.116 45.999 43.999 1.00 40.49

2952 OD1 ASN 377 92.992 45.532 44.178 1.00 42.59

2953 ND2 ASN 377 94.360 47.303 44.011 1.00 34.81

2954 C ASN 377 95.084 43.674 45.804 1.00 28.41 2955 O ASN 377 94.538 44.015 46.857 1.00 30.58

2956 N VAL 378 94.952 42.460 45.274 1.00 17.90

2957 CA VAL 378 94.131 41.426 45.900 1.00 17.33

2958 CB VVAALL 378 94.186 40.112 45.086 1.00 10.51

2959 CG1 VVAALL 378 93.423 39.012 45.789 1.00 11.35

2960 CG2 VVAALL 378 93.612 40.332 43.698 1.00 13.48

2961 C VVAALL 378 94.616 41.163 47.327 1.00 25.35

2962 0 VVAALL 378 93.813 40.997 48.248 1.00 27.43

2963 N GGLLUU 379 95.936 41.176 47.497 1.00 31.20

2964 CA GGLLUU 379 96.575 40.938 48.787 1.00 33.04

2965 CB GGLLUU 379 98.100 40.924 48.613 1.00 40.56

2966 CG GGLLUU 379 98.888 40.454 49.836 1.00 52.37

2967 CD GGLLUU 379 100.392 40.399 49.591 1.00 57.31

2968 0E1 GGLLUU 379 101.158 40.762 50.510 1.00 59.83

2969 0E2 GGLLUU 379 100.810 39.986 48.485 1.00 55.53

2970 C GGLLUU 379 96.166 41.984 49.825 1.00 31.53

2971 0 GGLLUU 379 95.922 41.650 50.987 1.00 29.16

2972 N SSEERR 380 96.092 43.245 49.402 1.00 32.96

2973 CA SSEERR 380 95.706 44.331 50.300 1.00 37.42

2974 CB SSEERR 380 96.066 45.695 49.698 1.00 38.70

2975 OG SSEERR 380 95.348 45.945 48.504 1.00 49.17

2976 C SSEERR 380 94.212 44.264 50.604 1.00 38.16

2977 O SSEERR 380 93.789 44.512 51.737 1.00 31.46

2978 N TTHHRR 381 93.424 43.915 49.587 1.00 36.08

2979 CA TTHHRR 381 91.976 43.790 49.729 1.00 27.53

2980 CB TTHHRR 381 91.320 43.333 48.413 1.00 22.85

2981 OG1 TTHHRR 381 91.706 44.212 47.350 1.00 16.53

2982 CG2 THR 381 89.812 43.351 48.543 1.00 23.91

2983 C THR 381 91.662 42.762 50.814 1.00 27.68

2984 O THR 381 90.813 42.996 51.670 1.00 29.54

2985 N TRP 382 92.375 41.637 50.779 1.00 28.31

2986 CA TRP 382 92.199 40.563 51.755 1.00 28.12

2987 CB TRP 382 93.063 39.353 51.386 1.00 36.50

2988 CG TRP 382 92.583 38.570 50.195 1.00 38.50

2989 CD2 TRP 382 93.258 37.475 49.565 1.00 42.33

2990 CE2 TRP 382 92.430 37.022 48.516 1.00 44.37

2991 CE3 TRP 382 94.483 36.830 49.787 1.00 47.90

2992 CD1 TRP 382 91.408 38.735 49.518 1.00 36.49

2993 NE1 TRP 382 91.308 37.808 48.511 1.00 36.31 en 4k 4k eo to to en O en en O

co eo eo co eo co eo co co co ro ro ro ro ro ro O O O O O O O O O O tO CO -o co cro cr. o o o o p O p oQ O ό cp cp cp c cp cp co oo vi oo en

2 o e coo ttoo o co oo vi coo en 4

OOOiO N

I_^_-J_,_J_^_J^_J_J_J_J_JOpc poppppppc_p F F F F F F F F "O TJ TJ TJ TJ TJ TJ TJ TJ TJ TJ -l -I H H H

73737373737373737373737373< <<Cl ZrZCZCZrZCZ LCZ m m m m m m m m rn m rn TJ TJ Tj TJ T

eocococoeocococococoeoeocococoeoeococototococotococotoeoeocoeotototocotoω ωoocoooncoω∞coαc-ooooooooooooncβωc-mcoffi ooviviviviviviviviv|vivivic ~nc ~ne ~n eneneΛeneneΛenejicnen4-4k4-4k4k4-4-4-eocoeoeoeoeoeocoeococorororororo

<-D CD -O C O3 C~ CO C~ CX> CD Ct> 00 tO ∞ tO tD ∞ to to to o ro -* vi ep co eo vi ρ p p p p p p ρ p vi p v| i v| vi p p p ρ ro ro p - -k ro ro ω p p p p ρ en 4k ω _k io ω 4k ro viu-Qoω-θ)θcoω i_ι i vi σ ii o 4k c o _k C oo 4k to σ> to bι ώ bo vi

CoO COr4ovi to r vi b ω to vj k 4k cocoo4kθovv)iMctoovvli -k αOO. toCO _k bι _ ό

- cn co 4k S oo -_ eo kroj -_ o4kv4ki(co o or t coosQwcD co bo 4k> ! M-k -k coen 4_k. vv co 4k oo 4k -k ro _ co to 4 oo _ tn ro e c co -k co -k ro oo co eo oo

--> co-roM _k _ 004k CO 0000 (O -- Ol 00 oo O- vi eo co 4- cn _k co vi oι o cn eo en en c "o ~ o ~ vi c tn -k ro vi en vi — oo vi

co eo co cn p oi eo vi to c cn

vo| 4k c-n oi oi oi oi oi oi oi oi oi oi oi oi oeni en en en en cn en cn oi oi oi oi en en en cn en n e _n.e_n.e_n. e_n. en en en en k en 4- en o -k θ _k ro co ro co 4- oι vi en vi σ> cn oi o - -- to eo p en 4k eo J- eo en en cn e en cn vi cn vi en coo c n- k 4k co 2 p vl CD v| eoooocn-en oieooo4kenviro-kcnco --ωcno 2o2 en

4 t r - b 2M2u b co cn cM ^ vi c ro i o -k - to to o

2 — v| -k __ tDv|rvo|C4Okvl o_o- -k-kecnneennecnnccoocoorrooen -k ro -k vi co -k θo c eΛ vi vi c -- cn -' en 4k o _ r .o_ 4k to o -k co -k 4k eo en ro coo oo

4k4kθ--cn_-cocoo CO OO -* v| vl 004- CO O 4k en en cn -- o eo cn oo -k cn cn cn en -- 4k vi oo co o -- cn oo o o vi vi vi eo oo o O ooooooooooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooo o ooo o O o o o o o o o O o o o o o o O o o

eo co eo co eo eo eo eo eo eo eo co eo eo eo eo eo eo co eo co co eo eo ω eo co eo co co eo co eo co co co eo eo eo c- co eo co co co co co co co ω o o o o o o o o o o o o o o o o o o o o o o o o o o p o o o o o o o o o o o o o o o o o o o o o o p co co cD CD α oo e)o Qp co co po cβ oo oo v| vi vJ vi v| vi vi vi vi vi en en σό cn en p en <n e^ eo M -k θ co c5 vi en c ^ e N3 -k θ cD θo v] en eΛ 4k eo ιo -k o co ω vi e cΛ 4- co ro _ θ co m omooooooroo>zooor oooooz O O O O O Z O O O O O P P P P P Z o > O P P P P P o o o O o O O D > O D > O O CD > O O Q CO > oo rom _ko _k ton m -- o o ro > pr ro - ro _k

-H H H -| H -H -H H O O O O O O O O O C C C W M O < < < < < < < TJ TJ TJ TJ TJ TJ TJ TJ TJ "O TJ TJ TJ TJ

•< > > > > 7373737373737373737373737373 X X X X X X

73-7<3-7<3-7<3-7<3-7<3-7<3-7<3rCrCZrCZrZrZrCZrCZrCZrCZπ73ιm73m73m73π73ιm73>>r->F ΓΓΓΓOOOOOOOOOOOOOO 737373737373

co co eo eo co eo co co eo eo eo eo eo eo eo eo eo eo eo eo co eo eo eo eo eo eo co eo eo eo eo co co co co co co co co co co co co co co eo eo co co φ (O φ Cp CO CO (P CO CO (O CO CO CO CO CO CO CO CO CO CO CO CO CO (0 (0 (O CO CO C^ }. $ . l> $ 4k 4> ω U U U U U U ω U I M M r M r<} - - - -

to vl

co co co co co co co eo eo eo eo co eo co eo co M io M ro io M M M M M M io ro M io M ro co co co eo co co CO CO co to to to CO _k -k p _k _k - p _ ^ 4 ro ro ro p p p vi vi vi i co p co to ro k co ro co ro 4 co 4- cn bo vvii rro άoo rro vii bco boo bo bo ωeo boo b Smoo '-- αoo uω bo obffioo boo bσiob ωω bo beobo ωco_4k -—ωco ben oo_ — c -Ooo -nD oDo Uenl -o kro ϊ r n <-n ro cn co eo en co vi eo cn vi „ .bC _t_ol. .o_.ro -k 4k ..ro^ -,l.ro. c_o, _ co c - b-cOo c eo c n -- cg to ro po -vi co - co cooo coo ttoo co 00 CO __ o --- θ -i .ro. t'o• .ro. _k . θ -— o — IS) c —D 4. l M k θo ro ro 4k

0 - M 4k OO (- 0) O M - r rV) ω M - - vi o en eo en eo vi to o eo ro ro 4k oι -- cn -k CD 4k 4k eo ro oo ro cD oo vi

OI Ol Ol Ol 010l 4k 4k 4k 4k 4- 4k 4k 4k 4k 4k k 4k 4k 4k k 4k 4k 4k 4 cn en cn ϋi oi oi oi en en cn en en en en cn en en en en en en en oi en en

00-0000)0)0)MMOOMO)MO) vi cn cn en vi v| p O CO IO p -k -k -k p -k p -k ro -k -k p ro - -k jo r ^ ^ vi vi vi p co oo ro oo cn ro oo 4k co ro ro cn c cnn oooo oι p 4k o cD vi _ _k eenn cώo oboo eenn ctoo oboo 4k -- _n. e _o- ro eo eo _ -k CD Co oi 4k o co vi co co cn _k eo o en co co -_ co co -- ιo eo en ro eo -k _k co o) 4- en -k _k tp tp ro vi oo ro oo co M S co ω s ϋi s S ω o r ω M ω r tn ω co o s o r σ)

__ co θ oι _k CD oι -k en o co oo — en eo o _k θo 4k 4- vi o oo eo -- -- co 2 e oo co oι vi en co 2vi oι co 4k vi oι o eo en en -k (o co -k en oo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo co co co co co co ro ro ro ro ro ro _k to to ro -k eo vi vi to p p ro vi p p p O v| 4k p to bo co ro - ro b bo bi - b bo co bo D eo 4k cn to en co co vi 24_ co vi vi 2 v .i en 2 c 4k

3094 CZ TYR 394 100.095 32.941 51.248 1.00 34.89

3095 OH TYR 394 101.324 33.471 51.562 1.00 35.44

3096 C TYR 394 96.900 31.615 47.813 1.00 27.71

3097 0 TYR 394 97.400 32.622 47.310 1.00 30.17

3098 N LEU 395 97.278 30.379 47.496 1.00 19.47

3099 CA LEU 395 98.356 30.112 46.551 1.00 18.70

3100 CB LEU 395 98.664 28.615 46.506 1.00 23.07

3101 CG LEU 395 99.219 28.005 47.796 1.00 25.20

3102 CD1 LEU 395 99.416 26.512 47.609 1.00 19.35

3103 CD2 LEU 395 100.532 28.681 48.180 1.00 17.74

3104 C LEU 395 98.106 30.630 45.140 1.00 19.62

3105 0 LEU 395 99.030 31.112 44.485 1.00 19.16

3106 N SER 396 96.862 30.549 44.676 1.00 25.13

3107 CA SER 396 96.521 31.018 43.332 1.00 19.88

3108 CB SER 396 95.047 30.749 43.022 1.00 25.09

3109 OG SER 396 94.196 31.513 43.858 1.00 39.87

3110 C SER 396 96.828 32.504 43.165 1.00 19.03

3111 0 SER 396 96.920 33.005 42.040 1.00 15.70

3112 N ASN 397 96.999 33.198 44.290 1.00 14.51

3113 CA ASN 397 97.308 34.624 44.281 1.00 20.25

3114 CB ASN 397 96.252 35.401 45.072 1.00 21.33

3115 CG ASN 397 96.348 36.901 44.858 1.00 25.70

3116 OD1 ASN 397 95.985 37.411 43.795 1.00 26.44 3 3111177 N NDD22 ASN 397 96.840 37.617 45.868 1.00 14.18

3118 C C ASN 397 98.702 34.926 44.844 1.00 21.44

3119 O 0 ASN 397 99.446 35.727 44.277 1.00 16.68

3120 N ALA 398 99.053 34.263 45.944 1.00 21.43

3121 CA ALA 398 100.339 34.463 46.611 1.00 18.24

3122 CB ALA 398 100.303 33.853 47.996 1.00 9.21

3123 C ALA 398 101.576 33.973 45.861 1.00 22.03

3124 O ALA 398 102.693 34.375 46.183 1.00 27.40

3125 N LEU 399 101.392 33.099 44.878 1.00 24.29

3126 CA LEU 399 102.530 32.590 44.123 1.00 21.14

3127 CB LEU 399 102.133 31.379 43:276 1.00 16.51

3128 CG LEU 399 101.814 30.092 44.047 1.00 22.47

3129 CD1 LEU 399 101.475 28.979 43.068 1.00 23.59

3130 CD2 LEU 399 102.986 29.686 44.929 1.00 24.50

3131 C LEU 399 103.189 33.656 43.256 1.00 21.08

3132 O LEU 399 104.414 33.724 43.181 1.00 27.40

3133 N ALA 400 102.384 34.499 42.618 1.00 23.35

3134 CA ALA 400 102.921 35.556 41.762 1.00 25.45

3135 CB ALA 400 101.860 36.050 40.782 1.00 20.16

3136 C ALA 400 103.500 36.724 42.562 1.00 21.72

3137 O ALA 400 104.438 37.380 42.109 1.00 16.17

3138 N THR 401 102.960 36.966 43.757 1.00 16.96

3139 CA THR 401 103.445 38.054 44.605 1.00 19.18

3140 CB THR 401 102.535 38.294 45.832 1.00 15.54

3141 OG1 THR 401 102.407 37.090 46.592 1.00 24.65

3142 CG2 THR 401 101.167 38.752 45.393 1.00 12.23

3143 C THR 401 104.893 37.842 45.055 1.00 25.46

eocococoeocococococococoeocoeocototoeocococococoeocococococococotocoeococococoeoco cocococoooooooeooeoooocoev|viv|v|viv|vivivivio)enenenenpenencnene^ c ro-kθco∞vic eΛ -coM--θ(θooviOTc 4kωro__oeocovicnc 4-ωro-^

POχPNPmσPmPoPoPcPoP>Z OPOPPPPPPPP OPOPPPPPPPP O P P O P P O P P O O P Z O χNrnorπooro> χNmσmoocD> O O ro > O O CD > tθ IO ~k -- ro ro _ - ro _ ro -k

7373737373737373737373737373737373737373737373737373737373737373737373737373737373737^

k k4 4k k4k4k4k4k4k4k4k4k4k4k4k 4k4k4k4 4k4 4 4 k4 4k4k4 4k4k4k 4k4k4k4k 4k 4k 4k 4k 4k 4k4k4k 4k 4k 4 4k

SooσpQpQOQOOopooooooooopppppbppppppooooooooooooooo cne!n3)cncncncnencneneneno.enencnoιcncnenenejι*^

ooooOoOO oO_OoO_OoO_Oov_loooooopp 00000000 0 0 0 0

CO CO OO O covicoviroco4- ω o -~ ro -k p vi p0vi0vi00vi00

Mffl p vl ovie e 4 op irovi k ovio -kp -e e 4kMvic eo en -* 01 in 0 _04k co b bo cn to b bo 4k 01 CO -OM01- toeno-'Cenroooenvi4_ eoeDrocovicDcn v| eo CO _k 4- cn k ro ro 00 -vi 01 -fk co o ro -k cn cn-keoejiroMoeeo4-oK5enoecD

eooivio_kcoo cn eo cn tn vi ro oo co ro -k 4k to ro - i — ro co 4k 4k 4k 4k 4k 4k 4k co co eo co eo co co eo co co eo eo co eo eo eo eo eo eo co eo co co co co co e coo co co 4k eo co eo eo co co eo co co to to to c 4k co - ro o p o (-n ρ _k - _ r p p 4- ^ ^ S ^ p ω ro ^ k ω ω 4k vi vi p p p p vi vi o 4k 4k 4 p cn 00

S 4k - vi 4k i to ι b b 'vi 4k ι 4k c b ώ ι ι io ω ω ι ro ^ ∞ vi ι 4 ώ c vi en b io to to b ω' -(θo co bo co cn vi oo vi cn eo ∞ cόo ro cD θ -k eo cn p K_ ecoo ecoo ccDo θeni vvli ooiι ocno ecoo σbo) 4^- cenn coni rroo eenn oo rroo -k conό 44-- to ro roco_-cncooooo O_ -k CO 4k oo _k -- -- oo S en co en en oo eo oo 4- -k — oo cD vi oo eo o co en oi co co co co co oo o ro co eo So rooooenenoooo k to

ooooooooooooooooooooσooooooooooooooooooooooooooooo 00000000000000000000000000000000000000000000000000

_- -_ _ _ _ _ o ro - _ — _ — _ — ro ro — ro _ _ _ ro ro ro ro ro -k ro -k _k _k _k _k ro ro ro -k -k -- ro ro co oo ro 4k vi ro co cn eo o o cD ro oo 4k vi oι oo cn cn 4k -k 00 4k cn θ) M cn θ) -k θ) θ co ω σ) co 4k v| 4k oo en e _k -k ro vi ro co -k θi 4k cn vi en e o eo rθ 4k vi o o eo e)o - en vi o cn en ιo 4k - 4k 4k cn vi en co eo eo o -k eo 4- -- cnvicnencooooororo _ to 4 vi ro co co

- 4k o - _ό o 4 o- eoenroro-kocno eo 2 oroooo viocoeoenoenooooroeovivirooiooocncoo _ to _k co o —

eo co co co eo coeoeoeo eo eoeoeoeo eoeo eo eo eo eo eoeo eo co co eo eo eo co co eo co co co co co co co co eo co eo co co eo cj co co ω MM M roMtXJM roro ro M M ior o i M i Mro to M

coeoeoeoeoωeoK5roroιoMioroK5Mro-k — -k — -k _k _ _k _k _ ooooo oo _ o_ o- o_ to CO CO CD CO CD θ)eΛ 4- eoM -k θ co oo vi oo cn 4k eo ro -k θ co oo vi oo oi 4k co ro -- o co oo vi cn cn 4- co ro _k o co oo vi cn en k

Po Pro P> Z OPO χPNPrnPoPrnPαoPPoP>Z O O O P P Z OP P O O P z O P P O O P O O P P O P P por> O O CD > O O CD > CD > to tO -k — * r ro _ o σ P P o P r P ro — IO — o >

mmmm ^ — -<^-<-<^rπmmmrnm -i -\ -i -i -i -* -i -\ -H -. H -i-i-i > > ι_r-ι_ — r-r-r_r- -H cccc X I X X X X r-r-r-r-mrπrπrπrπrπrπrπ-< J 7J3JΛΛΛ ΛΛ3J^ 7J7J SSSSSSJ Λ3J ^J7J πJ Λ 3J 3J 737373737373 > >CCCCCCCC7J

k 4k 4k k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k 4 4k 4 4k 4k 4k k 4k 4 coeocoe rorororororororoιorororo----_k -k_k -k — -_ -k -- _-. — -k O O O O O O O O O O O O O O O O O O O O O — O O O O O O O C0 C0 CO C0 (0 C0 O C C 00 0000 v| v| vl v| v| v| v| v| 00

_-, _ _ _ _ 0 0 0 _k _ - k _ k _k _ k _k _k _k _k _k _k _k _k

CO i pi pi p pi CO C04k 4k co eo 4k k pi v| p p p k p 4 4 c co to ro -i p -k ro - o - p ro ro ro ro to :--1 o o cn — cn ι 4k ώ bι bobo bo rooιro 4k -vi in vi cn vi i to ^ ^ b k - -M i ( ^ b 4 o roro roovicoooco — eooo -k - -- en 4 oo ro -k o Cn 4k en eo - C0 p vl C000 C0 O O e0 C0 O 4 O CO v| tD 00 C04k vi ro co o o -- eo oo co vi vi vi oιo 2 v| eo en en 4- cn to vi 2 eo (oω ω - s O -k i b4 o 00 CO - 4- 4k θi ro o cn oo co cn ro 4k coo co co 4k cn σ> 4- oo ro co CO CO CO to CO to cn 0000 v| v| vl oo

2 ro oi cn oo oo co ,- o c „n. c_o — cn to o co -k -k en to ro co co to to eo co coeo coeo co co eo eo co co _co-. eo co co co eo co 4k 4k co co co co eo co -k ro k w ω -r - r roo Mro trooωωtωoJ_4k. p ppp -k p p vi vi pι to to 4k to vi toenco -k io S 4

K5 teoo co to Ol oi CO O 4k o rob ikbito eoio to inbi to cn vi co — to cn eo ro en en vi -k oo -k — cn oo ro -k — oo ro eo o oo

o -o cn oo o -J. to o en en co eo eo cn o co eo 4k co rooo en co 4k θo en 4k ro vi ro oooooooooooooooooooooooooooooooooooooo ooσooooooooo oooooooooooooooooooooooooooooooooooooo oooooooooooo ro ro ro ro ro -- ro co co eo roro eo ro -k -- ro -k — _ __ r ro -- ro -- ro ro -k — r roo --k r wo - — — ro - — ro - - _k _k ro oo -k -- jo _- ρ ρ p ω -* _— 4k to M p -- 4 p vi roω p p v| p o cn _ tob _ oD -- ^ bo ) co - coc pi l vi Mb Kj-- i to to co eo vi ro vi tθ rθ Cθ 4k _ k 4k c ro cDen vi eo 4keo-M co eoen enenen co c ro cn eo en en 4- ro -k vj cocoeo -kθo cn eo 4- ro v| — to CD vl 4k oωoui -cooxo v1

co co eo co co eo co co eo co co eo eo eo co ro ro ro to ro ro ro ro fo ro ro ro ro ro ro cn en en en c

2n en en en en 4k 4k 4k 4k 4k - oo vi cn eπ 4- eo ro o co 00 v| oo oi

O O O P O O P Z O P P P Z O O O O O O O Z O O O O O z o p p ω p p p m O m P o P o P ro P > o o ro > CD > O CD > N m α o ro > rn σ o co > o P o z o P o P ro -k ro — > σ ro σ -_

0000000 _H H H H H H H > C C/O- C_O C_O ClΛΛ CCΛO rO r^ r- | r- r- r r r; .- ^ ^ <; g; ^ ^ 2 r- f- f- r- r- r- r- X X X X X X X r~ _______ o0

-ororor rf„fi in;mr C C rZ C rZ rZ rZ 7) 737373737373 -<- -< c c c c

4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4 4k 4k 4k 4k 4k 4k 4 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k k 4k 4k k to ιo ro to ιo ro ro -k — — — — -- -- — — — _ _ — — -k -k __ _k __ __ _k _ _ ^ _ _ ^ _ _ _ _ _ _ _ _ _ _ _ _ _ _k _ _k o o o o o o o co cD co co co cD co e>o e c c c vi vi vi vi vi vi cn cn en cn cn cn cn cn crι cn en cjι cn oι oι oi 4k 4k 4k 4k co

o σ o o o -k _k -- — — — _ -k _ _ _ — _ _k _ _ ro ro ro ro ro ro ro ro ro ro io ro ro _k -- _k — - - ro - M M - - - -' - - co vi p co co p ^ ro ro p p p ^k p p p vi p p ro p p p p p p ^ ^ ro ro p p ∞ p p p p p o o b b to i> -k bi M en 4k in to to c b in to b in ro to b 4k — r ω b ώ b ω b b b b b b vi b b b b to b - b b i k M -k vi ^ cΛ vi k θ M -k c *k ^ vi M e3 θ to ^ c c θ vi m _ Qp -k 4- cn en e cn eo o vi 4- c cn M ω r\) (θ θo ω - M *. - δ r J 4k θo s - (n o - M θ - w ω δ (θ cn oo oι o ω o ∞ o ω

sppp co eo co co co eo eo eo eo eo CO o eo eo co eo co co 4k 4k co co co co co eo eo co co co co co co co co 4k 4k k 4k co co co co _ _ ro co co cn eo to co ro ro co oo en o o (o oo v| vi vi en cn ro 4k θi en oo vi cD co o o o o _ ro __ o -k in - co oo en cn cp 4 M co — cn oo 2 e o eo ro en eo cn oo o eo 4k ro o oo en to -- co vi vi θ 4k -v| CD co _k to o b b oo oo p en vi _ co co co 4- r <00o _ 00 - - 000 S - (0 M - M M t)l M vl co J- 5. co co oo ro co en en vi vi eo eo vi 2 O O o cn ro 4k 4k _k 4 O ro oo ro co eno4kenenoooo--cooovico en oo -vi ro co 2 r oi ro 4k _k v| CO - co 2 — co -k oo ro ro ro ro - - W

— — O (O (O -k pM WN M-k - M;_> pM M-k M[O |M M I r4k Mp |j MtO M Mp Mro pN K-)k MM Ii4. I4k pM M pM pM M4 M M M p) I Mvl Mvl Ml M M M M M M M U bi — ώ όo to - b b ffl b _ b _ ω _ ω ik b ω - b M b b ω v| !|k b M N ω b s b b - i s - ω r b b ω o cD -k ro co cooo ccnn oo oQ oo eeoo vvii co en 4k eo 4- ro en ca en vi p _ ro co en to cD Oo vi to co co cD o o 4k 4k Cji o p c 4 o ro co oo cn Uco Mvi ueln uen) -_k _ O N CO O O O) M _ (00) 0) t> O M M M M (O o O) O CO ffl (Or 0 k (n O (o 5 _ ^ oo ooooooooooooooo oo ooo _ ooooooo ooooo o ooo o o o o _ o_ o_ o o o o o o oooooooooooooooooooo ooooooooooo ooo ooooooo ooooooo oo cn cn oi cn 4k co ω w ω - , ro ro ro ro co co co co co 4k 4k 4k co co co 4k co vi cn oo cn k to co co to -k ro - - _ ro co to - - ro ro to to c po e Onl 44kk — en co eρn epo op oo _vvii cn en vv|i -k p -k -k p p p 4k eo Ol vvil vvi| -_ vvii c rroo epn co en r- φpifflOM-. vl v| p p 4k b ω ώ ^ - ω ω j r b A r r ω b - i b ' b b vi b b b 'v| '_k o i'n bo co n in bo - cn oι cn -- W vi - co ι co oc M ω rθ 4k Co ω ω c-i ω oo ro -k o oo 4k oo -- oo cn vi

P NPNZmPσPrnPrnPσPoProP>Z OOOOPPPP PPPPPPPPP O P o O P P P OPZOPPPO ZOO

CO M — _ to t I R mC o o ro > Nmmαooro> o o O ro > to - ro -- m ro m — k o o co >

H d^ DOOOOOOOO JTJT T T T TJTJTJT TJ>>>>> >>popoOOC O - OQ TJTjTJTJTJT TjTJT TjTJcccccccccmmmmmmmmrπmrπTJTJTJTJTJTJTJTJzzzzzzz zzcc

4k k 4k4 4k4 4k4k4k4k4 4k 4k4k4k4k 4 4k4 4k4k 4k4 4 4k4k4k 4k4k4k 4k 4 4 4k 4 4k 4 4 4k 4k 4 4k k 4k k 4k k -fk 4

M r M M M M M M M M M M N M M M M rO M M N M M N r. r M K) I M r M M M I. I. M M r M M M r M M M M M M M en cjι en en en ejι CΛ en en ejι oι 4k 4k 4k 4k 4k 4k 4k 4k 4k eo co eo eo eo eo co eo co co co M ro M M M ro ro ιo -k -k _ _ _ _

o o — o o o o o o o o o o p _ _k O O -- -k -k _k _ __ _ _ _ O O -k -k — O -k O -k O O -- p p p p p p pp v| i p pco en 4- 2 e o _ _ _ _ n o en o vi o vi o _ vi 10 - 1. 0 - 0 (0 (0000 ω ^ ro ^ -k p p p o o p p to o p co K ro- '44k tocoionι ionι vviibcoo tococonoieoo rtoo ^---k ^ —- vi vl vl vl -k rθ Ol _k 004k 4k 4k CO Co r ^ ro in ∞ to to to in b io to -k bi ro 'vi ro in b bo bo 4k vi ωM cη vi ρ co po eocneo p -k oo oι oo oo cn UeoJ Uo 4*.44kk _-k — — U eobeoJ c_o - l.4kk UooI IcUo Uo Uoo -oo Uen) Nro vi eo co cD co o -k -k ro en en ro enco vi -k vitooo -kocooooo 2 -k cooi vi-koocooo eeoooooooorroooooocennoovic Kocnrooo cocn covi oo co o σo oo -k co 4k θ ro o ro M M M to M ro M io M ro co M eo co eo co eo eo co eo co eo co eo co co co co co co ro co ro co co co ro ro ro ro to ro ro to eo to co v viioi 4kk 44k -vvii oi cpn en vv|| vvi| cpDco cpo op co op op op --kk --kk rto roo ooen cn cn cn cpn 44kk epo rroo po r--k Oo optD Op Op Op co co vi oo vi co oo o -k ro ro ωb ωb M'^ toi b- b bb bfoω bb vi u ωb b ωb U4k obiro oιbo v-vii oιbco oboωeo 4kk ob obo co -vi oo o co o 4k en en en oo cn eooto 4k cn cnoo cD 4kc co coco co co ex) viencoen vio -' vioo oco p --oro co eo vi rop cn 4k ro 4k oo - o co co o cn ro vi vi co 4- co co oι en en cD θo vi ro o oo en — ooo -- ro 4- 4k cn ro ro ro cn ro 4- co ro o cn vi _ — k oo — oo -k oo co co co O 4k o v| co co to ro p p CO 4 ρ - -k ro - i 0n)to(DbOb0o- 's MN eno o vi ooos-

ro cn cn ro -- oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ro -k M M w ro ro toro ro ro co eo oo vi vi c-04k co ro eo io to eo eo co co eo ro ro -k ro eo eo ro ro ro ro co co oo σ> vi cn 4-. C poι ωp -- p p o p p — k w op ro o en 4k co -k ro co co oιoι vi oι -- co co 4k vi o ωO C vOi t po t vo en cncooo θ 4k vi i viω o 'to ω 4 όι 4k xι ω ^ '— ^ vi b vi — en ro inin peo ro vi k b 4 -- vito in ^ 4k o b vi k vi b 'vi

MMC _ tn- --i010)0)Mt OO vl OOMOO t(DM MJ 4-en eo en eo o en -- — oio ro -k ro ro 4k oi ro co oo 4k co oi

en k 4 eo eo to to o en o en o en o

co co co co co co co co co co co co co co co co co co co co co co co co co co co eo co co co co co co co co co co co co co co co co co co co co co co ω ω ω ω co ω ω ω ω ω ω u ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω co ω ω ω ω co co ω co co co co oo oo ~ooe c cρ c)o co oo oo vi vi vi vi vi v| vi vi vi vi en en en cn en p o cn cn cn oι en c-n cΛ cn cn c onι ecn ecn ecnn 44kk 44k 44kk 44kk eo to -■ o co oo vi σό en - eo M -k θ co c vi en c 4k eo ι -k θ (o oo vi oo e 4k Co ro -k θ cD θo vi cn oι 4- c"o 'ro -k o co oo vi co cn

OO Z P P PP PZ m o o ro > O P P P P P O P Z O O P P P PP P P o P O

N > OP Z

N o o o o o o ooo o ro > o o ok o r P m o o ro > p ro > to - o σ ro α — o cα > to CmΛ CmΛCmVO cmTJcmyo wmm- rm- rm— rm- r- r- r— r- — | H H

j] j) j) j] j j] C C C C CC C C T) T) T)

4k 4k k 4k k 4-. 4 4_ ^k ^ 4k ^ k ^ 4 4k 4k 4k 4k 4k 4k 4k 4k 4 4k k 4k 4 4k 4k _.4k 4k k 4 4k 4k 4 4k 4 4-.4k 4 4 4k 4 ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω u r i M M N> r N) iv> ro ι ιo M

— — --, — — __ _ _ _ o o o o o o o (θ (θ (θ <θ (θ (θ (θ (o co oo e ∞ oo c c cβ c vi vi vi v| vi vi oo oo cn cn oo σo cn cn oι en en

o o _o o o oo o o o o o o o o o o o v| vl Ol l8 co co o> co cn n ovi -viocn oen eoo 22 o o eootooro 2 k -k O O O O O O -k co roro ro ro ro ro to ro co ro co eo eo 2 o.o co O - n eon c p- p p p vl vi vl -k totorocn- ωooσi en cn en vi co c vi oo en cn co cn go o vl -_ co en 4k -vl OO Ol 4k 4k vl CO en to -k io to bo bo en ro -k eocn co oo o enoo eo -k cn en p eo J- ro o oo en vi cn oo co o — -vi co en co o 4k — cn o to o vi ro cn cn ro o to vl to v| _ co co ro P - co vi co — e o -&. -- en K5 cn -k oo ro to co en oo co 2 o vi co vi oo ro cn 1-2 co 4k vi oo co ro co ro co cn σ> ro ro -k -k _ ro M fO M M to M to M M M io eo eo M ro ro ro ro ro M M M ro io ro ro co co eo eo co co eo eo to to co co co eo eo cn oo oo o — ro ω en 4k en en eΛ vi en en en o o co oo e e en vi cn en en vi vi < o — op --k rroo --kk __— oo o M o -k — o co vi co cn co , — C04 _k _ 00 tO 4k Cn 4k e0 O CO 4k C0 v| _k vl C04k oι eo (o eo en eo cn ro 4k cn o vi vi bi bo ro in Ol v| 4k _ eo co cn eo co o en o _o2 k to o co cn eo en ιo en 4k vi o vi oι oo eo — co co — to cn eo co vi p p eo vi o en vi co vi o ro co oo co O o en co co en cn to en co en ro eo oo 4k CD vi oo oo o vi o en cn vi cn co o cn o cD eo eo ro ro - oo 4 oo -k co eo ro vi J. co co co eo co eo eo co eo eo eo co eo eo co co co co eo eo eo co co co eo ro ro ro ro ro co ro eo eo ro to ro ro co co co eo co co co ro ro ro co

00 vl oo p vl " M ffl fflOi pi * J ro eo ro eo co cn 4- 4- 4k co ro ro -k 4k cn en vi co o to -k θ vi oo co co _ o -k ro -- o o oo co θ- -k io _ — 4k ro oi to co o 4 o ro 4k θi 4 eo e_ϊ oo "_ o - -o- c - " —_o o-o. o-o- "4 —.k vi 4k 4k c — - "__o c"—n - ".k c to vi ω b co vi 4k to ∞ KJ to bo o ω en en c P vi cn 4k io n -k b vi M 4k co cn _ vi to o en o en o -k M o c-o co -k oo vi cD cn en M co vi o en co vi co M ro cn vi vi o ro cD cji co co oo co — — cn oo ~ o "i 4k CO OO co co oo ro co oo oo -k oo oo o vj -k o oi o - vi ^ vi eo cn -k -k θ eo cD en oo cn -k en ro co co -k θι oι oo co co 4k co ooooooooooooooooooooooooooσσoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo ro - J. J. Mro Nro Mro Uco Mro Uco Mro --k --k --'k Mro (ro ro ro ro -k o p cfl p pp — p — oo __0 -_ uco ro *4 *4k - — - — p p co bo b b b u b - M b M 4 to co en o i- θ

co to CO CO

3394 N ILE 432 109.051 23.316 36.380 1.00 15.93

3395 CA ILE 432 1 10.306 23.757 36.979 1.00 16.86

3396 CB ILE 432 111.497 23.632 35.994 1.00 20.40

3397 CG2 ILE 432 111.278 24.502 34.756 1.00 16.63

3398 CG1 ILE 432 112.804 23.985 36.709 1.00 14.19

3399 CD1 ILE. 432 114.048 23.649 35.920 1.00 13.37

3400 C ILE 432 110.182 25.187 37.499 1.00 17.42

3401 0 ILE 432 110.681 25.508 38.579 1.00 24.54

3402 N LEU 433 109.488 26.035 36.742 1.00 15.09

3403 CA LEU 433 109.277 27.420 37.146 1.00 14.83

3404 CB LEU 433 108.728 28.245 35.978 1.00 13.49

3405 CG LEU 433 108.378 29.708 36.272 1.00 10.45

3406 CD1 LEU 433 109.564 30.430 36.896 1.00 15.23

3407 CD2 LEU 433 107.939 30.400 34.993 1.00 9.30

3408 C LEU 433 108.289 27.433 38.304 1.00 18.07

3409 0 LEU 433 108.481 28.140 39.295 1.00 21.14

3410 N GLU 434 107.245 26.621 38.173 1.00 21.38

3411 CA GLU 434 106.209 26.503 39.188 1.00 16.25

3412 CB GLU 434 105.184 25.452 38.753 1.00 23.52

3413 CG GLU 434 103.812 25.605 39.385 1.00 38.66

3414 CD GLU 434 103.161 26.933 39.037 1.00 42.62

3415 OE1 GLU 434 102.828 27.148 37.851 1.00 32.73

3416 OE2 GLU 434 102.993 27.765 39.953 1.00 37.72

3417 C GLU 434 106.850 26.095 40.511 1.00 14.12

3418 0 GLU 434 106.561 26.676 41.556 1.00 14.76

3419 N ALA 435 107.753 25.120 40.440 1.00 17.75

3420 CA ALA 435 108.465 24.610 41.610 1.00 16.67

3421 CB ALA 435 109.303 23.410 41.214 1.00 8.83

3422 C ALA 435 109.344 25.683 42.254 1.00 11.99 3423 O ALA 435 109.372 25.827 43.477 1.00 7.99

3424 N SER 436 110.057 26.435 41.422 1.00 15.97

3425 CA SER 436 110.924 27.508 41.900 1.00 21.95

3426 CB SER 436 111.636 28.163 40.713 1.00 24.20

3427 OG SER 436 112.489 29.212 41.135 1.00 40.93

3428 C SER 436 110.110 28.554 42.674 1.00 21.39

3429 0 SER 436 110.519 29.009 43.748 1.00 24.40

3430 N VAL 437 108.951 28.912 42.125 1.00 18.68

3431 CA VAL 437 108.054 29.889 42.739 1.00 8.95

3432 CB VAL 437 106.855 30.188 41.818 1.00 11.54

3433 CG1 VAL 437 105.917 31.169 42.478 1.00 11.34

3434 CG2 VAL 437 107.339 30.734 40.486 1.00 5.44

3435 C VAL 437 107.533 29.401 44.092 1.00 9.21

3436 0 VAL 437 107.452 30.176 45.048 1.00 12.18

3437 N ILE 438 107.185 28.115 44.161 1.00 9.76

3438 CA ILE 438 106.673 27.504 45.388 1.00 8.03

3439 CB ILE 438 106.309 26.015 45.171 1.00 14.49

3440 CG2 ILE 438 105.931 25.360 46.500 1.00 10.62

3441 CG1 ILE 438 105.162 25.896 44.164 1.00 23.13

3442 CD1 ILE 438 104.753 24.468 43.853 1.00 31.20

3443 C ILE 438 107.692 27.603 46.520 1.00 12.21

OOOOPPPZ OPPPPPPZ O P P P P P z o σ o ro > Z P P P P O P o p p z o o o OP OPPPP OP Z O o ro > z z P

X X N O ro >

IO -k — __ ro ro > ro - ro - m o o ro > o o o ro > O

>>>>>>>>> <<<<<<<>>>>>>>>>>>

TJTJ TJ TJ TJ TJ TJ TJTJ ~ ~ ~ ' ~ ~~ OO OOO O O O O O O C0 C0 C0 C0 C0C0

4k 4k

01 4k4k4kcocoeoeocoeoeo-ororororo rororo---k — - - — — _ — — — ooooooccooδcoccooccooccoocco k o ω ω ω

CD CO 00

O OOOOOO0O- -k_ — -k -k — OO OOO i o o o v| pp_vi co pppp p ω roto -- p p -v p vi vi δo σo cn oooι 222 co p4k o o o o c- o n e_n vico eo o o o o o o ro ro v| oto — ro — eoen -enroocopvi ω -kvibvi — 4 to ro ro — 4k co en co o to io oo o o co vi cn (θ vi oen roro 4- ro M O _ 0) p (O I o eMoou1oorov-icOo —O eI ς4nkv-io(O4u) cun)oMotfflooS - en eo co -k e 4k to 4 cn c 4k k -k θoeooo co oι oι oooto 4k to -k — C cn cn <-n - cn 4k ro o oo coo vi c_ co 4>. oo co co co oι 4- coco vi co en co ro -k -k O O CO — to

oi 2 en en en cn oi o eni ocnicjι en cn encn en oι cn oι en en cn en cnen cnen en 4k 4k 4k 4k 4 4 k 4k 4k k 4k 4k 4 4k 4k 4 4 k 4k 4 eo to -k ro - Is) Is) 4k U p - Is) ^ Is) - k p O p rO p — k p — ' p p p vCOu 0u0i 0u0u v^i| CO. ^v.l i c-o' uoo. ucnωen viWcnic-oiviuoii wcn vi i coo i vi cDcovi to _k vi c moc^o, 4k r.o.c ^n ^ M^ - b ub -b^ b b jb M M -ωb b M r - 4k in _ ro in o eooi oo — en ro vieo o o cn en -k θco c α)e vi p cΛ θ oo M C k coo vi co M - - ^ co ∞ co ϋi c _. - —k θ _ o _o coco cn ro oo -k co o ent oooco - enooo oo (ooor cnα - ooω -lk(oθ)θ)θ (θ- (θo -θ (θ(θ θM viωeo(cDo ccoo --k coBo Ccoo ωeo ωeooen) eo en oo cn co oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo co M M 4k 4k co ro M M to to 4k Coeo r ro - _ _ _ _ _ _ _ _ _k _ _k _k _k ρ 4 _4k -k to p p p p p -k p p vi — p ro p p p 4k ro - o p θo

4k cnωbι bo 4k vi to roen en 4k — en ik ob ik vi is i - '- bb ω cn to 4k vi vi vioιcocn - coocncnco

vicnooenocn 4k θvivi 4- roco eoroeno -k 4- coooco

en 4- 4k eo eo to to o en en en o

ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω u ω ω ω ω ω u ω ω ω ω ω to ω ω u ω ω co ω u co ω ω co ω ω ω ω u co co ω en en en en en en eii cn cn cn cn cn cn cn en en en en cn en cn oi oi oi oi cn cn en tn cn oi oi oi oi oi oi oi oi oi oi oi oi oi oi 4k 4k 4k 4k 4k 4k 4k 4k ^ co co co eo eo co co co co co to M io ro M ro ro ro ro ro -k — -k — _ _ _ _ _ _ o o o o o o o o o co co co co co co co ro -k O co c vi cn en S co M -- o (D ex) vi en eji 4k co ro -- o eo oo vi cn cn 4k eo io -- o co oo vi oo cn 4k co ro -k o co oo vi cn cn 4k

PPZOPOOOPPP OPOPPPPPPPP O O P O O P z O P P P P O P P z o o o o o o o CD> mmooro> χNmomooro> O O CD > o P > ro -k to ro -o. — O O D > to _ to — α ro o ~ o co >

>>>>>>>

X X X X X X X CΛ CO CO CΛ CO CO CO r-r-r Z r Z r Z r Z r r Z :CCZ73737373737373737373737373737373737373> >> 73737373737373 TJ TJ TJ J TJ J TJ

4 4 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4 4k k 4 k

Cn c e e e e cn e e en c e - k 4 4 4k 4k 4k k

_ — — O O O O O O O O O CO CD CD CO CO CO tO CO CO CO CO CO OO ecec cvivivivivicncncncncoocncncntnenenenenen

O O o o o o o o o o o o o o -k _ o o o o o o o o o o o o o o o Pr* CO O eo 228 cn en eo vl v| 00 CD CO -- O CD 0000 CO v| 00 v| vl 01 Cn C04k 4k 4k Ol vl CO __ vj to -k cn oo υι oi 4k co ro co 4k cn co co co co to — o cn en vi vi Cro0 ovi| oCO cvn| CcOo r4ok CeOn e-nk cvDi tcOn

co en ro to en oo cn CO. -O-- t-o- C-O- o-o 4_ co r -o - vi - t —o o - 2 00 σo co tn oo ro ro en co σ vl o co co co eo co eo co eo eo co co co eo co eo eo co co co co eo co eo co co eo co co co co co o co co co co ro ro ro co co co co co co co co co co cD v| vi vi ro 4- ω co ρ cn co en ro ro ro ro co eo to to 4k 4- en cn vi oo cn en *.4k 2 c co ro -k _ _ oo vi oo o o ro — -k co ro ro ifl ro vi to ro ro co bi to co vi to b -k cn cn — -k θ o σo oo ro 4k cn cn vi oo cn en _k _ — to oo -k vi o cn cn oi eo io pώ co - oi M j ω cn oo c —o vi tn eo ro cn cn -k oo oo cn cp vi 00 CO CO co — oo cn oo ro vi eo co σo co o en vi oo -k co en ro ro oo eo cn -k (θ θ cn cn oo α) θ) - - is) J M * o to vl J O -- o oo co vi 4k co o o to to ro oo cn en cn cn cn cn en cn p p en cn cn cn cn cn cn cn cn cn cn eji cn cn cn en en c cjni ccΛn tenn ecnn cϋni ϋcni ccjni ccjni coni cc^n tn oi cn tn ui en p en en e „η. e _n. en tn - — ro eo ro ρ en 4- -U M -k p p ro ro o -k p p p p ρ ρ p ρ p _v| vi p v| vi v^

- b bω b b ω b b b vi b b b b b b s b b b b b ^ b b b b b ik b b ω ro b - b b - b b b b vi — vi co vi J- oo eo -k Oo io co vi co co -k C δoo vvii coni ccnn een eeo ccBB eδo --kk MM ctoo vvii oδ --kk vvi oSo cSo ocno ucήi ctδo tto tωo -k -. ϋi enoi S o M * - rn ro m ^ _ πi _ n rn rn /n _ rn _ n o no Mto viI rcno renn vJi moo kNi3 kto. no viI o-k vil raco rcon o-- ron mcoo πenι mcn (cno reono A4k rcoo no rcnn r(in renr rcon no vii ^vιi oo 4k vi boboboboboboboboboboboboboobboboboboboboboboboobobboboobboboboboboboboboboboboboboboobboboobboobbobo

ω ω ω ω ω ω ω ω ω ω ω ω co ω ω ω ω ω ω ω ω co ω ω co ω ω ω ω ω ω co co io ω ω co co ω ω co ω ω co ω co ω to ω u oi oi oi oi oi oi cn cn cJi cn cn cΛ cn cn cΛ oi cn oi cn cΛ cn cΛ cn cΛ Oi c cn cn - - co co co to oo oo OD CB p QJ Oo oo oo co vi vi vi vi vi vi vi vi vi vi cn in cn cn cn cn cn cn cn cn cn oi oi oi oi oi en en en oi ω N) ^ 0 (O CO ffi θi 4k ω N) ^ 0 (0 ∞ Q Cn 4k ω N) ^ 0 (θ α M O) Ol k ω r -' 0 (00} M σ) Cn k co to -- o 2 to2 oo2 vi2 oo2 en2

OOOOOOOOOOCD ≥^≥≥ >≥>r ^WffiWWMWrrrrrrrrrooooθ < < > > z z z z z z Z<-<-< oonn„QOOO O^S^ ]P.SWWWWW(flC0WM ccCCCCCcrr

4k k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k 4k k 4k 4k 4k 4k k cn o cn cΛ cn cn cn cΛ cn cn cΛ cn cn cn oi oi cn cn cn cn cn cn cn cn cn cn tn cn w v| ovil v|i ovi| ovi| ovii o-vil cn en en cn c^ cn cn cn cn cn oι oι oι oi cn 4k 4k 4k k 4k 4k eo co co oo co co co eo eo to M M ro M M M

_ --k _ to tco co co co to cD co co co o o o co co oo p en vi vi co p co

→ ! → vi co — to b k 4k bo to 4k — o -k cn co o co co co eo ro ro oi 4k to o 4k vi oo oo cn eo ro 4k ro i o co en

k eo co co eo eo co co co 4k co co to co co co co co tO t 4k ro (θ θ c n σ) σ> co co -} to vi oo oo co oo to t-o- O CO O o cn co D too ieoo oiι e k — co - co co -- -vl i co ccp too troo '4" cn - oo oo v| CO oo cD co Qo co -- 4k cn eo co o co -k Co 00 {k _ 5 o cn co

-k

oi -k co S en eo — cn oo ro cn co vi o ro en co — co oo

ooooooooooooooooooooooo o o o o o oo oo o oooooooooooooo o o o o o oooooooooooooooooooooooooooooooooooooooooooooo oo co M s cn cn c)) s o) ro o) cn c (o o o (o oo s cn o) cn c cn co o) CJ) 0) cn cn tn c cn ro o vi oo 4k co co cD O vi ro o oo o eo o o oo en cn vi ro oo en oo cn o -k to v| vi co — oo o co oo oo - cn — ro o co oo vi ro oi ro -k co

4k p 4k cn cn co co -k ro eo eo — ro o o eo vi -k en eo en ro ro eo en o ro oo co oi vi cn o vi p co oi -k ro cn — 4k c c vi v| CO CO cn k co — k -k θo oo o vi oι eo co o o vi ro cD θi en θ vi oo en cn co eo -k to oι ro vi ro cn 4k O CO vl OO O O OO O -k vl vi to ro

ω ω ωω ωω ωύJ cwo ωω ωω ωwωu ωw ωuωω ωw ωω ωω ωω ωω ωω ωω ωω ωω ωw ωω ωω ω ω ω ω ω ω ω ω ω ω ω co ω ω co ω co co co ω u co ω co ω co

Sp 4kφ4kp4kecnoecnocconcenoεωncconcc —nocc —noee nocc —ooeM ~ncr —oncr oncr —oocr —oner ~oncr —oncr —oncι —oncr —one- n-ko _ —o->o- —oc_ —nc_ —ne — —nc _ —nc_ —nc_ nc_ —nc o —nco —nco —nco —nco —nco —nco —nco —n cn cn en cn en en en en

00 (0 (0 (0 (0 (0 (0 eoro~-o_eo3vicnenSeoto--0(ooovicnen4k_io-kococvicnen4kcoro--oo o co oo vi cn cn 4k

Z O P o p P O O O O O P P O Z O CD > B ~ m α o ro > ooooooozo O O O O O P P Z O P 2 σ O O D > > O O O CD >

_ o _ o ro ro > oo>z O O O O O O O O to — — _ ro ^ " ~ -% -% -v %0 r*0 Γ~fl Γ~o I~~0 Γ~0 Γ*2Q ~*_-:-:-- r---:--__Q_^x ^^^^^rrrFFrFrO_

CO ω C CO CO CO CΛ C C C C C C C C C mrπmmmmmm < 73x73x73x73x73x73i73r>rccJ> mmmrnmmmrπ

4k 4k 4k k 4k 4k 4k 4k k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k 4 4 4k 4 4k 4k k 4 k en en eo pω e έ k 4k 4 oo 4 ceno ccno eeno ceno ccno ccon rcon rcno cron eron eron eron eron rcon e-nk cn en cn cn en cn cn cn σj cn cΛ CJi cji c-n cn cn cjri cn cn cji en en en en en -> -k θ o o o o o o cD co co co co oo oo oo oo oo oo oo oo vi vi co to to co co co CD _ — _ to ___ —k co CO -k tO CD CO CO CO CD CO CD CO tO tO tO lD tD tD CO CD en en vl vi oo 00 CO o o o o o o eo o o o 00 to o o vi vi p ι oι ro co 4 4k cn c cD i go cn oo oo co cn cn oo oi to oo _ o CO en k ψ ' co vi _- oo en co eo 4k θo o σo 4k o co oo co co o o oo ~— v| en to 2 00 eo CO o o _ o o o k ro en eo 00 CO 00 to v| —k eo eo 85 CO ^k o ^k ro i b ^ o vi ^ vi to cn to ik c i to —- co to eo co c too oo -k 4 4kk cooo ccnn ccoo ccn 44kk c_n.> v -| -i, 4_k c-n,, cn 00 en o CO k ro -_. —_ oo co cn — oo vi co o ro CD ui en en en CD 4k 2 ro en ro o cn o oo to

Ol ro vl — eo 2 eo ιo ro ro co co eo eo ιo co co co eo co eo eo co r\) ro M M ro ιo ro eo ro eo co eo eo co co co to co co co co co co eo eo co co to co co eo co co eo ∞ vi co ro o p p p p ^ ω to ω ro ^ p p p p co p p p p p p ^ ro ro co p p p 4k p p p _vi vi cn oo co oo vi vi vi oo oo p b b o . b i k j r b ^ b r ω ω f k) ^ vi 4k — bι io io b co 4k i 4k io io ro in b bo o oι ca ro en e vj co ejι co vi oo c vi _k < co eo — co -* 4k CD - — eo vi en p o cn c vi oι oι oo o -k θ -k 4k o σ> co -k vi _ ro vi cn co en en cn oo θ 4k co ro o eo eo -vi oo oι ro eo -k eo co eo cn co oo oo co cn _2 v| CO O co oi oo vi oi oo oi o o oo ro vi vi ro cn o to c cnn e cnn e 0n1 c eno oi o cni o eni o eoi o 00i c -nk c -n cn tn oi oi oi oi oi oi oi oi cn cn e _n. c _n. cn cn cn cn σ> cn cn cn cn cn 4 4kk 4kk eOnl eOnl eOnl vvil oC0o cOnl oOιI cCOo 44kk CCOO 4 4kk 0000 vl vi t000 θ C0000000 C0 co o co eo co oo vi cn p en to -k to 00 - vl oι to ro oι 4k θι oo co ro 4k 4k O) co co 4k Oo co ro _ co co vi co oo -k ro o Jk ro eo co co eo cn 00 co o ro -- eo vi oo vi c_n e _n o _ o_ι 4k _i o _ι σ) ςo cn co en — eo o to en eo o — co _

o co ro k _ ro o 4k co co co oo co c —o o -o c -o- c-n c-o- C-D θ-o- 4-k k ro -vi

00000000000000000000000000000000000000000000000000 00000000000000000000000000000000000000000000000000

4k 4k to co ro co eo . 4k 01 4k eo co co co -vi co vi 501 o 01 vl b cp 4 eoio cn 0000 oo _ 4k — -vi co oo

en eo eo to to o en o en O en O

ω ω ω ω ω ωωω ω ω ω ω ωω ω ω ω ω ω ωω ω ω ω ω ω co ωω ω ω ω ω ω ωω ω co ω c ω co co co ω co ω co co ω cn cn en cn en cn cn en en cn cn p cn en en cn cn en cn cn cn en cn cn cn cn cn cn en cn en cn cn en cn en cn cn en cn en cn cn cn p p p co p p co cD co cD eoo ρ e m co cs oo oo oo oo v| vi vJ vi v| vi v| vj vi vi cn en ( en cn p cn cn (n cn cn cn oι oι oι (^ c M -* 0 (D OJ vi o eji S e M -k O (o oo vi e e 4 eo ro -k O (D oo vi en en 4k co M -k o co eo vi m

PZOPOZOOOOOOOOOOOZ o o o o o o o OOZZOZOOOO P P CO p p p > > x N m o rn o o ro > o σ O ro > X X N ΓΠ O O CD > r > o P ω O o CD > ro -- ro - m o oo p

m < 737373737373737373737373 -0 T3 -0 -O T3 -O -0 -O Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω Ω -HHHHHH HH W WCO COC

4k 4 4 4k 4k 4k 4k 4k 4 4k 4 4k 4 k 4k 4k 4k 4 4 4k 4k 4k 4 4k 4k 4 4k vi vi vi vi vi vi cn co cn cn cn cn cn en en cn en en en en cn ej. cn DO cn cn cn cn cn cn cn cn cn cn cn cn cn cn cn cn cn oo oo cn oo cn cn cn — -k O O O O Co co co cD co co co eo co co co co oo oo oo oo oo oo vi vi v| v| vi vi v| vi vi v| vi oo cn cn cn cn cn (-θ (-n oι oι oι oι θι

ro ro ro ro ro ro ro ro ro ro ro rro- r.o- to ω U M M rO NJ W W W M M M r O M M fO rO ro ro - K3 to ro o -k -- ro ro o o -k p vi vi pι o vi vi k cn e i e -vi ro eo en to to vi ω ro ro co 4k 4 4k 4k vi b b ι ro ι o —o ron ovioco e-n vθo vi θ όk| cvni __ co ol cn cn 4k ro - ro vi cn r to - CD O cn -k j co oo 4k vi oo o oo co vi cn en co 2 eo cn en en 4k o co vi _ en cn 4k co oo 4k 4k to eo en co cn cn σo cn _. _. „. en en l o i i p CO c0o0 vvil vil cn p p

". ω j-. , j_ io j ;. e u _-i _-, y,. — to— b_o i -n- v 4k v4k to :- b '->■

CO 8Cn? CO -k 4k cnn e con rσ _-i -v..i1 ee_o.- mc _n. 4k _ vi co co en co o co co o to oo

4s OO (0 (00 -) 0_ co oo o o O 4k CO CO CO

OO OO O OO OO O OOOOOO O O O OOOOO OOO OO OOOO O OOOOO O O OO OO O O O OO OOOOO OO OOO OOOOOO O OOOOOOOOO OOOOOOOOOO OOO O O OOOO O O O OO

4k en 4_k._k- e_k.k o- 4 v. 4 i_k.o. c v.i i.^.n o p _i o p__i o.i o -k p __i c o._n 4_k 4.k.4 i p_k_c n p_n_4_k_c r.o_co eo co 4k en en en o o o O (o po -vi cn co oo po cn en en en oι oi 4k 4k 4k CO p en eo ro Jk p o o oo - p -vl pi k o o ω k θ CO CO

CO 4k r i) b ^ b -^ -k i i ω ω 4k b M . cn b b b b ik ccoo icoo io co 'co ' 4k bo bi io bo 4k Kj vi vi 4 bo v| vl oi n -- — o ro -k θ -k θD cn to ro co 4k θ co cn -- cD θθ co o -k 00 Ol O O O O -* vi S oo vi oo vi to co cn co vi co — CO

eo eo co co co co eo co eo co co eo eo co co eo vi vi vi vi vi vi vi vi v| vi oo cn cn cn cn cn O O O O O O O O O O tO CD CO CO CD CO

co oo vi cn oι 4k co ro -k θ (θ oo vi cn tn 4k

O P P CΛ p p p O P P P Z OOOO OPZPPPPP o o o o o o z O O O z o O o P P O m o ro > CD > mO σP oP roP > N rn o o ro > o o ro > o ro > σ o o cα β ro — _ _ ro

OOOOOOOOOr r ^ C CC^^^^^^^^^rflrfif^r^^^ \ _} _q ] ϋ| Q] Q] ϋ| cccc ccc McoωwwoitΛωω jojoi joo ojj j j i α o

k 4k 4k 4k k 4k 4k 4. _k 4„k„ _k_ 4_k_ 4.k_ 4,k. 4__ 4_ 4.k. 4,k .k 4.k 4k 4k 4 4k 4k 4k 4 4k 4k k 4k 4k 4k 4k 4k 4 4k 4k 4 k 4 4k 4k 4k 4k 4k 4 4k 4k k 4k v| vl vl v| v| vl v v|t vv|l vv|l vvll vvll vvl| vv|l vv|l vvj| vvl| vvl| vv|l vvl| vl vl vl vl vl vl vl vl vl vl vl vl vi vl vi vl vl vl vl v vl| vv|l vvl| vvl| vvl| vvil vvll v| v| v| v| v| vl vj v| v| v| vl -M vi - cn- c-n e-n e-n c-n cn e-n en oι oι oι oι oi ϋi 4k 4k 4k 4k 4k 4k 4k 4k 4k eo co co co eo co co M ro ro ro ro -k to co co to — ' (0 (0 (0 (0 (0 (0 (0 (0 (0 k O O O Q O o o o o o o o o o oo eo eo o o o o p o o o o o p o o o o o o c cn cn cn cn eji eo c- to o -- -- r "o ro i0 0 _- o — o ro ro 4k C v| v| Ol l 4k 2 o o o co o co oo oo en vi oo vi cn vi co co ro co -k to -k o o to P 'vi to isj bo ro 4k cn c 4k b ω b b M b vi j M w cn r j vi ro b -vi en 4 ro ro -vi ro -- ro co oo -k cn cn 4k oo o cD -- ro -k -P -- c e -M ^ co ιo 4k co 4k p en cn o -- vi vi cn (D 4k ro vi __ oι ro cn -- j o 4 co vi o n — oo co ρ c o co (o oo -n 4k k i i to 4 en o to eo co eo vi -- vi co cn vi co cn 4- o o -- -^ ro co 4k — — c cn o en eo co o o o co k θ — co to ro ro ro ro ro ro ro ro ro ro ro io ro ro M

CO CO tO vl O0 Ol 4k 4k 4k 4k Cn 4k CO — K5 CO 0-0 oo co 4k vi co σo eo oo ro .-- 4k o r roo 44 ' eo cn eo 4k p o gι eθ 4 "k 2 k b 4-k oo o∞ ooo tP coo oP ooo 4 v| vi co oo co n o oi o en oo o en -k cn 2k θ co co en

c .n1 e rvn. c *—n . cn . c .—n . cnn c mn e inn e _n-l cn coo coo cn cn cn en en co coo vl 00 O O CO OO CO vl oι oi 4- co ro co co p o -k

-* to eo 4k to -vi en cω ffip σin) to to |ooj b rj b i co — ro o oo vi oo oo 4k oi ro ro oo eo o ro en vi vi cn oo

-k CO 4k CD — ro oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

4k

U ω 4k

3744 N ALA 478 105.617 22.580 58.948 1.00 44.29

3745 CA ALA 478 106.146 21.262 58.617 1.00 43.92

3746 CB ALA 478 105.808 20.264 59.716 1.00 37.80

3747 C ALA 478 105.601 20.782 57.272 1.00 43.29

3748 0 ALA 478 106.312 20.127 56.509 1.00 44.64

3749 N LYS 479 104.346 21.116 56.981 1.00 45.34

3750 CA LYS 479 103.736 20.720 55.715 1.00 50.82

3751 CB LYS 479 102.214 20.847 55.762 1.00 57.75

3752 CG LYS 479 101.555 20.268 54.522 1.00 65.44

3753 CD LYS 479 100.167 20.814 54.286 1.00 68.93

3754 CE LYS 479 99.651 20.332 52.943 1.00 68.91

3755 NZ LYS 479 98.384 20.999 52.566 1.00 74.62

3756 C LYS 479 104.283 21.581 54.581 1.00 47.22

3757 0 LYS 479 104.451 21.109 53.455 1.00 50.00

3758 N PHE 480 104.526 22.854 54.878 1.00 43.15

3759 CA PHE 480 105.076 23.776 53.894 1.00 41.41

3760 CB PHE 480 105.089 25.204 54.443 1.00 41.63

3761 CG PHE 480 103.894 26.021 54.033 1.00 44.23

3762 CD1 PHE 480 102.638 25.432 53.905 1.00 41.42

3763 CD2 PHE 480 104.026 27.379 53.756 1.00 39.25

3764 CE1 PHE 480 101.535 26.182 53.503 1.00 36.23

3765 CE2 PHE 480 102.929 28.136 53.353 1.00 32.42

3766 CZ PHE 480 101.682 27.536 53.227 1.00 29.83

3767 C PHE 480 106.485 23.334 53.515 1.00 41.98

3768 0 PHE 480 106.881 23.434 52.353 1.00 37.95

3769 N GLN 481 107.229 22.824 54.495 1.00 41.79

3770 CA GLN 481 108.585 22.342 54.256 1.00 41.10

3771 CB GLN 481 109.236 21.868 55.559 1.00 39.98

3772 CG GLN 481 109.603 22.993 56.513 1.00 47.39

3773 CD GLN 481 110.507 24.034 55.870 1.00 56.58

3774 0E1 GLN 481 111.605 23.720 55.406 1.00 55.49

3775 NE2 GLN 481 110.042 25.279 55.834 1.00 58.30

3776 C GLN 481 108.553 21.204 53.245 1.00 38.69

3777 0 GLN 481 109.386 21.146 52.340 1.00 37.55

3778 N ASN 482 107.564 20.324 53.391 1.00 35.14

3779 CA ASN 482 107.394 19.189 52.491 1.00 35.59

3780 CB ASN 482 106.302 18.250 53.009 1.00 41.18

3781 CG ASN 482 106.647 17.642 54.355 1.00 52.28

3782 0D1 ASN 482 107.756 17.148 54.560 1.00 53.57

3783 ND2 ASN 482 105.697 17.678 55.282 1.00 61.08

3784 C ASN 482 107.057 19.657 51.081 1.00 32.00

3785 0 ASN 482 107.358 18.971 50.105 1.00 35.80

3786 N MET 483 106.421 20.822 50.981 1.00 30.00

3787 CA MET 483 106.063 21.391 49.687 1.00 29.42

3788 CB MET 483 105.092 22.562 49.855 1.00 33.61

3789 CG MET 483 103.693 22.173 50.303 1.00 33.22

3790 SD MET 483 102.589 23.605 50.374 1.00 34.18

3791 CE MET 483 102.294 23.881 48.638 1.00 31.57

3792 C MET 483 107.330 21.870 48.991 1.00 26.58

3793 0 MET 483 107.453 21.778 47.769 1.00 26.98

ωωcoωωco coωωωcoωωωωωωωcoωωωu ωcocouω ωωωωωωu ωωωcoco uco

Sφ όoooooω αooω mrφoo co oocoosoo α ooαωco m 4- 4k 4 to to to ro ro ro ro roro to to ro -k — — _ __ __ _ _ _ _ o o o o o p o o o o co co co co co co eco o -kθcooo

ωcn vi c cn 4keoM θcDθθ vicncn 4kco ro-k θ cvic oι 4k Co ro -k oo

ZOOZ NP rnPπ oPα ΩPm roP oooopooo O o o P z

Nm k >ZOOPτ XrONONZmOoOr m > D > ro coπOr m OOOZOOOOZOOO ΩO ΩO roO > rn m o o co toπOp _ rooro> CD> ro — to -

OpOOPOO(7)0> >>>

CCCC CCC

4k 4 4 4k 4k . 44k- 44_k 4k 4k 4k 4k 4k 4k k 4k 4k 4 4k 4 4k 4k 4k 4k 4k 4k k 4k 4k 4k k 4k 4k 4k 4k 4k 4k 4k 4 4 4 4k 4 4 4k k co m n o oo ooooφtt c- α co oo oo t θ) c. cβc. αc- oo oo tt o — co " co " io eo

e oo e oo oo cβ α) θo cD C oo co co co vi vi vi v| vi cn cn o en cn en cn en oι cn

-k O O O O O oroιoo __ __ o _-ιoro 4k eoviviooen 4k coenen4kcoco-k p co eo eo p co k ik bb ώ bi io cobo bi eo eo o cn ρ eo -k vi oι oι eo -k vi -- oo r 4 b 4k b -k co cn cn ro cncn — o ro o -k vi co S ro c -o. c _o c _o o .o. o .o ro co oo cn ro r too o eni c coo o coo eno --δ) -k θo en o ~o ro cn ro ro oo cn ro o-o oo en c-n cn cD' -k ro eo 4k o

ro ro ro ro ro ro to ro ro ro ro to ro ro ro to ro — -k o ro ro ro ro to ro

00 o v| CO 4k _o 4k Co ro ro co ro -k O O O — ~- ro — o oo co vi vi oo oo oo oo oo oo cn vi oo oo co o -k -k co ro to eo v| CO CO 4k co vi oo cn eo oo en oo oi ecn cooo ceoo -k oo 4k 4k cn — oo co ro ro vi 4k oo -k vi oo co eo co cn vi oo cn cD eo eo CO vl co o oo o co δ p io oi tk o gi o 4k cn o o 4 o -k — cn co -k Oo co cD vi oo eo 2 o

00 vi -- oo vi cn cn vi cn 4k -- O0 -- CO — o co ro ro co ro co co o ro cn ro cn vi co co ro o co vi co co en co ro 4k _ vi oo o ro 4k vi 4k θo

4k 4k 4k 4k 4k 4 4k 4 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4 4k 4k 4jk 4k 4 4k k 4 k 4k 4k k 4 4k 4 4 en

-k — ro p vi co p k to 4k co p 4k co cn vi vj 4 cn oi cn cn 4 en to en en en en en pi cn en vi oo cn vi vi vi to ' o o o p Q b 4k to cn co vi k 4k w r P P e_> b b 2 ro to - o eo co v| co o p p -> o _i ωi 4 i i ^- i t f vi bo io fo vi oo en eo 4k — co vi c ro — o co co oo oo ro oo Qo vi o cp cn o ro eo vi co — 4k 4k -- o en ro cD O -' OO o o en -k CD vi co vi _ ro cn co o cn vi oo vi eo o cn vi 4k cn cn en cn o cn oo 4k eo ro 4^ -- o 00 C000 vl 00 -- v| C0 CD C04k 4k r0 4k r0 00 r0 C0 C0 -k 4k vi vi ro co -k to oooooooooooooooooooooooooooooooooooooooooooooooooo ooσooooooooooooooooooooooooooooooooooooooooooooooo

— ro -k -■ _ _ _ _ _ _k _ _ _ ro _ vi vi cn en ro ro -k -k -k -k ro ro o vi p ro vi ro v| o p 4_ to 4k ro ro vi ω ro i to k> ro o r b b to kj ∞ vi to 4k c

4 4k to oo 4k 4k 4k to o eo 4k vi ro oo co

_- io vi 4k o eo 4k ro c 4k CD vi 4k ro co oo co ro oo co co oo oo 4k

ωω ω ω ω ω u ωω ω ωωωω ωω ω u ω ωω ω u ωωω ωco ω co u ωω ω ω ω c co ω to ω cou co coco co co . ω efi oo oo oo oo n ω oo o- ά α oo oo oo ( ω oo co oo Q> c. oo oo α

(D co co co oo cβ e S oo e c oo eβ oo vi v| v| v| vi v| vj v| vi v4 en en cn cn cn p en <n en OT co M -- o co to vi c cΛ ^ ω M -- o cD oo vi cn cΛ 4k c M -- o ω cB vi OT c 4k ω r -k θ co c

P oP oP oP roP >ZOOO oOoOOOZOOO > ooooooooz o o o P P P P P P

B ~~ m o o ro > oo z o S o D ro > O O O D > ro -- ro -koro> IO —k O o Ω

— _ O ro > O P O O P P o ro ro -k ι— r— r— r—r— ι— i—r— r— ι— r— ι— ι— r-pQppppppppppQ>>>>>>>>FFFFFFFF>>>>>>> c c c c c c c c c c c c c c -<-<-<-< c c c c c c c c c z z z z z z z z ' ' TJ TJ TJ TJ TJ TJ J

k 4 k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k 4k 4k k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4 4k 4k 4k 4k 4 k 4k 4k 4k k 4k 4k to to cθ P cθ P cθ eθ (O P cθ CO (D P p P p CO CO (O P (0 (D (O CD (0 (O CD CD CO CD CO (D CO CD CD CO CO CD CO (D CD tO CO CO CO (O CO CO c35 i)o cn cn en en en en cn en cn en en eji 4k 4k 4k 4k eo eo co eo eo eo eo eo co ro M M M ro ro to io

k _ _ _ _ _ _ _ _ _ _ _k _ _ _ _k _k O O O O -k o p vi vi _vi vi -k - vi b b o o j r vi vi to to eΛ p o p M 010 * vl u) ffl plOI M CO k co 4k cn o ro cn co cn c 4 θi vi co

^ -k -k — -k - -k to o ro ro o ro ro ro -k -k - - -k -k -k

4 p 4k 4k vi Kro o - _k — _ _ k p (0 o co vl C 4k 4k 4k Cn Cn v| v| v| v| (O 00 v| p p ρ p 4k Co ro ro -- o cD p co vi p co p

_ ro 4k vi to o to ro o vi cp i 4k C o ι ι vi r'o co oi -k c ono ceDD 44kk __ o 4k θi o σ co ro ro p ro co ro oo -k _ co 4k in o c in en vi ro cn eo en ω vi en oo ρ oo K en o eo ro -- __ oo vi QO k o o —o ro ro o -ι cn ro en oo en ro eo -k S o -k ro vi oo 4k 4k o to -k o 4k — _

-k co oι o -k -- oo co 4k. — co ro co vi ro eo ro oo vi 4k en oi eo — (O O vi vi _ 4k — ro o to vi ro vi cD — o co co en co ro -k co oo k cn C0 4k 4k 4k 4k C0 4k CO C0 4k 4k 4k 4k 4k p ro -k p o co p oo p ro o o p p i b i b vi b cn b i b ώ b vi cρ o oι en co ro ro en ro en p o cxι

co -vi to oo cn co co cn en o

OOOOOOOOOOOO OOOOOO _ OO_ O_ O_ O_ ooooooo ooooooooooooooooo o- o- o- o- σo_ oooooooo ooooooooooooooooooo ooooooooooooooooooo

- - f ro ro _ _ _ _ ro co co co -- — _v _ ro -k -k _k _ -. -k to to ro -k -- en ro ρ rk p - js _-. ro ceoo eρn co en p p 4k en to to -k o vi 4k en vi — co o co ro

2 b c ^ o b o c o o b o b b i i vi _ l-k eo b b e |k w 3 vi i eo — to 4k vi Ko vi _ iβ bι

001 v| _ _ CO v| 4k O vi cn o C (D _ — tO lD o 4k" oo 2 o eo co - o co o o o eo co o vi ro co -k CD o oo (o oo o co vi oo co o

ω ω u ω ω ω ω ω ω ω ω ω ω ω ωω ω ω ω ω ω ω ω ω to co ω co co ω co ω co ω co ω ω co ω to co ω co ω ω co ω ω ω ω

(p( b φ (O CO(0 (0 (0(0 (0 (0 (0 (D (0 (0 (0 (D(0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (O Φ (O Φ

( ( ( ( U U U u u u ) U UU M N rJ NI K)N rO N M o o o - o o o o - u O O O O O O O O O . _ O IO _ (0 eo ro -k o co c vi c cΛ c f o o co c vi cn cΛ 4 c ro o o co c vi cn cji 4k C ro -k θ co oo vi c cn 4k

P P O O O O O O O O O O O Z O O O O O O o o o o o o Z o O O O O O Z O O z z O z o o o o r > O P CD > pro > ooo Ω CD > O X X N ro -k o ro > α o o ro > ro — ro - m o o co >

H H Hω ω ω CO CΛ ω < < < < < TJ TJ TJ TJ > > > > > > > > > > > r; xx xm m mmmm> > > > > Λ JΛ i 73 π Λ Λ ?J ) i π π 3 m m

?. 1 ΛΛΛ7]Λ 3ujrr r

OOOOO -)OOC)0 -)000 c c

oi en cnen en en cn enenen cn en CΛ Cn CJl CΛ C CΛ Cn c Cn C 4k 4 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4 4k 4k 4 k k k 4 o coeoooeooroororoorooorooroo-k o-k o-_ 8 O O O O O O O O O O Cθ P (D (0 (0 (O CD CD CO CO (O CO CO CO (O CD CO CD CO (D CO CD CD CD CO CO CO — -k _ O O O O O O O CD C0 (D (0 eD CO e0 C 00 CX> C03000000 vl v| vl vl v| v| v| v| v| v| v| cn C0

ro ____k.____-k_______rorororo to ω vi oo co oo oo cn cn oι co ro co 4k co ro ro -- o -k ro ro k 4 4k Oi p 4k 4k 4 p 4k p p ro -k ro v| v| cn p

O _ v| CeoO v|, 4.k o-o 2 en vioo4kθococn — cn cn oo co 4 co ω o b in ι to bo in in -k co 4k 4k o oo co cn o en 00 -k to oo CO v| m co cn P vi cή vi -- ro vo| eon con o-voi o vi 4k bι co bo . —o oo co ro oo to co -k to vi o ro cn - ςp cn v| CO oo cn vi to vi co ro en oo to o en o -k (0 (o o co ro co cD 2 o eo cn 5v| p o eo oo co oi co -k — 4k tO O C0 0001 00 C0 4-k en cn o - to

M M io to ro ro ro ro ro ro ro io ro ro to ro ro rso ro ro ro ro ro ro ro — ro ro eo 4k 4k en en c oi 4k 4k co 4k en c oι 4k co eo to ro -k — p - p - p - p — p — p - p - p p v| v| 4k pι p p 4k CO 4k σ)p)σi<jιcnσ)cncncna>σ) co to ro oo θ 4k oo oo co - -k cn — vi _ M o e o co 4 v| i ro ro Qo vi k ι ro en o oo 4k ώ c bι to co b o '4k 4k ι oo co 4k θ θ cD o ro eo co 4k vi c 4k co cn o en p o vi p vi o o in eo vi _ co o o co v| oi vi — o co co o en en co -k o o vi -k O vi to -k — o co oi c cD e c -n -k g) _ vi e 4k e e c ι cn e -- cD 2 to ro -k ro to ro co oo co — oi vi vi oi co cn vi cn ik co vi

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo eo eo co eo eo en eo ro ro c ro ro ro ro ro ro to ro — - — _ co -- _ _ _ ro co ro ro -- ro ro ro ro ro co ro ro ro ro -k — -k — _ eo rθ - _-k O o v| ^ _v| _v| v| v| 4k p p 4k p vl en en to en to to l 4k Oo 4k ro ro 4k to ∞ vi i t i o vi k i vi to 4 in 4k -k b to ro o ^ 4 to o b bi ifl ro ioo ro oi bi in o co 4k i bi b co ro cn o en ejι en S cβ M en en o -- cβ co co 4k vi co 4k — cn en o vi cn en vi co ro 4k en oo co o oι ro oι σ> en co co co oo co ro o o oi 4k oo

ω co ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω ω u ω ω ω u ω ω ω ω ω ω co ω co co ω ω u co co ω

CO (O CO (D CO CO CD CO (D CO -0 (D (D (D (0 (0 (D (D (D (0 (D (D (D (D (D φ φ φ (0 (D O CD CO CO CO CO CO CO (O CO c co eMo coo oco cooo ecβ ovoi ocnp ocΛo ρ4k ρω er c-)-o <o-o cvoi ovoi vvii cvni vci v4i ωv| Mvi voi voi econ θcn3 evni eOTn ccn ρ4_ ecno

P P P O P P P P P O P P O P P O P P P P P P ZOPPPPPPPPP OPOOPPPPZOOPO o ro > O CD > O O O ro > σ o o ro > Nm ro ro — ro -- rom - o roo -ocα> mrπσocD> op ro - to _k

oiencnenencnenenenenencn S _.c _n.e _n cji en cn en en oi eji cn en en en cn en oi en en en en en en en en en cn en en eπ en en en en en en en en

O O O O O O O O O O O O O OO OO OO OO OO Q Q Q P Q Q p Q O O O O O O O O O O O p p p p p O O p p O O O O CO CO CO CO 000000 Ca 000000 vi vl vl v| v| v| vl en en en cn en en en en cn cn cn oι oι oι oι oι oι oι oι 4k 4k 4k 4k 4k 4k 4k 4k 4k co co co co

4k — ro ro to ro ro ro to -k to ro ro en cD ro -k ro -k -k O o to o — o vl 4k oo p vi co co en co -k co vi 4k cn co 4k vi oi co cn cn -i -k co

i σ ro co co en — cD cn to oo ro r to M M Co co eo co co co ro M M ro ro M i M ro to

-O -o p o __ _. p p -vl vl v| v| oo4k ωu ∞ ιt ii cn (θ θoo oo oo oo o vvii oo π M (bθ θo en co co oo k — cn en - ca M io io co eo o -k ro co en o -- M io cn cD O O vi _ 4k 4k c c -- o cn en

eo co eo co co eo co co eo eo eo co co eo co c co co eo co co co eo co eo co eo M M M M M M co to co eo ro ro ro ro ro ro ro co co co ro vi p vi p p p 4k i co cn vi cn cn co 4k cn en _k _ _ ro co -k _ — en en en vi en vi co o to o o p αo oo co p co -k o — p ι in 4k ι b ώ cn bo to i o — to co vi in eo ro eo en vi m o e)o e)o eo en vi cn c en vi co -k en oo o vi vi co -k -- 44kk rroo to — 4k vi ω o cn Q) U) Co ro cn oo 4k θ) ω uι σ) vj in en e w ro oo o co o ~ co cn vi vi cn -k θι 4k en oo cn δ> 4k ro vi e ro — 2 M CD ro oi -k M φ c k co o cn cn ro en co ro co oo n ιo 8n2 n co oi - ω θ (θ θ) oo (θ δ oo cn t -k is) co θ) θ) oi vi co co co oι co jk ' CO ^ o ro oo -k oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo

_ _ _ _ _ -_k t roo -- -k _ - ro ro ro -k — — — — ro ro -k ro ro ro -k -k -k -k t roo tcoo co co ro -k ro ro -k ro co 4k p p vi ro o vi ^ p ro o p vi p p -_ p p p 4 p oi oo 4k 0 " 4 *k oo cn cn cn -k -k vi cn co oo o bo in bo b - '>■ o ) b i b k ro o b k 4 b4k b b vi vi -. o o ro ro vi en eo cn -k 4k co 4 co cn o ro cn eo o CD o S eo oo cn en cn cn vi vi ce oo o cn ^ en eo vi eo e ro ro 4k cn o vi cn vi _. en cn cn cn co oo 4k cn O vl CO Ol 4k

k k 4k 4k 4k k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4 4kk 4k 4_ 4k 4k 4k 4k 4k 4_ _ 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k CO CO CO CO CO CO p p p p o o o o o o o o o o o o o o o o o o oO O O O O O O O O O O O O O O O O O O O O O CO CD CO CO CO CO 4k 4^ 4k k co co co co co co co ω ω co to ro to to ro ro ro ro r "o " tO __ _ _ k _ — — k _ _ _ o O O O O O O O O O CO CD CO CO CO CD co ro -k θ CD co vi co en 4k co ro -k θ co cD vi cn cn 4k co ro -k o eD oo vi cn cn 4k eo ro -k o cD oo -vi cn en 4k eo ro -k O (o oo vi o en 4k

P P P P P Z O O Z Z P Z P P P P o P P P z p p p p p p O O O D > X X N — _k ro to o m o o ro > ro > o o O P o t o o ro > z o o z o P P o o o o P ro ro > O P P o P P P P _ to α — o ro > O Ω f_: = — m m m m m m m

mmmrmπ

Ol OI Ol Ol OI OI OI Ol Ol Ol OI OI OI OI Ol OI Ol Ol OI OI OI OI OI OI OI Ol Ol OI OI OI OI Ol Ol Ol Ol OI OI OI Ol Ol ϋl Ol Ol Ol Ol Ol Ol Ol Ol Ol _ _ _ _ _ _ _ _ _ _ _ _ _ _ _k _ _ _ _ _ _ _ _ _ _ _ _ _ _ --k _ _ _ _ _ _ _ _ _ _ _ _ _ --_ _ _ o θ O O

C e en ι oι oι 4k 4k 4 4k 4k 4 4k 4k 4k 4k 4k co co c co co ιo ro ro ro ro ro ro to -k -k _ -- _-, _ _ _ o o o o o o o o co co co co

. to to to to ro to -v ro ro o _ ro -k _ _k _ _ _ _ _ _

CO CO tO OO CO OO CO CO Is co t o -* 00 (0 o o co oo co p p p p vi co tn cn ro co jo w to vi b to oι o to 'o o to en "4 i b tn to 4k vi bo b ro ' vl 'k co ω cn eo vi cn en ro co ro p o o fo to ro o en J- o eo p * c _n. 4.k oo vi co co cn oo ro o-o 4k vi ro ro oo co o vi _k 4k _ _ ro o co vi co co ro eo 4k θo

vi vi vi oo o co v| o co v| o o CO -k co

2 co eo co ω uω ω i N) N r rs1 rV) rV) rO K) N N) M rs) N} ω U CO U ω U U ω U eo en co r o p p ^ ρ v| vi o p p p vi p o __ jk ω ω ro o _k o p p p p vi vi ^ 4k CΛ e c vi cD ∞ tn oi b j t in rro bo o l- ω ii vi - j όo bo i ca i to vi b eo io o co b b i ω ro co O i co ω CO 4 v4k icn p oι S ω ω j rό J> ω i cn 5 M o rj) oo oo rθ o ω ω ω (ι o o (θ (o oι i (o o eo 4k v e oni v| o cn ^ e 4 eo o (D 4k 4k (D vi M e en 4k M e e en ι vi oo oo o c e 4k co en o cn vi 4 c co vi c ω

4 Mk U4k α4k p4ki 4k C04k CO Co eo cO CO CO CO C o _ M o c p 4k

OO O o 4_ v|

C Cn CO b ObObOObbObObOObbObObObObObObOObbObObObObObObObObObOObbObObObObObOObbObObObObObObObOObObbObObObObObO t _ r -- ro o _ _ _k _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ r -k _k _ _ _ --. _ _. __ _, _ ro p ρ ρ ω ρ vi ^ ^ vi ^ ro p p ro ro ro ω ω v| o o ι 4k io co o (-o ω o co o OT b i i vi ω cΛ C ia i ^ in — b o αi ^ i i to vi b b b b vi vi e b w

„ rO O O O) (0 ^ 0 ( _ U u) 00) 001 o uθ) 4.4 lk O O _ 01 tθ ω S U O O) 01 _ S ω θ o U

4k 4k 4k k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4 4k 4 4k 4 4k 4k 4 O O o o o o o o o o o o o o o o o o o o o o o o o o o o o o pooooooopopooopopooooooo _ oooo _ oo _oo _ oo _poo CO CD cD co coo c c oo co oo oo oo α> oo v| v| vj vi vi v| vi v| vi vi cn en en cn cn ρ cn cn en en cn cn cn en cn cn oi ϋi oι oι 4^ CO to o O - C —O 0 —0 vl ^ oi 4 Co ro θ (o oo vi cn oi 4 c ro o eo cn vi e c 4 co M o co oo vi c en 4 Co ro o o co oo 2 o o

OO Ol

r- I— r- r- r- V _HH_H→H=J=-^^^^^^< OOOOOOOP<<<<<< m rn m m m m XXXXXXX>>>>>>>r-r-r-r-r-r-r-r-r-> >>>>

73737373737373737373737373737373737373 r- r- t- r- r- r- r- rZ rZ Z rZ rZ C- rZ r-: rZ r- r- t- r- r- r- m rn

oi oi oi oi oi oi oi oi oi oi cn en en cn en en oi cn oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi en en en ro M io M io M M ro ro M io ro ιo ro ιo ιo ro ιo o _ _ _ _ _ -k _ _ — _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ o _ _ _ _ _ 0 O 0000 0 O 00 O 0 C0 (0 (D (0 (0 (0 (0 ∞ ∞ ∞ ∞ ∞ C v| v| v| vi v| vl v| vl vl OT 00 Cn θ

to ro to ro _ _k __ _-. _ _ _-. _ _ _ ro ro ro ro ro -k _ _ _k _ _ _ _k to _ o co p p vi to ro ro eo eo 4k 4k oi en vi oo oo vi oo oo oo eo o o IS ro o o co oo oo oi cn en cn vi vi 4 p 4k θi ∞ p cn to to en g io io p o vi cn ro v ■i ■M O Jk rO o O ϋl OO όo 4 _ ^ bo ω o 4k 4 ro 4k θι ώ o 4k b r v| o 4k cn oo to o co cn co ϋi co -vi en oι co o en o vi _ oo oo r coo c eon c on oo ro ε co oo oι cn en cn co ro ro 4 4k θ -k cn vi oo

00 _ v| 0 v| cn v| 00 C0 v| _2 vi ro 2 to oo ιo o vi cn cn 4k 4k en vi o co oi vi oi vi oo oo o co cn co ro co co 4k 4k 4k 4k en co i en

oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo

-k co co co 4k co 4k eo co c ro co eo ro to co co co ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro ro co 4k oo ιo eo 4k cD _ vi oo 4_ ro o 4k vi ro oι 4 to ro ro ro ro ro ro ro ro to ro ro p 4k p to p p p ro p 4k p ω 4k to to ρ c o en vi 4k to -- ro o to vi ro co -k (O Oi to in to en "4k b b cβ to cβ in eo ro 4k 4k _ 4k io 4k ro 4k ro b io 4k 4k — 4k to 4k to io io co to CO IO 4k o co o (D vi c en o ro cn vi c 4k θ c vi c 4 en oo c 4k θ 4k M eo M i en eo c e oo oo vi 2 io 4k to b to in vi cn oo 4k 4k eo o o oo co

k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k k 4k 4 k k

4k 4k 4k 4k C C CO CO eo tO eo eo eo co ro ro ro ro to to ro ro ro ro o _ _ _ _-. o _ _ _ _ _ _ o θ O O O O

O p O O O O O O O O CD CO CO CO CO tO co ro o o co oo vi co oi 4 co ro o o cD oo vi en en 4k eo ro o o cD θo vi cn en 4k co ro o o co oo vi cn en co ro o o co oo vi cn en 4k x O

HHHHHHHHHHOOOO>>>>>>>>CCEC>>>> >>>>=C _X XX XXX XXFF )πΛΛΛΛ3J3Λ^-<-<-<-<T) TJTJT)τ^-nCCCCCCCC^ z-z-^z?z?z-z'^z-z='w c/ CO CΛ ω tΛ W t', W CΛ Iu ri1

(Λ en en oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi oi en cn cjn cn cΛ en cn en en en cΛ CJi cji C-n cn cji cn en cjn cji O M M M ro M l o M I M M M M M ro r KO M M M M M M r M ro M M IO M vi vi vi vi vi vi vj v| v| vi cn en cn cn cn en e cn oι oι oι oι 4 4k 4k 4k 4k 4k 4k 4 eo co co c eo c eo eo M ro ro M io M to M r M

k — _ _ ._ __ o __ __ __ _ _ _ _ _ _ _ _ _ _ _ _ _ _ ro M io ro ro -k --k _ _k __ 0 oι oι 4k 4k cn cn cjι cn cn cn oo vi -vi co cn cn ω r r 4k 4 4 4k vi p p 4k ω 4k ro ro ro 4 4k vi ro r- ro o co p co fo cn cn o co cn p cn c p p i rθ vi *. co e p (θ o __ vi e p o p o eo k θ co ro ix io bo o _ bo oι b co bι in ' en co c cD Co n 4 o o 4k 4k e co e 4k c e k oo o en ro eh 4k 4 4k e o c c eo ro oo o vi cn o o cn en to o ro vl O CO 4k 2 to ro o cn eo o to oo vi vi oo o vi co co oo o o _k vi o cn o cn ro vi oι oι oι ro o 4_ _ oo vi co o o cn co oo ro oo o O 4k 2 O CO 2

4k 4k 4k 4k 4k 4k 4k 4k CO CO CO CO C0 4k CO CO CO CO CO CO CO CO CO CO CO CO co co co co eo eo co eo eo eo eo co eo eo ro ro o -_ o o co oo oo co oo o co co eo oo vi oι cn cn (n cn cn en 2 eo co co co co co ro co co co o o o o o _-, ro o ro o _ co ro ro -k _k co o

4k bioio iowro 'o ro b invi in b vi b io ro bb ro toro o io vi roin o 4^ M <oo vi co vi eo(o cn eB OtD co to 4k cn vi vi o oio vi o co cn 4k p ro vi 4 CB i o co o M vi o o vi co M o co c^

OaUMWCUI (Du1 u1N) v|OimOO) O)OO tnO) 4v O u1 Uvl kU v|m O) O O u1 (OM 2

4k 4k 4k 4k 4k 4k 4k cn c e c oi cn vi vi p ro ω n vi to _o in 4k bι in vi bι io io cn oo o c co 4k o ω vi _k

00 vl vi 4k θo co oo cn ro 4k ro co

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo o o o o o o o o o o en cn CΛ cn oι oι oι oι oι oi cn cjι cn en cn c-n en en -vi p p p p vi p p o p p p p p p

-k in „. o τ k. 4k i b b b in co eo v -vii v vii coo c oni e en o > c en M co en cn ro

44114444 CC TYR 527 116.266 42.524 52.517 1.00 58.54

4 4114455 O 0 TYR 527 1 16.862 43.593 52.342 1.00 58.64

4 4114466 N N THR 528 115.271 42.383 53.386 1.00 59.24

4 4114477 C CAA THR 528 1 14.855 43.486 54.238 1.00 59.20

4 4114488 C CBB THR 528 1 13.447 43.253 54.836 1.00 54.20

4 4114499 O OGG11 THR 528 1 12.504 43.053 53.776 1.00 47.41

4150 CG2 THR 528 113.010 44.458 55.655 1.00 54.59

4151 C T THHRR 528 1 15.887 43.653 55.356 1.00 60.28

4152 0 T THHRR 528 116.168 44.773 55.787 1.00 63.64

4153 N H HIISS 529 1 16.464 42.533 55.792 1.00 61.45

4154 CA H HIISS 529 117.484 42.512 56.842 1.00 66.52

4155 CB H HIISS 529 116.984 41.721 58.060 1.00 66.73

4156 CG H HIISS 529 115.652 42.169 58.576 1.00 71.41

4157 CD2 H HIISS 529 115.119 43.407 58.721 1.00 72.13

4158 ND1 H HIISS 529 114.688 41.286 59.010 1.00 74.46

4159 CE1 H HIISS 529 113.618 41.958 59.398 1.00 72.55

4160 NE2 H HIISS 529 113.856 43.248 59.232 1.00 70.77

4161 C H HIISS 529 118.743 41.844 56.273 1.00 66.01

4162 0 H HIISS 529 119.005 40.665 56.528 1.00 68.54

4163 N P PRROO 530 119.540 42.598 55.492 1.00 63.94

4164 CD P PRROO 530 119.254 43.981 55.082 1.00 59.34

4165 CA P PRROO 530 120.778 42.128 54.856 1.00 66.66

4166 CB P PRROO 530 121.137 43.284 53.914 1.00 62.98

4167 CG P PRROO 530 119.837 44.009 53.711 1.00 59.02 4 4116688 C C P PRROO 530 121.952 41.819 55.784 1.00 70.87 4 4116699 0 O P PRROO 530 122.567 40.757 55.682 1.00 73.58

4170 N GLU 531 122.248 42.762 56.676 1.00 73.21

4171 CA GLU 531 123.365 42.683 57.621 1.00 73.20

4172 CB GLU 531 123.107 43.597 58.822 1.00 75.84

4173 CG GLU 531 124.335 43.811 59.703 1.00 84.33

4174 CD GLU 531 124.108 44.832 60.799 1.00 87.41

4175 OE1 GLU 531 123.904 46.021 60.474 1.00 95.89

4176 OE2 GLU 531 124.142 44.446 61.986 1.00 83.48

4177 C GLU 531 123.843 41.312 58.106 1.00 71.16

4178 O GLU 531 125.042 41.026 58.066 1.00 69.83

4179 N GLU 532 122.923 40.470 58.563 1.00 69.84

4180 CA GLU 532 123.299 39.151 59.064 1.00 69.95

4181 CB GLU 532 122.239 38.621 60.028 1.00 76.12

4182 CG GLU 532 122.200 39.350 61.360 1.00 90.10

4183 CD GLU 532 121.231 38.719 62.343 1.00 99.66

4184 OE1 GLU 532 121.294 37.485 62.540 1.00 100.00

4185 OE2 GLU 532 120.407 39.460 62.922 1.00 100.00

4186 C GLU 532 123.601 38.095 58.006 1.00 65.98

4187 O GLU 532 124.484 37.257 58.202 1.00 65.68

4188 N VAL 533 122.878 38.136 56.891 1.00 60.94

4189 CA VAL 533 123.071 37.152 55.829 1.00 51.25

4190 CB VAL 533 121.727 36.491 55.419 1.00 57.84

4191 CG1 VAL 533 121.983 35.305 54.492 1.00 49.96

4192 CG2 VAL 533 120.942 36.054 56.655 1.00 58.45

4193 C VAL 533 123.741 37.704 54.574 1.00 44.33

4 k 4k 4k 4 4k 4k k 4 4 4k k 4k 4 k 4 k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4 4k 4k 4k M ro M ro ro to to ro ro ro ro ro ro ro ro to ro ro ro ro M ro M to ro ιo M ro ιo ro ιo ro M i ιo ro M M io M io ro ro -k _ _ _ _ _ 4k 4k 4k 4k co co co eo co e to eo eo eo o ro ro ιo ro io r .o - r .o_ ro ro o _- _-, _k _ _k _ _ _ _k D θ o o o ρ o o o o co to cD CD co co co ro o o co oo vi oo cn k eo ro o o eD oo vi en cn 4k Co ro o co oo v! co tn 4k co ro -k θ co oo vi cn cn 2 co to D co oo vi cn en 4k

P P P P P P O P P P P P P o o z P z p p p p zo o P P P P OPZPPPPP p p p p o p σ o o ro > o o o ro > O m m r > N rn o o ro >

— * N) o o o ro > _ ro o — ro IO o o oo o ro > o ro 0

FrrrrrrrrFFrrFrlIllIlIlII2^^^^^^! ; ;C ;!- C :! ! !;! !;C! C!;< mmmmmmmmmmmmmmmw ocow_o_o_o_ _o_ gg^

en UUωuuω U UrOt M IslrO Nr rOrOI r rJr N o ro o _- o o __ o oeo * c v| vico c _ CD cn c vi cn e e ooooθ (θ vi _o eo en vj oo vi oooo vi vi cn c^ i ω ω o ^ vi to viωω b 4 b i r i o _ω M tn co 4k 4k ro ro o cn cD cn co to 4k oi o co co c vi vi oo eocn o cn 4k θco eo o o vi _ cn eo c vi _ o oo co o _ vi tD o oo to M 4k eonι oo rroo oo ccnn eeoo ccnn cono cpn en cD en co co oo co ooo oenMMcncDO vienco vi c vi — ooo(O orotoo vico cocncnccnoce vien coM -k co co -k 4k -vi cn oo co o en 4k

4k k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k eo CO CO eo co co eo co eo co eo co co co eo eo 4k 4k 4k 4k 4 4 4 4k 4k CO CO to pp _ __ _ _k r_ ro o ro p co ppl v| v|ppp v| ppp _ p en eo co to o o O O O CO 00 l bk) bbbb4kb ιbbbt o b' vi _ _ bo 4k eβ b in ω vi to vi ro b io io co vi o o o ro to o ro oo ro ro vi ro p o 4k θi 4k vi S tocn o ro cn en _ vi p 4k o eo eo3cn cn eo v| c 4k oi CD Oo o _ co co vi co co oo vi - o co cn co 00 C0 4k CD 0 v| 01 r0 CD 00 r0 o vl C S03vl roeo rocn co ooen ro o o o ro ro oo to oo c -o vi co ro c _n t.o co cD .. α _o 2 4k cn vi vi co oo co ro o

82 ! 01 01 01 0l 4k 4k 4k 4k 4k 4k 4k en 4k 4k cn en en en en en en encn en oicn en cn en en en ecnn e cn cn cn cn cn cn oi co ro ro -k o oo co to co oo co co o p co ro io o -k o p o roro io pp 2 cn ro p p -vi vi cnn cn cn cn cn ι cfi 4kω o oρo -> i)w ω t io o cβ in b in ^ in robo in ro 2 4k to vi o 4k - o 4 to bo bo vi vi n cn b co co to oi eo coco eo o co o cn oi o cn o vi b o ro co en co b oo to o o 4- b ioboroio bo i

2 en cn pppeo to o gi o p e co Qo n ro 4k (o eo 4k vi co vi cn co en o oo ro o enco vioiroroooo vi coeoooocD o o o o en v _ioocooo Bcn 2oie _o.roc _ n nr _o oι co 4k o cnιoroco vi ι 4k O CD 004k rθ vl ol C0

OOOO O OO OO OOOOOOO OOO OOO OOOO OO O OO O O O O O OO O O O O O O O O OO O O OOOO O OOOO OOOOOOOOOO OOOOOOOO OO O O OO OO O OO O O O OO O OO O O O O r 4ok rooo cron rooo co rontoo _vi ro o(D vio oco 4k p eo cn oo vi o o O OO Oo Jk CO CO CO vl

4k 4k k 4 4k 4k 4 4k 4 k 4k k 4 4 4k 4k 4 4k 4k 4k 4k 4k 4k 4k k 4k 4k 4k 4k 4k 4 k 4k 4k 4k 4k 4k 4 4k 4 4 k 4k k 4k 4k k 4 4

N M I I r r M t r\) I K) I I N I r r K) M r r N) I M N rS) r M co co (D cDooooooooooα> oooo cooo vi v| v| v| v| vivi v| vivi cnen en enen cn cn cn cn cn cn cn oι oι oι oι o^ co ro o o - t o- o —ovi encn ^ C0M o 0 C000 v| 0) 0l 4k C0 M o 0 CD00 vl c c 4k C M o 0 CD ∞ vl cn cn 4k e M o 0 C0 C00 v| 0 0l 4

P P P O P O O P O O O O P P P P P P P P P P P P P P P P o P z o o p o O ro > ro> σ o O ro o o ro > O O σ P P r P > z o ro ro > to o ro o o oo o ro σ o o ro > o ro σ -k o ro >

FFFFWO Wtococo>>>>>>>><<<<<<<rrrrrrrrrrrrrrrr>> >>> > > >p mmmmnimmmmmwcoM_ococo- co>>>>>>>rnrnrnrnrnmrnm ^ ππ ^Λ ^ TI TJ TJ TJ TJTJ TJ Tj r- r- r-r- r-r- t-CCCCC C CC C C C C C C CC Z Z Z Z Z Z Z Z

22 to θ)θ 2C2θ)2cn2cn2c 2oι2t 2t 2k2k2222k2k242ω2ω2u2ω2ω2u2ω2M2M2r 2M2is2222222222222222222 l )M M ro - - o o o o o _ oo o oooo o to

4k 4k 4k C04k CO CO CO CO CO CO CO CO CO CO CO CO CO CO eoeo eo ro ro ro co co co eo co co roeo co eo co eoco co eo co co eo eo co o o oco o cocooo en vi vien vi v| vi cn cn enro wωto p vip p o _- ro ro ρ p p p o _k co ω ωro ω ro ω ro ω o ro cn oo oo S (θo en eι eoeoe o _ _ cD 4k enω 2vi 8vi-2k ro o v| v|toeoco vi p oι o cD en o eo vi co cD θ cDeo b bo o ro in en o en or co 4- cβ o _o oo3 θ & ocn en c (D e o vi 4kc vi to vi 4k ro oo oo o co to -vi c to o en _o co co oco eo - c "o — |3ooocDe coc e Me 4k coco coιo 4kroo o 4kM 4kM co(n occo c o c cD θo -vi oco oto croo oαoo cvoi co co eo co eo 4k 4k 4k 4k 4k k 4k 4k 4k 4k 4k 4k 4k k 4k 4 4k 4k 4k 4k 4k 4k 4k 4 4 4k 4k 4k 4k co eo eo co t _o c _o c _o eo co co co eo co co 4k enenvicoeooooo o o co o ro -__-.ro 4k eo cn cn 4 4k co4keoιoro roco too o oenencnoo oo(-o vioo vicn v vll v vl| O pQ ( _k e 4 vi coco o oi coro o o co cn ro eo en cn o rocoenencn(θ 4k to oo eo o _ to ooeo co oo bo io to io o _ k t ro oo v| OO o θ CO o θl o _-, tD o cθ CO OO O_ v| no oo oo vi __ roocn en cn o ro co co o cooι cn oo co oo cn vi ro eo oo to -k o CΛ oeo eo oo ro -vi oi cn 00 O 00 2 4k OO CD v| OO 4k cn co co cn o cnoo 4k cn co o cn oo co ro 4k o CD to c cD - c en i - Co

4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 01010l Ol 4k 4k 4k k 4k cn 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4 4k 4 4k tn en tn en k tn k oo oo oocn vi oooι cncn v| vi v| o ro o o oo oo vl 00 CO o CD 00 v| en en eo 4- k Ol Ol CO en p p p cn vi vi co ro ro to o co o p

CO o s vi io υi vi b bi bo ik i s vi en o o ~o ro vi 4k o -ι o o_ ccnn ccoo eeoo eeoortoo ccoo σeno e Onl ooOoOo 4lk cenn oo4k o CO co eo o oo o k oo co vi _ en co ro co oo 4k locos co co cooo roro co en op co oo enco co pp ro b o 4k b in 4k i — bi to b 4k b co vi vi vioo cocoo vioo oitorooorooeo rooivienooo 2o oo to ro cn vi co o (Dco -k _ tnroenro -- ro oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ro co co coco eo co ro ro ro ro o co ro ro o _ ro o ro ro o ro o ro co eo eo eo co co ro ro ro ro -k _ _ _k _ _ _ ro ro ro - _ ro co vip p pto ro vi vip pp pp op vi j ^ p ro vi p ro p pω p vi p to ro -k co oo σ ϋi co vi cn ro o i 4k b roi vi vi b vi 4 to o icn b ω o b o o !_ u b rs b r i | o ι i -ik i) encnoencncooo4koroocnoocn4k oιo roen(Deocncnencnocacoencnen o 4kθ oco co 4kcn oenco kto o^ o *o o

en 4. eo eo to to

O en o en o en o

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOO P P P P P P Z O P Z P OO O O o o o o

X toXtoXMXioXro Xro XMXM Xro Xro XroXroXroXro XroXroXro XroXroXroXro XroXroXroXroXroXroXroHto Ho σ o o ro > N rn σ o CD > o p _ ro

en cn cn cn cn oo oo oo en cn cn cn en en cn en en en en cn cn cn encnenφ en cn en cΛ en cn cn cn cn ci cn w en r0 N M N N N M M I o o o o o _ _ _ j _ 00000 p p 00 t t ^ t t t t t ^ t. t * ^ ^ * t A t c vi cn oi c o o o co c vi c cn 4k eo to o co oo vi e cn 4k Co ro co coco3 CB

_i co - -k _ o _ _k o oo -k -k — ro co co o ro ro o __ oo co ιo o ro co co co roco o ro to roco eo ro eo o 4k 4k 4k 4k 4k 4 4k 4k to CO

Ol Ol Cn CO fy e—n■! coj o_Mo i^j, _k o v|pp ppppp4kp o p -_ro ppp vi pp 4k 4k 4k k 4k k k s vio) cn5555 ∑ 54k ro to to co oo to o b 4k to co io ' l_ cn K σicnb ώvibi i b oin b b ^- v| bo to in ro in o tn o vi in b 4k vi v| 01 o θ vi o θ 4k 01 c ~o eoco o co vi coco vicns n o . _ . _n. v| co oo oo 4k ro co oo co o en 4k -k co oo ro o 4 ro o vi co ro eo co en en cD O Oo 4k θι viccnni voi cv —nitro oo -o 4'k θ —o oco - oα-oi rvoio_ki ro -tk c vi oo cn oo v| C0 C _ v| CO -k _k CO CO — oo co ro 4 4 -- ro to co c _o c _o- ro co r .o_ ro co r .o_ ro co co r .o_ -k — ro o M c _o. ro co o co co eo eo co co co c ω ω ω ωω ω ωω ω -o ω ω 014k en 4 o j-, oo cn ro o _ (o o o co to oo cn co cD 4k o oro co oo 2 c en vi " o —o cn co en c —n e —n c p vi p vi vi vi vi vi vi vi co en oo oo co o to rϋoi con rconccnorvoiαco.4oki cvoito oooo oro oo oi oi oo ro ro in o cn 2r rooio 4k bo vi o (θ oι ro co -k co -k evnl c4nk Ocn ∞— cn oi b-vi cvol o ro oi cn α- co vico oi vi o v vii oo c coo o oo eni ro O enl v vij CCOO vv|l 01 4k α_.o> o_ v ^i. v .i c_n. -^ ccoo en 4k e o oo oo - o co - -k cn oi co k en ro ro o vi vi _-. ro oooo -vi oi oi ro oo o to K ro cn vi oo oo co ro co co co o oo oo cn co o co cD cn co oo o ro co en en

4kθi 4k 4 4 ι ωco o oι ι coroυi 4k coc 4 4kco 4k 4k 4k en Ol 4 p p p p p p vl p p v| p 4k p o __ p p o p p vl p o toto t b ra io b b vi vi ω o 4_ _- to b ωro ω toin inb b io i i 4_k 4vki ccoo otn rcooo o vn| tOn c4o_ i4_o onιroo reo _- c nceoDcvni tcoD coooco_ vieonoevoi ooooooo coo 4v_i _4_kooo cn oo oo to

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooσoooooooooooooooooooooo roco co 4k to ro co eo ro co co ro eo o _k ro -k _ _ _ _ co en k 4 4 c 4k 4k 4k 4k co 4 θo oo i o eπ t e c r r vio o cn o cn o e co 4k en 4k cn o cn vito cooo c vi v| oc p ro p o p 4k p p _ p ro co -i 4k vi

-v| 00 4k v| _ o en v| vl b i ik o^^ ώb Mb jb 'o b b bbb ^ ωb o i r en cn co 4k o o ro o co o _ ooco ooen eo e vi cnc ooro vio4k O o mcn o 4k cn rj o M oi oi oo vi co cn e vi 4 cn o

en eo eo t t o en o en O en

4k 4k 4k 4k 4 4k 4k 4k 4 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4- 4k 4k 4k 4k 4k 4 4k 4 4k 4 4k 4k 4 4k k k ω ω ω ω ω ω ω ω u ω ω ω ω ω ω ω co ω ω co ω ω co ω ω ω ω co ω ω ω co ω ω ω ω co ω ω ω ω ω co ω ω co co co co co co eo eo co c en oo oo oo ρ oo oo oo oo vi vi v| vi vi vi vi vi vi vi cn en cn (n cn p cn cn cn cn cn oι oι oι oι oι oι oι oι oι 4k K 4k ω r o co c vi c c S c M o o co oo vi c cn 4k c ro o co c vi cn cn 4k C w o co cxι vi c cΛ oooooooooooooooooooooooooooooooooooooooooooooooooo

X X X X X X X X X X X X I X X X X X X X I X X X X X X X X X X X X X X X X X X X X X X X X X X X X X M ro ro io ro to to ro M M io to ro ro ro ro to M ro io io M ro to ro to ro M io io to io rj M ro ro M l $ v. Ξ Ξ Ξ Ξ ξ Ξ Ξ V.

>>>>>>>>>>>>>> H -. -I -I --. -I -I H -I -I --I -H -. -I -H -. H H -I -H -. H -I H

cn α) θ) cn o) θ co c4 cn o) θ) θ) θ) θ) θ) θ θ CD θ) θ) cn cn cn o) θ) θ C]) (j Φ vi vi i vi v| vi vi vi vi c en e c c φ e e en c eΛ eΛ c w en e oι e cn e 4 4- 4k 4k 4k 4 4- ^ ^ ^ e ω oo vi en e 4 e M o θ (θ θo vi e en k c M o o eo c vi c eΛ ^ e o o co c vi c cjι 4k co ro o cD θo vi c oι

Ol o ro co ro ro 4k co 4k ro tn cn cn 4k ro to 4 co o co c o to —k — ro - k to ro ro k -k 4 c 4 en p tθ p 4_ o p vl p p -_ -_ -- o to 4k co en 2 co t .o co c co ro co oo o o co θ) co k o oι σ> 4k p vl oo v| p p p p p o _ p p p eo oo b o _-. o 4k ro bo to b vi i bo b vi vi ,- o ro oo e — o vi ro in io to bo o n v .i c_o 4.k bo b o 4k _ ro to o 00 g „ ^ b ∞ o o io bo io 4k io '- _ en oo ro ro oo co en o cn o ro ro o S n S oo ω o o rjo ω r o co o oo ro oo o vi co co co - co cn cn to k vj S o o bo eo o o en co oo oo co 4k θ vi o ~ en en o en oo ro co 2jk co i oo cn vi — ro 4k co oo ro vi oo vi o cn oι oo 4k ro Oi eo oi 4k t cnπ e cnπ ro co e _n . ro_ o en co en co co cn co cn 4k cn fo co cn cn 4k 4k cι vl p ro p — p — en o to p oo cn p p p p vi p ω ro ro -tk ;--

2 vvii bco iMo 'ee—nn '-vvii• '-rroo -'44kk ccno rroo eeoo vvii to oi 4k θ in bo io in iΛ cn in bo in io '4k bo bι in o p c _k ro ro ro co 4k Oo o oo eo o co oo vi _k to o oo 4k -k o cn i vi ro t oo

CO co 4k cn

vi ro cn cn o co co co oo tn vi ro o oo ro 4k o eo co oo oo co cn cn oo ro ro oooooooooooooooooo oooooooooooooooooooo oooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooo ro to co ro ro t ro ro ro ro eo o 4k θo ro co IO 4k ro ro eo co 4k ro ro en ro co ro co -k co ro ro ro eo co ro ro -- ro co ιo ro - co ro o v| tO vl oeni oeni o vi cn co oo co cn co IO IO K5 en o c cn o) en ro o io eo co oo eo ro cn en vi ro o p vvi| __ cpo opo cpn op vl O vl 4k e eD o k k o o con veni coo ieoo bo in 4k θ vi o e vi oι oi cn _ "ro 4k 4k to — p c 2 bi ro b vi o) bi -o cn _ b vi i vi '4 co 4k b bo co cn to 4 o ^ oo en eo 4k θ o co o cn oι eo co vi cn o vi 2 _ co co -k oi 4k eo eo cn co 4k oo en en ro -k ro to cD vi

έo^cocococo

4k4k4k4 c e e e_jωc e e.ωc MMMMMt ι roMMo___k__k_k__ _ _ooooopoooo ω ωM o(oooviδ.eΛSeoMoo-θoovicoui4ke rooo(θθovic cΛ4ke ro o(Dθov^ oxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoxoooooooooooooooooooooooo

Γ M Γ I Γ Γ N N ΓJ M M N I Γ M M M M I Γ M N xxxxxxxxxxxxxxxxxxxxxxxx urn

HI -.I HI -II -II -I8 HIII -II -II -II -HI -II -II HI H

v| v| vi v| vi v| vi vi v| v| vi vi vj v| vi vi vi vi vi vi v| v| vi v| v| vi vi v| vi en cn cn c en e cn en en OT (n cn cn e c c cn c c c σ) r N) r N W M N M M o o o o o o o _ _ -. p p p P P p θ p p p i tpρ p to φ to p p (0 (p CO CO M

CO v| CO Ol 4k CO Ko ocoooviooen4kcoro o to 00 vl en 2 eo ro o to oo vi δo en co ro o o cD oo vi cn oi co ro o CO

— ro cO — k — — — k — _ — tO — _ _ _ _ _ cθ — _ k _. en o cD θo o co ro ro ro o o co o o eo o to co oo ro 4k co 4k to co ro ro co ro 4k 4k ro o ro co to _ ro co oi o ro o ro -k co

4k c Q- Q co to o cn co cn j^ co en vi tD oi oi ^ co oo cn 134k o o co o to o CO o oo co o ro oi oi oo en v| o 4k 4k eo o co o 4k c vi p o k _ vi in vi oι to !^ f b o co e vi o cn to p to to ro -vi vi vi io in 4 ro oi eo vi in ro p

2 4k 4k co co co ρ to co ro en 4k θo ρ κ5 ro vi — 4k o oo o n c coo 4k ro cp to oo o cn 4 ro ro eo eo p vi k o co co to co ro to co vi o oo 4k. co oo oo oo vi cn ro en co cn oo ro vi oi o j o oo ro CD CO co 2 oo ^ to o o 2" L _ k — 4k _ to vi — ro 4 ocorororoωcoro corocoroooocooocororoocoroo _ k — ro 4k ro o _ o eo co o _ ro ro oo k o 4k CO -k o o oo cn 4 ω ω <* P P in ot - co* to- oo en eo en co o o 4 "k K rooo vi oo co oo co ro oo o 4k ro ro vi 4k co co oo vi vi v| CO v| 4k b b in ro vi bo oi beno cooo ccnn cn ro o co oo cn p ro in vi b o to co cn co c —o o — _ co oo eo vl 00 io b 00 rvl b veni ito co k '4 roooφ4kffioιsr cηp)ω ro co co vi oo 4k en o CD CO O Ϊ3 2"^ 4k vl 4- 2 t04- C0 C0 o 0 8 00 o CO 2co c2 coovivicocovioooooro o oo oo en to co cn vi co ro cn cn

oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo cn cn vi vi cn e vi vi cn en vi vi cn 4k cn 4k cn 4k cn en eo vi cn co oι ro 4k co 44kk ecnn ecoo eo en en co to -tk s 4k 4k co ro co co en co p p ro p vi p p p ro vi p p ρ ρ p vi ρ p p p 4k vi ρ p ρ p p p p p -vl en co ro o tn oo vi vi co — O -k CO CO CO p Ol o b o b b o b to b ro to 4 o co vi e vi α) i 4 *k- i_- o — b _ _M <_ v ^<| o — co oo oo -k eo cn -k 4k 4k 4k 4k to eo en en oo bo ' o o co 4k Cθ cD (o eD to eo eo o ro cn oo vi ro o en oι eo o _-. r roo oo rroo oo oooo vvii vvii oo eo cn to oo co cn cn oo o oo cn vi cn vi 4k ^ co to oι

4444 OH2 WAT 729 129.629 27.848 38.891 1.00 31.80

4445 OH2 WAT 730 138.391 3.193 36.697 1.00 88.33

4446 OH2 WAT 731 101.751 58.675 54.521 1.00 69.41

4447 OH2 WAT 732 146.260 39.908 45.702 1.00 71.98

4448 OH2 WAT 733 99.632 27.238 39.217 1.00 65.15

4449 OH2 WAT 734 139.029 16.241 44.768 1.00 76.36

4450 OH2 WAT 735 93.410 43.367 39.907 1.00 51.51

4451 OH2 WAT 736 99.833 50.411 52.960 1.00 40.10

4452 OH2 WAT 737 121.822 63.145 36.945 1.00 88.71

4453 OH2 WAT 738 123.231 52.111 47.051 1.00 59.41

4454 OH2 WAT 739 112.095 2.568 44.854 1.00 87.55

4455 OH2 WAT 740 105.823 21.588 32.912 1.00 65.78

4456 OH2 WAT 741 112.121 15.677 29.574 1.00 63.57

4457 OH2 WAT 742 116.006 23.098 23.234 1.00 66.58

4458 OH2 WAT 743 101.396 34.063 30.976 1.00 67.78

4459 OH2 WAT 744 105.307 25.170 29.199 1.00 41.04

4460 OH2 WAT 745 138.659 10.582 45.837 1.00 59.51

4461 OH2 WAT 746 114.904 60.800 37.648 1.00 51.77

4462 OH2 WAT 747 124.430 21.295 33.036 1.00 63.60

4463 OH2 WAT 748 107.809 9.528 45.664 1.00 96.91

4464 OH2 WAT 749 129.675 48.310 54.546 1.00 50.35

4465 OH2 WAT 750 104.938 42.943 50.401 1.00 73.99

4466 OH2 WAT 751 127.598 19.431 38.063 1.00 50.28

4467 OH2 WAT 752 107.804 42.960 53.690 1.00 100.00

4468 OH2 WAT 753 106.996 46.067 52.208 1.00 80.89

4469 OH2 WAT 754 115.697 53.285 33.391 1.00 88.83

4470 OH2 WAT 755 107.557 43.929 23.164 1.00 97.00

4471 OH2 WAT 756 104.503 37.526 36.972 1.00 58.13

4472 MG MG 757 105.326 36.717 53.406 1.00 29.00

4473 MG MG 758 103.375 43.256 48.861 1.00 41.96

4474 MG MG 759 106.905 43.906 51.594 1.00 60.57

4475 PA HPH 900 106.514 40.269 50.769 1.00 64.84

4476 01A HPH 900 106.467 39.079 51.657 1.00 56.34

4477 02A HPH 900 106.738 41.560 51.467 1.00 62.50

4478 03A HPH 900 105.506 40.292 49.674 1.00 62.63

4479 01 HPH 900 108.952 41.335 50.186 1.00 61.96

4480 C1 HPH 900 108.025 40.315 49.769 1.00 64.00

4481 C2 HPH 900 108.690 38.930 49.523 1.00 61.37

4482 C3 HPH 900 109.069 38.562 48.285 1.00 51.27

4483 C4 HPH 900 109.443 37.123 48.011 1.00 49.88

4484 C5 HPH 900 110.870 36.593 48.349 1.00 48.79

4485 C6 HPH 900 112.049 37.566 48.069 1.00 37.71

4486 C7 HPH 900 112.320 38.019 46.829 1.00 34.33

4487 C8 HPH 900 113.476 38.969 46.623 1.00 35.58

4488 C9 HPH 900 113.227 40.333 47.247 1.00 56.66

4489 C10 HPH 900 113.089 40.275 48.776 1.00 68.86

4490 C11 HPH 900 112.157 41.010 49.392 1.00 73.13

4491 C12 HPH 900 112.037 40.934 50.893 1.00 66.86

4492 C15 HPH 900 108.853 39.500 47.137 1.00 54.81

4493 C13 HPH 900 111.421 42.067 48.641 1.00 68.76 4494 C14 HPH 900 111.753 37.299 45.656 1.00 41.06

4k 4k 4k 4k * 73

gr en en en en tn

-<

01 0-_1.0o1 :0-k1 0l 01 0i ;p|ki C{oi oi en en

P o o o oo o

4k

(θ co <p (θ (-)Φ cooo oooooo oo oo oocooo oo vi vi v| vi vi vi vi vi vi vi cn cn cncn cn cn c _n. c _n. o _o. cn en e _n. e_n. e_n. t_n. en en tn en en k 4k 4k 4k 4 c cn 4 c ro ocooovicnc 4k co o o (o oovicnen 4kcoro o ocooovioo cn 4k c-o- -ro- o o — c —o o —o vi o —oe --n 4k co ro -kθ(ooo vi σ)en

P >ZXPNPmP O rom

c ωτττJTJTjτ τjτjτjττjτjωωωωωMωwr-r-r-r- ; Γ-Γ-Γ:Γ-TJTJTJTJTJTJTJTJTJTJTJTJOOOPOOOOO iiiπiiiiiiiiiiiiimnimπiπimiiiπimmmmmmmmmiiiiiiiiiiiiri-rrrrrrrr ^^mm mmmmmm mm o^^TJTJ^^^ccccccccCmmm mrnrnmmmrnmzzzzzzzzz

coco co co eo co eoeo co eo co eoeo coeo co co co co coeo co co eo eo co eo co eo co co M M M M M ro M M M

COCOIOMMtθrθMMMMroM IOo _ _ _ _ _ _ c O OOO OOOOO CO CO COCOCDlOCO CO CO COCO(OOOCX) C∞

en cn en 4k 4k 4k 4k 4k 4k cn en en en ene cn cnoi tntn cn oi tn oι en cn en cn en cn en en 4k k 4 4 4k 4k en en oι en en en en k 4k 4k e en en co ro co vi vioo coco cD O o ro ro rooo J>. C0 C CO to k 4k 4k 00CO v| C04k 4 Ol 4k rθ vi vi p ro ro o ro o ω p p o —k b i vi cn vi k c i ro to vi cn vib vl v| C —O v,l C_O- o — 4k (o oo oo oocn 4 4k b in en io vi vi o vi ro vito bi cn cn vi cn oo _ 4 oi 4kco o e vivivi o ~ o ro eo oo S P o vi o ro CDi- — . e _o- o—*r IoN-o —c _- v --^i 4 •♦k— - —k c cno 44k_ ccooooc coo o c pco co ro o co co ro co oρ0oo o4k 4

-vi co oi to co o oιroδbι co p 2 cn

2 co ro co cn 4k co co 4k ro co co 4k ro ro co vi αo co oo co σ> Ol v| ro

COCO CO CO Cθeo eθCθeθCθeθ CθeoC04k 4k CO Cθ 4k COC04k 4k 4k 4k 4k 4k Cθ 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k Cn CJl Cn 4k k k en vi vi e vi ιo vi(oc oo cn vi c cβo o fχj oo o cD(D o eoo ro o ro eo o o ro oι cn σ) θιcn 4k 4k CO ro co 4k o o vi o cD co oo oo en c 4k c e c 4k co cn 4k cn o ro 4 4kcn co ∞ vi cn 4k M 4k i 4k e e t roeocncn M 4k cn M vi c cn e c c 4k θo o v^ en c o en 4k vi cp o vi co ro co p roo o 4k cβ eoen ro o co M o c eo vico cβ cn oeo o vi co 4k cn co o tD o o ro co oi 4kroco coM θθ vicn o o o p ω _ ω rι _ cncKoooocacnooovicncoco co 4- co 4k c —oo -o co - oo oocn co vi co 4 ro co co i en -k

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo ιoro^ o _ _ _ _ _ Mcoroι roK. .ωωwrowrop MroM MMMMfo^o ooo o _ M c co o _ _ c 4k vi o o iDo vi cn e vi to o(o enen co e3 en _ vi 4k o _k ro coo i to Q 4 i vib vi to io roQ o b 4k o ^ vi O -^ _- -^ roin o k 4k O oicσeovi- vivirocn roe3toσ o vico k oo0 ι oo4ke enMoιc 0 o o(oe vi roo e^

97 C SER 33 137.014 51.819 36.136 1.00128.72

98 0 SER 33 137.973 51.561 36.865 1 00128.38

99 CB SER 33 137.079 54.277 36.684 1 00130.20

100 OG SER 33 137.554 54.211 38.019 1.00130.89

101 H SER 33 135.440 53.163 38.329 1.00 25.00

102 HG SER 33 136.817 54.182 38.626 1.00 25.00

103 N ILE 34 136.616 51.017 35.153 1.00128.06

104 CA ILE 34 137.313 49.773 34.842 1.00127.26

105 C ILE 34 138.715 50.001 34.268 1.00128.81

106 0 ILE 34 138.869 50.556 33.177 1.00132.56

107 CB ILE 34 136.483 48.884 33.865 1.00125.22

108 CG1 ILE 34 137.227 47.570 33.595 1.00124.19

109 CG2 ILE 34 136.174 49.640 32.570 1.00123.27

1 10 CD1 ILE 34 136.518 46.611 32.665 1.00121.43

111 H ILE 34 135.838 51.274 34.627 1.00 25.00

112 N ASP 35 139.736 49.600 35.020 1.00125.91

113 CA ASP 35 141.105 49.749 34.548 1.00120.92

1 14 C ASP 35 141.437 48.728 33.464 1.00116.38

115 0 ASP 35 141.993 47.661 33.726 1.00115.56

1 16 CB ASP 35 142.122 49.709 35.700 1.00122.56

117 CG ASP 35 141.780 48.684 36.761 1.00123.82

118 0D1 ASP 35 141.342 47.566 36.414 1.00129.46

119 0D2 ASP 35 141.952 49.002 37.955 1.00123.01 20 H ASP 35 139.577 49.234 35.909 1.00 25.00 21 N ASN 36 141.017 49.067 32.254 1.00111.08 22 CA ASN 36 141.237 48.307 31.037 1.00107.72 23 C ASN 36 142.508 47.462 30.983 1.00104.04 24 0 ASN 36 142.486 46.361 30.443 1.00103.31 25 CB ASN 36 141.160 49.215 29.783 1.00108.78 26 CG ASN 36 141.378 50.742 30.076 1.00113.72 27 OD1 ASN 36 141.308 51.535 29.156 1.00115.16 28 ND2 ASN 36 141.666 51.127 31.309 1.00113.86 29 H ASN 36 140.490 49.899 32.196 1.00 25.00 30 1 HD2 ASN 36 141.642 52.070 31.558 1.00 25.00 31 2HD2 ASN 36 141.817 50.557 32.067 1.00 25.00 32 N GLN 37 143.593 47.958 31.571 1.00101.33 33 CA GLN 37 144.857 47.226 31.576 1.00 97.84 34 C GLN 37 144.752 45.887 32.306 1.00 91.48 35 0 GLN 37 145.120 44.848 31.756 1.00 87.36 36 CB GLN 37 145.964 48.079 32.204 1.00104.38 37 CG GLN 37 147.329 47.907 31.541 1.00109.27 38 CD GLN 37 147.433 48.643 30.213 1.00112.48 39 OE1 GLN 37 148.192 49.604 30.088 1.00116.42 40 NE2 GLN 37 146.670 48.202 29.220 1.00113.85 41 H GLN 37 143.558 48.839 31.989 1.00 25.00 42 1 HE2 GLN 37 146.735 48.687 28.371 1.00 25.00 43 2HE2 GLN 37 146.083 47.436 29.358 1.00 25.00 44 N VAL 38 144.242 45.916 33.536 1.00 85.52 45 CA VAL 38 144.092 44.702 34.337 1.00 79.25 46 C VAL 38 143.148 43.731 33.634 1.00 77.63 47 0 VAL 38 143.416 42.529 33.568 1.00 78.06 48 CB VAL 38 143.542 45.018 35.752 1.00 78.16 4. 4k t

o

ro o _k _k _ _ _ _ _ __ _-. _k _k _k _k _k _ _ _ _k _k _k _ _ _k _ _ _k _ _ _ _ _ _ _ _ _ _ _ _k _k _ _ _ _ _ _ _ _ _ _ _k o co co co (D co peD(D CD (D θooo ooα) θo p oo oooo oo v| vi v| v| v| vi vi vi vi vi cn cn cn cn en p en cn (n cn cn cn cn oι oι cn cΛ o co oo vi coe c t o θ (θθo viσoe 4k C to o θ(θ c vic cΛ 4k e ro o o cDθo vi cn e 4k e M o co cD vi c^

XPcoOOP>ZXxXOiONPmPmPoPoPoPc OOPZ"!^_iX to - D > x x x ZPP ro o N N N NmoPoPαOPP> XOmOrnOoPoPcoOPP> XPOPPZXPP

CD > OO to ro o

>< < < r- > > ππj^TJTJΛTJTJπΛπTJTJπ ocΛ oω cΛcoωωωωcccccccccc^^J*^^ > ι— ι— > r~

k k 4k 4 4 4k 4 4k 4k 4 4k 4k 4k 4k 4 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4 eo eo cO CO Co eo cO C CO co co co eo eo co to ro ro M io ιo M i M ro ro ro M ro o _k _ __ _k __ _ _ _ _ _ _ _ o o o o o o o o o o o co to co co cD c

4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k C_l 4k 4k 4k 4 4k 4k 4k k 4k 4k 4 4k 4k o oro ro .o ro rocoω o okcokoc4ok 4rok 4rokr4okr4okω4k 44kkOolc4okoI

4kθto oo vicn oι oι oι 4k ro ro 4k co ro eo toboco in inb ro- v-|1 ' co cn coro cn coo oocn ro ooo 4kOi vi _ coenen 4k o oo oo en oo en 4k vi vi oo eo eo δ) o oo 4k e vi co oo _ Q gooooo oorroop cn .k o _-o o - _ eo vio "όe" 4k θooo rrooeωo opι -o _ oc) e-n.

O v| _k O 4 ocoeooo !4 ok k v| cn 8: ro oo co vi co cn δso _ vit ω oo ooo e o _ o o 4_ n to ro

CO Cθ 4- 4k 4k 4 4 .k 4.k 4k 4k 4k 4 4k k 4k 4 4k 4k p j M +k l ι oι cϋnl o o- irvo cuoj uϋin4k. - ro co 4k en cn co vivibp4kbcto ca bo4 .-_kr .oioi _n-. vl 4k ro v| O vl O CD vi Jk lO CO O CD o ro CO v vii CωO CωO trOo e*o. p _-, p _/ v -,i cn cn vi ooco oo vi ro vi eo oo co cn ro co oo vicn co oo o eoro to ro roeo coeoco eo co co co ococooocoocoroco vivioooi cn 4k ro en co en i 4k c _n. _ B OO o Q0 cov|pvi tn δ) i t coo ooooδ vl 00 Φ- co v] 4kO (o oo cn ro(D o eo oo en oo oo to oo o 4k o o cocnoro o 4k ooro cn oco co oo o ro co coo oo o CO OO o cO CO vl vl CO

ooooooooooooooooooo ooooooooooooooooooo

M 4k 4 4k 4k 4k MMe en cn c en e e 4k 4k 4 4k oι e (D (θ (oe5 e e vi vi _ θo cΛocoen (θ (D ocncoeo vi cD O oro l 4k ooooooo oi o ooco o θ C rOOOO COO oo co 4k θio coto _ cn

4. o

M enhenJreOnN4kM4kr4kI4kr4k N4 r4 M4 r4kreorwJre NeoMcocMcr I_OoMe NwtoMfoioMi fot toi o__k_k_k_k_k ro o — c —DC —ovioooι

cCoo rroo oo oo tcoo oooo vvii ccoo cenn k co to ocooovi σιoi4kt -o -ro o - ( —oo -ovi -o -oe —n4kcoro O(ooovi .c _ne .n- 4kcoroo

ProOOP>-XOcoOOP>ZXOmOmOσPoPcDOPP>ZXPo Z

ES o

r- r— r- ι— r- m m m m m OOOOOOOOOOr-r-r-r-r-r-r-|-r-0000000000000000000000 zcccc r-r-r-r-r-r-r-rr-r-τnrnmrnmmmmπ\r~rr-r-r-r-r-r-rr-r-r-r-f-r-rτ-r-r-r-r-r- CCCC ______ cccccccccczzzzzzzzzzzz

4k 4k 4k 4k 4k 4k 4k 4k 4k k 4k 4k 4k 4 4k 4k 4k 4k 4 4k 4k 4k CD CO CO CO CO OO OO OO OO 0000 v| v| v| vl vl vl v| v| v| v| C

-t>' -r-

4k eo | —

o

o o o o oooooooooooooo oooooooooooooooo o o o o oooooooooooooo oooooooooooooooo oooooooooooooooooo oooooooooooooooooo eo eo co co CO rO C04k CO C 4k rO 000000 v! Ol 4k co vioieoocoooocnvirooroooo 4kcororocoroco4kcococorocncπcn 4k CO 4k 4k co 4k to ro ro ooco oo vi cn 4k 4k en cn to J. eovioivicoc-neooviencoencoooro o c __vlθ oi cιn cιn 4k o 4k 4k oo co en o ro to vi bb" vic o ιbo_ ikOcn k ro bo io b to b to io in b — b b ' ro o o- rOOOOoCθeθ0004ktD01COCOCOvlvirθOOCOCOC0001tDC004kvl b voibcoiokctoovooibcobobobootoobrobcocbnbcoioooonccnob4k

ωω UU U rs) r N)MN)M MMr rS) I NrO r rJ M rv1 M K)NM p o o o o co (D(θ(D (θ (θ (θ(D (θ(D C c cβ e cβ pcc (_o cβ vi vivivi vi vi vi vi vi vicn cnoo oo cn encn cn encn e^ - ω to o o co oov|cn c 4k ωM o o cD C vi cn c 4k ω M o o cooo vi OT oi 4k ω M oco ∞

OO P Z X X POOOOP Z o=- X ZOOPPOP P Z X OO OPP O P P Zeo ro --k I ZPPPPOPPZ x o p p

> O D > xx mmoocD > mmσocσ > x x x N _ roo mm ro — to -* N N N m σ o co > σ tO o o to to

> a>j)>ZI>JlIHIHIIHIIIHIHIOrOrOrOrOrr-)OrΩrOrOrOrΩrOrOrOrQrOrOrrrrr^^^,-<^^,-<^mmmm

OO OΛ^^πTJ^TJT TJZZZZZZZZZZZZccccccc ccCΛCoωwωωcoc coωcoωcccc

cn en cΛ cnen cn en cΛ en cn en en cn cncncnoι oι oιoι oιoι oι oι oι oι oι oιoιoι oι oι oι oι oιoι oι oι oι oι oιoι oι oι oι oi ϋi oi 4k 4k 4k 4k 4- 4k 4k4kcococococococococo roroιororoiororororororo o --> -_ __ _k _ _ _ . σoσoooooo _ o_ o_ o__ o_ to co co co

CO 4k CO 4k 4k 4k C0 4k 4 p o p p toro(θo cn bo inboinbinbi 4k b eo o o e co cn ro o cn to co -vl co o

co eo to co eoro ro ro ro ro ro ro co ro co co eo ro co ro oco oo eooo vi oo oo o co o o ro b io roto o io b o ro i cn b b 'o k 4 θo4 Cθ 4 θo o o oo e en e cD co o ro ro ιo -vi vi ro vi 4k θi oo cD vi ιo oo ro co to co e en en t o o oro cop o(D oro v| o p ρ os eβ vi c j roMco 4 cn c cn (ne vic (θOT co eo ro w c toeo boee 4k v-oibobo ienn rroo rMoie 44kk oo vvii icnn vvii bcn vii rtooto(Dto(θ rMo 44k vvi| vviirrovviiicΛn vvii bo 4k v| vic oM θ 4k pc en ω oc coMθie 4kθM ro o _k co roo _k ρωωrjωrovirjιrJjr coooooco 4k cncnroo cocnc ^ vi e vi vi cn vi cn o vi ιo o 4k M θ 4k θ o _k c cnoen e e o __ co e t o cn o c ι oιo M (o CΛ to co o ro vi _ 4^ en oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooσoooooooooooooooooooooooooooo k 4 4 4k |O M 4k 4k 4k CO 4k 4k 4 | M M Cn Oi enejl Cn 4k 4k 4k 4k rO C0 Cn vl vl c 4 4k 4k 4k ro M M IO 4k 4k 4k CO C CO W o co o ro p o ro ro o o ro p p vi ^ ro 4k cn oc o ro eo M 4k 7) c e e o 4k vi ω toto 4k 4k b b toeo o to 4k io b b b 4k ι inbo to toώ ro io b b — to koto to roto b b b b 'vicn ∞ ro 4k — co 4k b t vi co 4koooι o oocoeo roen 4k viooo ooencn(n 4keococoooo ooeneoo cocnMeoo o o ocococnMocn cococoo o uιr

4. to

o

co eo ω eo ω coc eooω eoω coωω coω coωcocoω coω ωω ωωωcoωutoωωωω ωω ωωωωωω ωωωω coω ω ωcoco ωωω en cn enen e —nen cn ^ ^ ^ 4k S S 4k 4k 4k 4- co co coco eoeoeoeoeo eo M M to ro ιo ro rororo roo _k _k _ _ _ _ _ _ _o o o oo en en 4 Co M o O (o c vie cn 4-e io o oeo evi cn en 4k c Mo o (O Oo vicn en 4k c too oeo oo vi cncn 4k C M o cD c

OOPZXPPPPOOPZXPPPPOPP XP - PZ P P P

> oootD > σoocD > ro o ro o rnCoOPoPDOOP>ZXpX OOOPP >r - XXZZ Ω∞ > x XxXxXxXm xrox N o m o o co to to _

> C>CC>>rCrπCrπCmCmCmrπErj^CrπC^. E.EE.E.E.E. — _-_-_-_:<-_-_-_- ωcΛCΛCΛCΛCΛCΛCΛ>>>>>>>>>>>>>

>>>>CCCCCCCCCCCCCCCCCC_-l_-i_-i_-i_-|_-j_ _-|H3J3J3JΛ3J333J^JOOOOOOOPPOPOO

cncn cΛcn cncn cncncn cn cncn cncncn cncn cncn cncn cncn cncncncncn cncn cn cn cn cncncn cn ω totD(θ(o ooco ooooα. oooo oo oo v| vi v| vi vi v| v| v| vj cn o o>cn c c en cncn en oι en cn cncn en

o _k ro o _k _ _ _ _ ro ro too _ _k _k _k _ ro ro M M o _ ro ro ro ro ro ro ro ro ro ro ro ιo ro to ro or0C04k vlv|00pp4k0ipv| o_o(ocot e vioooroo(θ _( vioo(oorooovi tooov|v4cji 4ken4k vioιoιoιeo roc to io vi e co 4k vioeo 4kθ o ocoencn f- vi cnvicn eo4k eoene co4k vioι 4k vi o ro 4koo o o ro 4k θien o o σ o -vi _ vi oo to to oo o oι o vioιoo 4- oi 4k o _oeooo __ro oιo co enro rocn p oooo 4k cn p o eo cn o __cn co όo vio oo co n o oo vi oo eo o co ro ovi _kco cncn cnroeo j en co oen oι en oeo S ro(o eo 4kθo 4k oωooi ωSoooiO) 2 o c4n coo eono veni ecno oo r vo|rpo rvolrpo rpo r_4ok rto0r 4or4ok r4okipo rporpo cnooooo vi o vi .b _ i _oe -n. c .n in vi

-vi vi vi ρ oo vi vvji 0o0orrθo vv|i0o0o CcoOOglι ro 4k θo 4k θ k roc cn oco _

oooooooooooooooooo oooooooooooooooooo oooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooo cnoocn en ro 4k 4k 4k 4k cnen 4k 4k iotoeo co co 4k 4k 4k 4 ro 4k 4k 4k 4k 4k 4k 4 4k to to 4 4k 4k 4 4k 4k o roro ro o ro vi vivi cn en 4k 4 enen o cooιto oo oo(-n 4kco cocoeneno _k 4k e o 4 c k o p o pro ro o - ro ω ω _ ro o o oo en e 0o0 o vol o ro -c-n o- . e- _o- r .o- _ e-o co vi . i .ocob -o. b_ t_oc_o. t.o 4k v -i 4k b -oco b b o cn iob bi b bb b b b vi inbi — b i — v| v| 00 -vl O 4k co 2 vien oeo(o o o rj) cneMθ ooen en to(-θvico o o rooen 4k 4k eo o oo o o o ro(θo co(-o ro vi

4k

4k 4k 4k ^ 4k ik ^Au ωω ωωc ωωωω ωcoωωωωω ωω ωωωco co ω( ωω ωωωcoωω coco co ω cococo coco ooooόoooθ(θ(θ(D(oωφ((oωcocoo)θooop)θoooo)θ3Svi vi s ffiθ)Qcno)σ)θ)θ)σ)σ)Cricncn c vicn cn Se M oO (O Oo v| cnen ^ co M o o (D ca vicn c 4k co ro o o(ooo vioo oi 4k co - - O— -(o c-o vi c _n. e.n..4..k c.o..ro. . o_ CD 00 vl . o CDopp >zxp CD

CCCCC^-^C-^ CC[-;C--; -;--;-^> >>>>>_.>>>>>>>>> 7 OO HHHHHHHHH >

™ c™c™c™c™c™ccowco-c<o-c<ocoωcΛ'W<rc<ococow ) )7)7373

cncncn cnfficn o) θ)cn cn cn cn cno)θ) cn o)θ)Cβcn cn θ)cn o) θ)Φ cncn o)cn o)cn 4- ^ ^ 4k ^ ^ eocoeo eoeo eoeo ωco co co eoeoMroroM ioMM to M rotoro ro ro ro ιoM o _ _ _ _

eo toeo c eoeo 4 k 4k 4k 4k 4k 4 4 co to e co 4k coco co 4k 4k 4k co to eo 4 4k 4k k 4k k 4k 4k 4k 4 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k p 4kc p p 4kco o co co op i . p — p — vipρp _ p _ p _ p _ p p p _ eo o _ op o o _k co co ro ro ro 4k ro co ro o to o ro

— bi ro σo bi boc cppccno o iD vi _k. oo oo __oobotocorroo iιoo 44kk bθ vviieeoo oobooo oo conι eeoo eeooiennbcoo vvi| o O o k „ P. _4k C0 Cp 00 O CO CO 004k cn v| vl o CO 00 ro co -vi en oo vi S^ c-ή- eo oo p eoo oo vi ro ooen oo oen eo ooco cn oeo cocnoo cn en 4k co oi P en 4 4- ecnn rroo eenn eeoo ccnn 4k co ro co en co oo to eo o eo vi c ^o c ^ o vi oc c oo 4k θ3 K5toe c ϋio oocn 4k cnco oι oo cD o 4_ j ro ro oo co vi eo ro l CO o vi co co o

e ento viσ 4k eo co 4k 4k en o vi vi 4k ro p p ro p -vi p p p vi p vi p p ro o p co oo co o cn co CDeoen 4k 4k i bobι co pb 4k _ cnro bo iB ^ώ br .o. vi. !r.k „-. -_ . .. . _ 4.k en b toco 4k bo o oboo ttoo ctooob obiιob o boo cnn o co in o to

(D(otoroco(ooieoe 4k o ro4k +kQoeooj .. o _ c _ vi" "- c" Scooi oo _ o--ie-- O_ M- . e ~n. p ~ _ ~ _ _ ._ „io _i.itooecoo vvii _k cn o o

-vicn ro oi vio vicocn ro cn oo 2 co icnencnppo _-. coro v

4k θ toco coe cn vloι roooe 4kθco ιo 4k 4k θ ϋi 4k 4k to 4k — c cno ecoo ccoo ccoDccnn ttoo vi — co co co e _o c -o c _o ωco ω p eo co eo eoro M eotoco ro eo eo eo co co co co co M M co M M &o co eo co co eo e ro M M M M io M io ro ro ro oi cooi pi eok c4ok vi vi vie -vi cncn ke J^ *k e c oro(oto rO(D —o ro o oιD ~ vio vi . -k p. c.o 4.k 4.k _ cn e en vi co

— bo ico robob viboro bto to co oo o iocn fo cn cprocn bo co o o i to b '4k roc 4k b ^ io c bi in to o 4k v - v| v| CO 4k o ro Ol 4k b O 4k CO c vi o M 4k p ro cn o 4k vi v! 4k θ o o vi 4k Cn c oiconooo -o-oe-noeo-ct-oo oo-ooocnocconccooocno p 5rooιo_ Ol

4k vl o O C CD 4k CO 2 oo ooco eo eo e oo 2vi vi o o vi cn vi 4k co cn vi o oo oo co 4k ro co ro co o o

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo cococo eo 4k 4k ioroM M co cD c vien 4k 4k cn cn ro roroto M Mco (D coo vi vi vi cn cn cn cn vi ro vi vi vi viro ro co oo oo oo vi vi vi ro oo cn vicD e 04 cnenenen 4k O M Mo eo co co en cn enenen cnoi ro o oo eo oo cn co co o vi o tn co ωen 4k cn oι roro p ro vi p _ ρ -k cn ro co o vi ro ooo o en en ro c o co oo vi o ooo oo co oo o cn ιooo eo 4k -vi 4koo o oo cn oo coo o io ro 4 bo bι to b b o o 4k o en oo ooo o -vi 4k cn ro vi co OO o θ O O O O O CO tθ rθ CD IO o o CO v| _- θl O Cθ 4k v| 4k θ O cn k oo o oo cn o co o co

4.

4 k 4k4k4 4 k k4k4k k4k4 4k4k4k4k4k4 4k4k4 4k4k4k4k4k4 4k 4k4k4k4k4k4k4k 4k4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k cnoιoιoιoιθi(Λoι ioιoι4k4k4k4k4k4k4k4k4k4kωcocoωeoώcocoeocoroK3N MMrororoto tO o _ oco∞vic c 4ke t oo(θcvic cΛ^ωι oo(ocvicne ^e toootooovic en4 coro _ _ _k _ _ _k _ _ 0 O CO 00 vicoen4kcoroo oco

r- r- r- r- ι- >>>>>>>>>> > r— r— r— ι—|—r— r-|—|— HHHHHHHHH>>>>>>>>>>> >>>>r-r-|— mmcmcmcmcczoczoczoczcznczczoczc cΛCorπmmrπmrπrπrnrnxxx

2z _. rπrcπmcrcπmrcπmcrcnrcnxp3xjx:xoιx3xjjxpjxαxoc-Dω-Dwτncvjnωωτnωω-ιnwjJ>> ccc

vivivivivienoenenencncncnencncncnenenenencncnocnenencncncnencncncnocnooencncncncnoooooocncncncntn ooooo_(θ(θ(θ{θ(θ(D_(θ(θcoTOC)oco_eDCoocDθoviv| jviv|vivivivi(-oe c (nc c c^

oocroocconrvoipJ^eooιecnnconconvooicvo|oooconι^op^fcooi(Dotoconr_o_p^ S co co cn

Ol 4k CO o -_ CD O o 4k CO to tooococDoeorootooovi — ooovitn envi

CD v| vl Jk Ol v| 00O vvil CCOO o __k tcOo C(O0 t(Do oO oO v| CO (O v| 00

c en4k 2 ococ c c 4 4kcCoDυ0ι1cCOooo4kcCoO o CcOO C(OO O Mcn4k 4k2 o 4koorococovie eno - o —ocoeocoooooωroo —ιene .o . o -ιc _no -oθ - vi -t-o <-> _ r o ooenvioocooιoo4k4kocncnro o4korooo4kororooιcβroencno4krovi_kcovicoro4kenoιrocnocncootoro o oi cn co

ooooσooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

MtotoroMMrotooooioi4kcoMeorotoMMeororoMMroMrorocoeoMMMeoM pvicovi e proωpp p envi ro4k p^ 4 roω vip o (o oro4k4 4kcne en oeo4kϋiM o_ virob bbb ro b4kvivib rob'4kboro4kbbbroineoi totovib4k eoecooooooe vjro4koc cBθθocoωcoMcβorj,ooocncncncoooc oocΛeoOTooc(D θ4kαo4 eovi

Cn en cn e c cjl Oi e eji en en en e 4k 4k 4k 4k 4 4k 4 4k 4k 4 4 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4 k 4k 4k 4 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4 4k 4 o_k__00Op0p0O00(0(0(0(D(0p(0(0(D(000eCC)000pCaCβCβ00vlviv|vivlviv|v|vlvlcnOT woocooovjc c . ωMoo(θrvicnc - c roooeocovic c Sωroooco∞vic c 4kc rooo

P>ZXOmOmOoPoPcOPPZXPPPPOOPZXPPPPOOP XOPPPOOPZXPPP too D > oooD > OOOCD > OOOPOPP __r o oo OOOCD > ro o O_kOroOCD > σtoσo

^S222222222rrrrrrrrrrrrrrrrrr>>> >^>>>rrrrFrrFr mS ΩΩCZ zczczczczczc zc: TJ TJ TJ TJ TJ TJ TJ TJ TJ C C C

v| v| v| vl vi vl vl vl v| v| vi vl vi v| v| vl vl vl vi vl v| v| vl v| v| vl v| v| v| v| v| vi v| vl v| v| v| vl v| vi v| vl vi vl v| v| vl vi vl v| v| v| co(nencnencnenenenenenen4k4k4k4k4k4k4k4k4kcoeoeocoeocoeococoMMMiororoMroMo________ oooo

M M ro M ro M NoroM ro 4k co o oo or c kco oo vi

4k co 4k ro vi cn to ro

oιcn ro cooo etnn rroo 4kk ecoo oo co2 en i oecnirιrooo ooo ooo cccooo cccDDD CCCDDD cccooo eeeooo cccnnn o vvii oo . o"o _ro en 4k o o eoo vi vico roeo vi __ oo co (n v| o Seιιroco oo oo co oo a cn o 4k. cococoeocoeococoeo 4kcncnoιcnooro4k4k i k4ki i vi obo o ro cn o cn vi coo ro o cnco icnh vvii ccoo vvii oo to

oooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooooooo

rooroeorocoeorororororororoorotorororororooi ro rorororoeorororoco oeoenocooooo o p p 4k kr ro p ro cncoeo4kθpvi — o vi bin∞obovieocoinobvi btoinbiocob' 2 b isibbbbb |vi oιoooocoo4ko4_4_cooι 04koOl4 "kOOC001COθ2 oooent ovicooi4krocnooooooιvioιoooro4kθiθvioovi

cn oi oi oi oi oi oi oioioi oi oioi o cniocni cn cn pi oi cΛ oi oi oi oioioi oioi oi oi oi oi oi oi oi en oi oi oioi oi oi oi oi en en en en en en cn en cn en en cn cn oι oι oιόιoι oι oιoi ' Cj~ιe'~n *.4k 4k 4k 4 ^ 4k 4k k k to co coeo c co c e co c ro ro ro roro ro ro ro ro ro o _ _ _ _k _ _ 4k eo ro o oto oo vioooι 4k coro oθ (D θo vi enoι k eo ro oθ (θ oo vicn oι 4k eo ro o o (D θo vi σocn 4 co ro o cD oo vi c en 4k Co

P P O PP Z X XO OO PP ZXPP P POPO Z XOP P X PPP PO OP O fo o — ^ -- ^ P Z PP P O P O CD > Ω Ω to > OOOCD > > OO CD > o ro o xxxxm xx N m σ p oo ro X X X X ro o to ro _

1 π immm mωπimpmmFmpmpmpmFpmorororOrrO^mrmzr^^C;CC;C^>>>>>>>>> > >>

731111 o ωc _ 7373737373737373 VΛ 73737_37__3 -<"<-<-<-<C CCC CC C O OPOPOO PPPOPP 73 ooααooooωo oooooooooooooo i v)v| i i ι ι visvisss ss s svi j s vj s i i i i jjj^^Jθθθθooooωω(θΦ(θ(θ(D(θ(θooωooωω mo)θ)θ)θ)σ)θ)σ)C))σ)ci)σ)σ)θ)σ) e oopro eoo coo coo eoo coo eroocoo eoo e_o coeo eoco eo co co co co co c eo coeo co eo coeo co eo co co eo coco eo ro coeo co eo co co co eo eo co co co co to fo roc vi c en ene eo 4k e Mi M M M 4k vi c vi c 4k 4k 4 eo cD oo - ro o o o o ro o ro ro ro cnin 4ktoobo 4kcobroo. cobinvibio L_ 2cooιocncneoviro(θθoιrooo vi -_ vicDθθ o 4k 4k 4k4k -kcoco 4ktocnencnco cncn o co co en eo oeo o oo o vi ro<-o eo cD 4k _ . co vi co cn cn vi 4k ro enc cocn vi co eji cn cD vi 4k M c 4_ vi -k 4k CD co en oo co io vii oo cn 4k co ιo oocn en vi vi co coro ro oιro cn vi eo o eoen o oo oo eo cn en o ro cn oo eo oo cn eo cD vi o o vi vi oo co o co en vi np oop o oNJcoococD c c vi _ vi M O M e vi vi o o co co cxi 4 o co

o vi vi ocD cn c cn vi ro vi M vi _ co o to oo co oι eo co roio eo eo e coeo co eocoeo4kco 4k CO CO t0 4k 4k 4k k 4k 4k 4k eo 4k 4k 4k 4 4k 4k 4k 4 4k oo to O _ oo J,_ oooιcn vicoco o CO o p p p p p p 4k p ρ co co υι oι 4k co eo ι r>o- r too -k -k

2 oicooo eo eo -vi . CD Ol CO OO Ol 4k 4 K3 io b ob o __ σ) k3 b ω i ώbo io 4 4kk bb boo b b roooo cn co eeoo v| CO o C _O- 4.k O _l.4.k cn vi ro coo ro oo coto o o _-, _ ro v| o _ o tD θ o vi en vi cn to

eo o 4k „ co co co c ι (n c o c o _ vi c co oo (o vi cocn o _ w vi

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo r M ω ω M rS. N Is)N rθ ω ω M r N N M M rO r r M M r rO M N) M M

_ 4k roo ωe en cΛ(o e 4k vic vi 4k 4 rooι{oo o 4koι vi co cne M oι oιϋioιoι oι cn vi 4k oo o en ro o CO o r vi . b _ b _ vi ro to vi io ijιb b 4k io ^ vibtoi bto o to o ro o oo oo

(o cn ro cn oo -vi - o - o - o -o 4k co 4 - ro to o _ e.o cn vi 4k θo o cn ro oo cn ro 4rokboobo reon c4ok io v| - i ro 4 -o k CO- b o- b o- o- o- o- o- en oo eo eo oo ro vi co eo

o

enen en en cnen en cnencn en cncn encn cn encn encn en cn en cn en cn cn en cnen cn en cn en encn cn en cn coi cji cn cn cn en encn en en en en tn _ j _ _ _ _ _oooooρoooo(θ(θ(θ(θ(θ_p(θ(θtooo _(aoooo(sωoooooo vi | i NviSN io)θ _)- cn en cn ( c 4 Co to o o(De i c en 4k eo ro o θ(θ cβ vi cne 4k cθ M o o (oeo vien cΛ 4 eo ro o θ{θ oo vi c c 4k eo o ooccoooooo -vi cn 01 eo

Z NPmPoPoPcoOPP>ZXOmOmOσOoPCDOOP>ZXPNPmPPPPPOPPZXX ZPPZPPOPPZXXOPPPPP to romor σooco > m roo_k mromoσrooocσ > x iNm rom -σoσ _

wcScoώωcλωcSόcΞcc^

exicxicoacxi∞∞csesencoococ ∞cooeoc cp∞c co∞cs∞ cncntntntnoicncnoι555**KSKJ>5ωωωωωωuωωωωωtowMr torθr MM

o n coo Φk oooooo4k oeo4k rorooococooooo viroeocnooo enrocoooovi4k4_αocoocntocoooo to to ro ro ro ro ro ro ro ro ro ro M to ro o o o _ K5 co o en en en cn o - _k p bo io 4 b b ro o in to in b bo to io in io bι o — cot oop ikik oef encn vvi| vviitro vi roo tD (θ oocjιcn θo k k e - o eo coo44k ecjι oi (o co rCon toepo ro corvo|ro rorvo|rvo|Mv|M Coo Mv|cpo cporopco to io M M Mvlcoω rroo oo(D 4- en e cn vicn c c en o ene tn -vi co coθ (D vi co ϋi vi oo o oei (o oo oo vi ootθ 4k vi -k θoen ro to co co viro oo ro o o ooro ro co j&.4k 00 o c04k oo en co eo o coco co ro ro oocD vi oι co oo rooo o vi co cn 4k co (D oι oι o

oooooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooooo vi vi vi c 4kco eo 4k 4 M p ce vicnco 4k 4 4k ro 4 eoc eo e eo co co eo eoro ι M i M ro M io M ro M M cD o o eo en cn cno o e 4k c o k a M en o en o pcn 4k ro 4k pp p ro p 4k ro vi ce oo cD rooi c c c ω tob 4 o o'4k io i vi ω viro o _k to bro b vi to ioro ro io to o m b ro o cn co oco vi_cn oo cn 4k _ vi 4k co 4k io o o ω 4k c cω cnω ooo 4- o o o c M 4k cn co ω co 4k o

4k

o

cocncncncncncncncncncncncncncncncncncnppcnpp cncnoocncncnσooocnoιoιoιoιoιoιoιoιoιoι4-4k 4k4k4k p ^p^.c^o.c4okoeoooeooceoocconcenocenocenoccnoccnoccnocroncroncroncrnocroncroncroncroncroncronconc_nkcn evie _ cn4φkccoorrooooooeeoooooovviioooocc 4kco ooo _ e —oo -ovic _nen4kcoro ocDoovioooι4keorooocooovicnoi4keotooocooovi

ZXPPPP XOOOPOOPZXPPPPOOPZXOOOPPOOPZω_oo_ αoocDOOP >ZXOOOOPOOP ΓΠΓΠOOCD > DDOOJ roo > O _PMP_CD > m rorπopcD > N N N

CFFFFFFFFF OOOOOOOOO^^^^^^Ϊ-^^FPFPFFFPPOOOOOOOOPOΓ Γ Γ c C C C C C C C C C C TJ TJ TJ TJ TJ TJ TJ TJ TJ C C C C C C C C C C w O CO CΛ

CO(O(OCO(O(O(O(O(O(O00000000000000C0000000O000000000 Scncocooooooooo∞oocDcncoooocncoocoo∞oooooooooooooooo oθOOOOOOOO(0(D(D(DCOCOCO{0(0(00000 ooevivivivivivivivivioocncnencncnoocncnoooιoιoιoι

roιororo ooo o cnoocn cDo -o ooo oo

M _ Mrotoro.r_OMMNJ.MMMMMotrOoMeoMenMenM4 reOnMM. cMIOM e_vipρpv|ppooor e e e 4 p vii4-tnn epn eenIOMI IO n -vvii vitvOieoω o en ccnn ecn - - - - -- vi ωω'kωωtoω4ko__viωω o4_ ιιωocΛ 4kcoo4 Co-oocnvicpoeo-ocn(neovienoo_oo(oeno-oeoocn(oJ^cecnroSoviocn4kcno cooooenroencncooen4kvico(Denooeoeo(oenoMθoθ(Dθ4k(o4kocncnvioocncroocncDθoθococnoιrocnc

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooσooooooooo coroMroeoeococoeoeoMCcvi(n coeoeoeoroen4k4k4k4kcocoeorororoMcocoeococoMcn4k4k4^ eoenvi_oMooιeooroen(nocno4ktocnooρpvicppo(op oenoιppprorooρoιoιocoocnoocnpvipcncΛ iobtoinr\oroininbvibvi!^!^.co4ktotobtobioiob4koro tobinM toooroencoeoMMcno4kvio4krooocntoo4kcDcoMcoe)ocDenorocn viocenoococoo__cncocovioooo

o

M v|vo|v_kiv_kiv_iv_iv_k|v_iv_iv_kiv_kiθvivO|vOiOv|θvivpivθivOjvOivOic_oc(nDe(0ne(n0e(nθene(n0c(n0e(nDeOne_ncCnn(Cncenc(-nOcpneCncCnβeenβcCnevn|cvn|cvnlcvnicvnl(vnlevn|cvn|cvni(vniroO o cD Oo vi oo oi 4 c io o o (ooo vioo c 4k e ro o o(D CB vie en 4kcoro o o (o c vi en 4k c to o o co c vi OT

X xXO xONPmPrπPoPoPoPcDOOO >ZXP OPOPOPCDOPP ro o ro > _oo _-0OPPOPPZXOOPPOPP PPPPOPP o _k r o 1 m1m mromooocD > o roσoo o > OOOCD > ro ro

- 7v3-7^3-73-7v3-7<3^73-7<37-3-73-7<3!-7<3!-737-<3.7-3mιτιrπrn ZZZZZZZZZZZZTJTJTJTJTJTJTJTJTJCCCCCCCC

C0 CD C0 C0 (0 (0 (0(0(0 (0(0 C0(0 (DCD (D (D (D (D(D(D P (D (0 (0 (0 (0(0 (0 (0(0 (0(0(0 (0 (0 (0 (D C0 CD C0 C0 C0 C0 CD (0 (0 (D IOl OI Ol OlOI OIOI0101010lOl Ol 4k ^ 4k 4k *k * S 4k 4k coeococoeoeocoeoeoeoeocorororororororororo

o ro ro ro ro ro o oo en oo o o m r p mr co -o v.|1r mo r p -o ro v*.lι Ό ro vl mp bo to to ro bo to "-*-- vi in 4 — in en

CO Ol o 4k to o 4k e co co

4k 4k en co co to oi vi ro e2o rooo o cn ro o

ooooooooooooooooooooooooooooooooooooooooooooooooooooooσooooooooooo

M c —nM c.n_4 eok4 cok4 r4.ok.o4_kCvi.ec.no_eo. tCo0o4keCnOcC.n_crOncIOβceoeCooC0oo4_kvCoi.oeoooCocIncMncMncvsiovo|cvn|cen4vki44k _4ok ooooo toococoenovitoeo-vi; vio robιbbbbro4 inro cin r rooi co.

oooooocooen4ko4krocnroco co 2 oooencncnoooooooroocn CO 00 v| to o co co ro oi ro oi oo co roro cn en co vi

4.

O

vl v| v| vl vl v| vl v| vl v| v| vl v| v| v| vl v| vl vl vl vl v| v| v| vl v| vl vl v| vi vl vl vl v| vl vl v| vl v| vl vl vl v| v| v| v| vl vl vl v| v| vl vi vi vi cn e e cne pc cn OT( enc cΛ c e cΛ cnen cne 4k 4 4k 4k 4k 4k 4k 4k 4k 4 Cococo eo co eo c coco co ι M roM M θ (o ∞ vi <-θcn4k Cθ M oo cooo vi c en 4k Coro o co oo vi oo en 4k eo ro o _ c —o o -o. vi —cno -ι 4k co ro o o _ c .o_ o _o viσ _o cji 4k co ro o

o — ko_o_o_o_ —o io_ko_ -oko_k(tOθe(OθC(DO C(θO ((o0 (ι0θ((DDt(θO C_Oθ(0)C(OoCoOomCO (0 (0 (0 (O CO CO eO CO (O CO CO (O CO CO CD CD CO CO CO CO CO CO CO CD CO CO CD CO

O O O OOO O OO O to oooooocococo ssN vissviso)fficnmcoθ)θ)θ)Φ

rotoMMrotococoroMco MeoeoMrororororotoMMMMroroMMcoeo

C0 e0 vl 00 vl C0 o 0 (0 (0000 o _k C0 (0 (0004k r000 _0 _04_ _v| vi "p ~ vi_i p oι oι co vi ro en 4k θocjιcneo cn oo (oo oo co o b' ωbk)b *bb j i bvi

22 vl _k Ol v| v| -_ IO o r o - vi c -n c i 01 oo vl r 4ok i _k co ωeoeβ c oco co vi p 4k

4k oo o co vi ro oi O v| 00 v| i co 2 co cn o θ 4k eooo(θ v| o vi vi

4k 4k

Mb ro o ό ._. bop o ω pωro ro o __ro M ω 4k ωω ro o p o ro ωc b4k 4k vi k o ro M bo Kj ^ Lni i e c vico roi toto vi vi c vi v^ cn M Cc vico o 4kro co o roOT 4k C ro c ι k coo ooo co co cn OT ( o _ ro ω oo eo e ene eocn e ooe o n 4ke co ooo cocn eo c o v| vi ro v| vi 4 co vi 4k o 4k co vi _n-k ^ o o co c cn o ro co o M

4k 4k to

O o

ec c c c co ccβco _ c oo oo ecc coo c eβ e ( cco ccβ vi vivi ^

MMMI M- -J---J -JJO OO OOpOOOO-(0 _ (0 _ _ (0(0(0 _O C0 „ 0) - ffl _

4ke ro ococβvie eΛ4kC t ooeDc3vicnc 4ke M oθ(θevie cn4keoM o o(θc viotn 4keo M o o∞ xooo o OOO OO Z to

OOCDooo >zxc OoCDooo >zxo _J -_ X Z O OoOoOoooozxooooooo OO OOO Z X CD > OOOCD > I O OOCD > OCD > X ro o to o ro o O O ro o to ro to ττ ττττ ττ-f'-ι' -r'-/ O- -<^Ω--</θ--<^rrrnnrrmπrrmnrrmπrπmιrιrrnιrrrnnrnrnιrrrnn> >co>>_ >>_ >>_ >>w>>_o>>a>>>co>>w>>w>>>> >>>> >>>>>>>>>>>>0θ0O0O0OO00θθ0 >υi 73737373737373730i(nU)V) CO CΛCOC CCCCCCCCTJ TJ TJ TJ TJ TJ TJ TJ TJZ ZZ Z Z Z Z ZZ Z Z C CoωCOCΛCΛ CΛ

o o p o o o o o o oop p p pp p p ppo o oo o oo o o o oo o o o o oo o o o oo o o o o o co en en cn in cn en cn enencnencnenen4k 4k 4k 4k 4k 4k 4k 4k 4k eoeocoweoeoeo eocoioioro roM roroioM roroo _ _ _ _ _

c v| vi vi v4 vi vi ρ p p vi ρ 4kro ω 4k _4k co ro o _k oo rό rό o ό oo b to ω o i tob io coioi i i 4k ∞ sαsoωoiio jo -r ωωJioo - cni r i-irooo j o 4k co M o oo eo o(D vi cnen ( vi Men o c Oi 4k 4k c OT k co i

o o o o o o o ooo o o o oo o oo o ooooooooooooooooooo ro co cocoroio to eoro en co coco coco ro eo co eo en p oo eo ooen p oen p en vi 4k oip oi oi oi cn b vi ro b to vi b vib in b iob o o bfo co eo ooo4ko rocoo4kθcncooocn ocnocooo4k

4k o

O O

oooocncnoocsoopoQoooooooi looooco cooo oo oooo oo oo oo oo oo ooppp p mp p p p p oo oo oococo oo oo oo oooo oooooo oo oo viv|v|v| ivi ie c c e e ι i cncnoo cnen en oioi oi Cn tn 010l Ol 4k 4k 4 4k 4k K 4k 4k 4k CO CO co coco co co eo coeo ro ro ro ro ro oooi4keorooo(θθovienc eoroo oto oo vi cnen *k eo roo ocooo vi cn en 4k co ro o o to oo vi cnoι 4k coro oo co oo vi cnen

OOOZ I OOOOOOOOOO OOO Z X X X

> NmmooocD > ooooooo >zxo OoOooooo Z X O O CD > CD > ooooo Z ro o o OCD > Ω to to

• > f> j>> J>> f> s>> y> uCΛ) tCO uCOi uCΛ) CCOH cCn0 cCnΛ CCΛM —H i

ΩOOθmmrπmrnmrπrπmmmrπzz"',_z''"z:*"z',"z:''zzzzz cmcmcmcmcmcmct>— ι>— r— r r- rr—rmrπrπmmrπmrπx

>>>737373737373737373

_- _k _- _- ._. _- __ _k __ o __ _- _- _- __ _ _ _ _ _ „ _- _ _ _- __ __ _k O O O O O O O O O O O O O O O O O O O O O O O O

MN M M J - - - - - J - - -* J J θ O O O OO O O O O OO - _ _ _ (0 (D _ - (D _ 0) ffl O _ ffl N S N S N S ->| l O)

M M rO M _ k 4 CJl nc b oto c e Me

(o Sc co e

e M(o oo e (θ o vio c vi c ooooo roo oo(θNJcnen M o o vi oo(oeo (o co ( vi to o co o _ ro o _

cn 4kco.oco > o o 4 v|

4 CD θ vi cDθo

o oo ro rorovi cocoθ (o oo roeo cooo oo o o ooco co ro (θ (θ (θ(θ o o o o ro o o to 4_ to eo αoco oθ 4k co co ro o o co

irso) vvii renn rcnn rtnn tenn (toO moo iroo n αi o M J 4. κι renn ■vi vi eo CO vl CO O ' )θιotn5 o co vi roe co vvii 4^^ rroo ooii 4^ vv|i vi roe e oi en o ro oeo vi — isj tDoo oo o en o —- r ,o_ . v| vi k tp tn o ^ o ro

σooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

. ro„ . ro.. ro ro eo rororo roro ro io roro ro ro ro roeo4k co co ιo M ro toM to o __ ro ro ro ro ro ιoιo o ro roro ro ro ro coιo ro roro ro ro oo Mooeo eno enenco 4kOo o vi 4k4k o oioi oioocovi 4_ cn co 4k oovi " cn ιV| o ___ _ vl cθ CO Cn c 4 vi p eno o - o_o o .o pp4k _j p 4kro coP oo o enP P p into to b io b b tob b i o

(ooi oi o o_ ro. o_ 4.kcn eo co vi . e .o_ vi . o oPco oi en o o o o (oo (o o ko cn 4 k o r -o - o o - i o - o -o b roio i eo co eoco _ o--o o_oo_ cn o_o r.oeo o _ o _ o _ vi cnco o vi co o

(θ(o<θ(θ(θ(θ(θ(oωωω(θ(θ(θ(θ(θ(θ(θ(θ(θ(θ(θ(θ(θ(θ(oωcocomαα∞o)∞Φ∞∞∞

M M - M- t-O- IO- - - r-θ- rOM _ o — _ -_. _k _ - _ _ _ _k _k _ _ O C Cn o o c -o- O o- O o vi - O O o- θ o c- p n ^ θc ro Oo Oθ (_o(cOo tvO k co rooo cooo vi en oι 4k eo r i (σO CoOι COk Oco Oro O- oO ∞co oo Cvβi CσXo) ∞ oo vi cn cΛ 4 oι 4k co ro o _ t .o_ 0 -0 vl oooz_o^y=-i zzozoooooozx oooooo X OOOOO O O ^M^IIZZOZOOO > ii x OOOCD O O CD > X X IiXrn roxoNmσocD > ro o > iiim x x N m o o CD ro X X X X ro o ro to o _k ro ro o _

OΩOO>>>>>>>>>>>>>>>>>r" r" |- r" r" r~'- r" r" r~r"'- r~r_ r_ |- ,- ,->>>>>>>>>>>>> I- t- r-r- 7373737373737373737) 7) 7373733J 7373 ^^^^^^^^^^^^^^^i^l^}. ^ 3737373737373737373737373 zzzzooooooooooooooooocc=cccccccccmccccccoo(voooooooooo

oo en en en cn oi en cn cn oi en enen cnen cn en en cn cnen 4k 4k 4k 4k 4k 4k 4k 4k 4kco coco co eoco eo co co M io M ro rJ M ro ro ro to ro to ro rorororo o _ _ _k _ ro _ _ _ _ _ _ ro o roιoιoro roιorororo roiototo ro -k -k -k — oi vi oicnoo ro CDCDSooθ)(θ θ (o oo -k (ncnenuιωto ro e 4kcn 4 co cn oι cn (oro vi vioi 4k vl O pen vi _-. p cn p p o oι o o oo o en co vi ro vi eo co -vi co co o ro cno o M vi cD c oo 4k vi ro en ro 4- cD p 4- eono ecnn eeoo ccoo ccoo vvii ro noo co oo oo o o oo cn 4k co 5 vi o co co vi o oi oi vioo cn to oι θ ( vi cn oo vi ro cn ϋi

eo oo vi p p p ropωpopproropp _- _.4. p — r.o_ (Oo _k k _ pcoe oιoi4kθi 4kθi 4k vi oooo ϋio vico vi c e 4k 4 io to 4k to 4 co to — o io io vi b io '— r r - " i ■ '-M- '— '— j vi b is) v| _. ω b b ^- k b ω ω ω b k

(O OO -k CΛ O O — O -_■ -io _p ιr- -^- n ocnco e 4k o p e o oo 4 p cn e eo to vi -- M eo ro o co 4k tn o oo o 4k o ro vi ro -k _ _ o CO v| Cθ o rθ 4k O CO vl OO v| vi <oo ^ v| vi o _k cn S vi eeβ o ro o co vi oo vi o e o en o vi c-θ cn o co coo co o vi

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

MMMMM MMMrO NMMrONNMMM MMMMM oeo o _ c CΛ o p 4k o p opp 4k ω en ω 4k i o cn4k viω ι cn cn cΛ θi oι oι ιoco vi c to o co to bb b bb b in inin 4k in ro to e io bio b ro vi iΛ 4k b roto b ∞b 4k ioo

4k o cn co oo o oo o en eΛcn cno 4k cn 4k vi vio o ro θ(θθo o eDCoo o vi eo oo(θco co co co o o o o σ o o _k co vi eo 4k θ

4k

CO(0(OCOCO(OeOCO(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0(0 (0(0(0(0(0(0(0(0 cviv4vivivivivi |viviencnen(nenρe (nc eneΛe e ene CΛe eΛθioi4 4k k4k4k4k4k4k4k4ke c e —o cocoeocoeoeocoro θ(θcβ iccn4s rθ^o(θθo ioocn^ωMJθωooviΦ tωM-kθ(oαviσ)cn^cor Jθ(θcos vic oi4kc roooco

OOZ OOO

> o o CD

mmmwwWwwWww zzzzzzzzzzzmmmmmmmmmmmm-<-<-<-<-<ωωwwwwωωwcnt CΛCΛzzzzzzzz

N MM M N M M I N M M I M M - - - - J - - - - - J - - - J - - - - - - - - J -' - - - -' - - - - -' - - - -

- J Jθ OOOOOOOOOO _ _ (0 (0 (0(010 (0(0 (0(0(D _αi _ 0) _ S Svl S v| S S vl N Cn fflO) 0)Cnθ) CI)0)

__roo_k______Λ_____roMMt r roroMo _roι Mo__roMMroMMM oι M

(θθ(oωωcoωtncnpspNθopω uωi.j ^(opopooopcooo)ui Q robe ro to^ol_.viroini totoboroc ^ ^ol_._kbbbotoi w oeΛ4kvivi Doe4kM θCΛC θc ro4kc (θ4ke c copco4kMeoenooenoιo4k<nιovicncΛθopcc 4^ vi4^viMviMv|__rocnvic)oo__roMc cnvirovico( oi4 θcocovioe o_c (no_vi_cΛto^ vi vi to co co ocooop po^^^ω rororoo-kro^ ^ vivivivivjooωcΛa co to o co ro r ϋivivi opo kr .o_ 4 ,-k -i c _nrι.b or eOo- ..ra o _o_ -mm(l) oQmeo3re-vviiro)'vsiiraookro)fflcn_4kraoo_4k-oroιωcojoroιmoo_4korotoviooocooi ro co p r .o_ 4τk-tocorococo4ko koottoo44kkvv||oooorroorroo44kkcn n

CO vl k encneno_-.cnrooovivivienoroeoroocnen c cop4koeoeonoccnoe4krθoιtronorop4kv4kioPιcennevniecnncrooecnoo4kcθoocDoooceoo44kkeeoneconrroooo eo

ooooooooooooooooooooooooooooooσooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooooo

M pN(oωcnrpMeΛMCΛp^CcoWρωpωppωωpcoMpNroMopMMeorroMcoN4kCNΛMθoMcn(roNeΛωenoeΛ4kCΛeneΛcoen(ncDvicorocoo--cnencnooeo4ko cΛi tobbbωr in^^bρro^bovitocob'4 to toio^bo ocnoooooroooocnocnoco cneooooooo4kco cooιorooocoroenroco{θ4kθooeooroeoooroooovioooo vioocntorocoooococnenroen

_ __ _ _ _ _ __ ____ __ _ _ _ _ __ _ _ _ _ _ _ _ _ _ _ __ cococo cococoto<o -oco (β(θco

000000000000000000000000000000000 (0 (0(0 (0(0 (0(0 (0(0 (00000000000 p 000000 cococo rotθM i fororoιo MM o __ _k __ __ ._. _- __ __ __ o oo oopo o o o tooo vi cn cn 4k ω ro rj __ o co oovi coen4k w to o o iooo vi oooi 4kco ro o o co oo vi cncn * co io o o

XOOOOOOOOOOZXOOOOOOOZXOOOOOOOO OO I I

Nm CDOOO> OoCDo i)r-πko r o- ocD > OOOCD __ ro o > r roπi-noo- > O OO o o oo>z X OO O OO O O CD

TxJ TxJ TxJ TxJ TxJ TxJ TxJ TxJTxJxι_xTJxTjp ppp p p p ppθOOOO OOOO JTJ T) TITJ TJ Tj ωC0CΛCΛC0CΛ CΛC0 p p p p p p mmmmmmrnmrnmmmmmmmmmmmm cpcccr_:c~ccccooooooo^^^^^^Jfs

M mcrnIeSn) reOn Menrenr(nernNcn) r(On(Mn MenrcnrcnNoi roOi MoiIoi MoiMoiroir4k r4kM4k M4kr4Ok 4k 4k 4k 4k 4k coco cococo eo co M io io ro ro M M ro o _ _ _ _ roroMroM ro o o roo p __ _k oo to bo'vi en ro b to ocno v-v|i tcon eono ecno o*o. cvoi

2vi to vi -vi cn cncnen eoo ro ro eo 4k4k co cororotoroco r e o cb o o o _k ro cntn cn coco en cn ro en ro co en en cn cno vl tO v| 00 vl o cooiro ooooco eo eo o cn co oo o ro ro ooro 4k o coco

2 en e eΛ M cnρ roM co co cD θ 4k 4k 4k θ vi ro M 4k c vi - _ r -o- e-o- 4k - co cΛ θo cn co o co coc vi k cn c co 4k

oi 4k cn co v| o 4k to o en Jk oσoooooooooooooooooooooooooooooooooooooooooooooooooo ooooooooooooooooooooooooooσooooooooooooooooooooooooo tocoeo ω eoM eoMco eoco eo ro roM Co eo co eoeoco M vi vi vi cn 4k 4k co 4k co M M M coeo M M toM roM co M M ω oi kcn o c (O i (ooo oo( e cnoo roe>- ( ene (nen(no o__ oo o p ro 4k 4k p vi vi oi oi vi ro b o b ∞ cΛc in vito 4k io rob in b v bto b ro∞ i iΛ o ro b ώ b ∞ o oi eo co oo o * ^oιS 4k i b e)oo eno o o ooco en oen eocne _i n o - eo - vi . eooi o co oo oo e _n- vi. o._i e_n. e .n- c_no._i o_ o co vi to o _ co _ o co ro vi co eo

. O

o CBoCococ eo_oviovioviovioviovioviovioviovioc ooocnoenoenopocnoeno(notnocnocnoenocnoenocnocnoe ocnoeno4ko4ko4ko4ko4 o4 o4ko4 o4ko4kowoooooo

4 co ro o o co rvicn cΛ 4kc M o o co eo vi ooc 4 Co ιo o o( e vi c cn 4k Co ro o o co eo vi oi 4k co M o o to c

eoco co co eo co eo coco co eo coco eocoeo co eo eo ro MM roro io fOMtoto roM M M to toro io M to ro M _k _k _k _k _k _k _ oo o ooo ooo o o o _ (θ _ (θ(θ(o cθ(θ(θ(θ(θ(o eβ cβ e _ cβ c c ooe3 ccβ ex) c rporcoθrporvolrporporpo rooirJor4o_rpo ocθroo -θOk rOoroorroorθoroo to iob o to '4k in o i o o o bo o oo to v| 0001 o p v| C0 C04k 4k p o 0004k vl 00

-k co vi o 4k vi ro o o co 4k oo 4k en o r 2o ro -k n

04^ co 4^.4^ rόc roo ooc o — — ororo ro o __ __ o 6 e 6 o b b o ooo o ro ιo o o oo o _ r oo ecoo eenn eeoo ttoo --ii cco rotooi cn cnco oocn oi viro o o -- 4k 4k ro co eoco ro o cn to to bio io to to io o bι ro in b in ro in bo 4k o o—i t —oi Oo 44kk oo roco co v! vico ooeo oo o 4k co eo vi en o ro eo ep o cn ro roMcooococn-iCobo cnocn coϋi -kO O vl o co 4^ cn e~n e~n oco eo vi vico ooo oo o ro cneo ro o ro cn o cn co oi o 8 o-o to oi to 2 4k vi r vi coco o co ro v| vi co o vi ro oo vi oo o o oo v|

Ul CO C04k 4k 4k 4k 4k 4k 4k 4 4k k 4k k 4k 4k k 4 4 k ro

(θ(θ o coo o roco co cn cn 5 S to ιoro co en 4k 4k eo n ooc o 4nk eCn 4kro 4kbC0 roo vi vio vi ro en vi oo roto oo ro cn o ro co eoro co o oo oo tn eo cn o ^ cnro o co o vieo ro o vi o cnen o co oo ro :2 4k co in in 00 v| C0 rθ v| co oo o en o vi vi oo co co vi o co en cn ro

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooσooooooooooooooooooooooooooooooooooooooooooo oo-vi vioo vi vi cn roro ro 4k oien enoicn cn en 4k ro ro ro ro rororo co 4k 4k co 4k ro ro ro tooo tn 4k 4k to 4k 4k co eo ro ro 4k co co co eo co co(θCΛ o co 4k v4p cΛ viro o op vi p ro ρ (θ vi vivip ro k ro o cn c en oi eo vioi o tD oo ro to vi oi oi 4k vi vi vi vi in i - vi - r0) 44kkbU ebibU viύlιrNo to_ -o bUI b_ Nro i-Λ1b- to_ bWo(toUrISo)viNro eUΛl Vvi| 4kk iUΛ10 o oU oU oυ OU -vl CO vi co oo oo co o o o eo ro co o to co vi co co ro ro oo oocoo _k_kθ oo o ^k θooro ro eo o to ro 4kro cncoo o o ovi co cD ro oι co oo vi o ocn ro 4 cn 4 4k

s

o _ _ _ _ _k _k _ _ _ _ o O O O O O O O O O O O O O O eo co eo co to to cororo roroioio rotoro ro o O O O O O O O O O O CO (0 (0 (0 (0 (0 (0 (0 (0 (00000000000 cooι 4k co ro o o(θθo viαooi 4k coto o (O oovien oi 4k _oro θ(θ oovi αo cΛ 4k co roo oco oo vi oo oι 4k toro oo cooo vi cn en

OOOOOO OOO OZ* ro o -_z OOOOOOO Z X Nm r mσo oocD > i Nl N Nl Nmooco > OOOZNJO __OO o o r > II OOOOZ OOOOOOOO O OOOCD O O to o > m rom ooocD > oo ro to

mmmrnmmmmm rπmrnmww wω oω β < -<-<-<zzzzzzzzzzzcccccccccc"DT)

eo co eo _ eo co co coco eoco co eo coeo co eo co eocoeo eoeoeo c co co e c eo eo eo co co coco co co coco eo co co eo co eo coco co co co co cncn cn oo cn co cncoooo (-n cn en en oioi oi Oi oi oioi oi oi oioi 4k 4k 4k 4^ 4k eo co eo co co eoco coco co co ro ro ro to ro ro toro ro ro o _k to

M o roro roro rororo ro o _k _. __ _-, _. _k _-. __ _-, _k __ _k __ _-, __ __ _-. _k ro o co ooro o __ro oto ro 4k co vico co 4k cnvito covi viσocn cncn cn CΛ Co vi 4k eo 4kcn 4kθi oι cn (θoo oo oooo vioι oo vi oo o oo vico ooro o co oo viorooo coσo cn S vi vi eo to 4 4 oθoo r i __α) | v|_k __cΛ co o oo roto 4k o _k ro eo c eo o n cn 4 o 4k co to vl v| v| vioo vioo ooιoviooe vicn oo v| CO CO v| Mco t M 4 θo c (o c cnro vi c viooto eoo o _ .oo poio _k co oo co vi o o o co co ro oro en vioιoo 4k vico vi oι co eo oι eo to _k _ 4k o oo tocn (O ocn en eo cn coro 4 vi oo viro O O CO 4k eo ro CO vl oi cn CO 4k eo o ro ro o ό __ _k θ o ob oobco o <b ιό o _x 4k rό c (θ 4k iόr 4k 4k en o o o c ∞ cn cΛ 6o ι eo ioiι 4k bρ bo b co oo v| 4k CO tO C0000101 CO o 4k Cn θl 4k o p cn vi vi cn o Qocop o oo ro co cΛ viω orj_ωr_θ)p - Oι co co co en tn CO o v| to cn Λ vi ro o tp cp o vi oirocnto Jk ro ... o 4k co cn en 4kc 4 o to o e oi σco oo o cn (o o o vi ro 4k 4 4kk 4k o o 004k n en oo 4k o _- eθ(θ 4k v| 4^ δ eo c 4^ ro ro c _5 — Bk o cn vi co vi vi co rotD Oo vi co -vi oo co co oo co o o v| O co

4k 4k 4k oi 4k oi eenn 4k θi 4k i en eη oo eo oo o co o ro COθ θ o 4Ϊk o viivoi eoniocoooooteoo r-ovi oω_ cn ro o)ι o co o vi cn co o o

0001 o tO o

o o o ooooooooooo oooooooooooooooooooooooooooo o o o ooooooo to CO M eo c eo co 4k 4k 4k c toro M M vi v| __ __ (θ (o co co co ro oo oo eΛ o o ro vi ω pp vi vi s o poι*o)pcno to bo vi co co co ro 4k cncnenoo oo cn (o , ι enio 4k bo to b io o ro 0 C0 v| 4k o C000000000000

--j j2 oo 4k ioto ιo o ro

4k to

O

eβcoocβcecβeeβvivivivivivivivivivicncnooσocnp cncnencnenenenenencn 0101010l 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k C CO tO oovicnoi4kCorooθ(ooovicnoι4keorooocooovicneΛ4ke -or -o o co oo vi cn cn cotooocooovicncn4kcoιoo ocooovi oooozxoooozxooooooozxx OOOOOZXOOOOOOOOZωroo

CD > CD > OOOCD > Ω zooooooo z x to o OCD > mmoocD > ill N m o o CD >

(noi(ΛM „>>>>>>rrrrrrrrr-M„ MwWM „MOOO TJ X 7373737373>> >>>rZ l :CC:cZCZClCZ737373737373737)CZCZκZ:c^ m

4k 4k 4k 4k 4k 4k 4k 4k 4- 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k COeoCO eoCOeo cO COeo COCO CO CO COCOCO COCO CO CO CO CO CO CO eo co CO CO CO CO tO CO roM M ro ro o _k _ ^ __ _k θ o ooo o o o o co(D (θ (θto eoco (θeoo cβco c ω cD θoco c oo vi vi vi vi vi vi vi vi vi vi vi ^ rororoo

-J kcoco o

coocro(θθoιc nooeΛθcoocoo^_k_ _(n( o4-ooιvirovi4_cnotooιcoooooviviviooc coc vi∞ o p ro

—o _4kto 4kco ι oooo

vioιoι

rorororo roio rorofororo Mroro io roro to ro roro ro

4k coeo co cocoeo cocococo rororo to ro ιo ιo to o eooo vi cn eΛ 4kCoro S3 MroMtoMMM MMMto to Mioio ro roro ro o _k _-. __ _-, _-. _-. _ _-, _ oo o o oo _ oO oO oO oO CO CO CO CO CO CO CD CO CO CO OO

O (000 vl 00 Ol 4k C0 rθ o eo oo vioooι 4k co ro o o eo oo vi oo en 4k co ro o o co oo vi oo υι 4k co ro o o co

XOoOoOoOoOOO>ZXOOOOOOOOOZXOOO>ZXOOOOOOOZXOOOOOOZXOOOOOOOZ -k D > OoO > O roo r oOD OrooCD > OroOo CD > o o

CCE!^ T)OOOOECCCCCCCC:<< :<^<->< >>> > wc co m cmczmzmczrcπmcmcrczπrcπrczπrcπmczrcπrcn. mmrπrπr-r-r-r-r-rnrπrπrπrπrπrπmm >>>>>>>w CCC C -<-< - -< - CCCC CCCC C r- r- r- r- r- r- r- r- τJ TJ TJ TJ TJ TJTJ TJTJ ^j ^J^j

4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k k 4k 4k4k k4k 4k k 4k4k 4 4k 4k 4k4 4k4k4k 4k k k k 4k 4 4k 4k 4k 4k 4k 4k k 4k 4k 4k 4k 4k 4k 4k

∞ ∞ c oooo c tt vi vi vi vi vivi vi vi vio>(n en co _ cΛCΛ CΛ CΛ cncΛθicn oι 4k 4k 4- 4k 4k 4k 4k coco co co co coco co co to ro ro ro co M eo co M roM roco ro roto Mtoro toM eororo eoco eo co oo viooωoo ocn oocooocn vi co co ro oocooo cocnro ro o ro rooop ooo cnrocovi oo o ro roco rooi vi cotnoo4kcoen oco4koco ooooeorocn ocΛCΛ vicacΛ __ otoc θ oo vi vi oco oM vicn ero vi k _k cn co ooro vi

o cn cn en 4k 4k eo ωM pc pc p o _k o cn cn en oo vi cn cn 4k co ccoo coo c4n_ vi co 4k coc _nr.o_ o r -o- o'— c'—o toin o vi to oo ro o 2 C C (OoCΛM 4k θoθ Ol vl D W Cfl - Oi ni - Jk

- - -- - - - - ;K oo eo - vi cn 4k 4k ro - ococo o cn

ro oo co rocn ro co co cn cn en cnoiencncn4k 4kcnencne enn conioioioioi oioio _i k 4 4k k CΛCΛ4k 4k 4k 4k 4kcncne encnen en en en cn en cnen oioi oioioioioi oioi oo o o o oo to oo co c 4k co o _k __ _ θo oo co co co o O OO CO CO OO CO O o 4_ cn k k ro ro eo 4k 4 o o _ o to ρ 4 vi vi o _kθoo cΛ θo kco cneo 4ko rooro vip 4k eo vi - co co o tO (O 44kk vvi| cn ro tn in ro en vi roin to b to — b o cn

4 -k e .o. c.n_ c.o. p_ cni o_ e —o vi ■ ∞o ϋio roo o o ^ co oo ro oo Qω o o_o v .| ( -Xi vi c 4k o ro iocn 4k co c cn c - vvii 44k ccn 44kk — 4k co ω oo όo oi eo c ~n co e cn cn ecnn oo oo ^ o cneocnrotoro 2eo ococnenen ococoo v| C04k C0 C0 C0 vl o 00 C04k 000 C04 4kk 00l1 O0004k vl cθ vi O CO OO

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo rv)- -MN)rON)MI K)N rJUroi rON)N)rOr K)UrOMUN}N eΛ(θ e 4k ro e 4kp jθ 4k pcΛ ω co o 4_ ioι i _ ι _ vi cn{θ vi cΛθi 4k o vj cn vi vi _k θi vi k r^ b ^ to to 4k C torob ∞ o vi Lk oto 4k o b4k r4 o bino cΛ to vib ω M θ(ocΛθoeo o <o4k _ ocnencoeno4k θoeoocΛencoo oeno ocnoo4k Coo(oo- roo coeo(ooo o v| o ωroo o o θ(θ

1241 N ASN 149 128.742 12.845 48.203 1.00 23.38

1242 CA ASN 149 128.210 12.801 46.850 1.00 20.71

1243 C ASN 149 126.781 12.269 46.809 1.00 25.14

1244 0 ASN 149 125.990 12.678 45.956 1.00 25.34

1245 CB ASN 149 129.125 12.008 45.932 1.00 15.21

1246 CG ASN 149 130.320 12.817 45.489 1.00 19.96

1247 OD1 ASN 1^9 ' 131.340 12.856 46.167 1.00 34.43

1248 ND2 ASN 149 130.185 13.505 44.369 1.00 25.72

1249 H ASN 149 129.509 12.271 48.444 1.00 25.00

1250 1 HD2 ! ASN 149 130.969 14.021 44.090 1.00 25.00

1251 2HD2 ! ASN 149 129.340 13.468 43.887 1.00 25.00

1252 N LEU 150 126.445 11.379 47.743 1.00 21.91

1253 CA LEU 150 125.096 10.829 47.827 1.00 24.64

1254 C LEU 150 124.171 11.938 48.330 1.00 22.13

1255 0 LEU 150 123.058 12.104 47.831 1.00 27.92

1256 CB LEU 150 125.051 9.630 48.780 1.00 17.59

1257 CG LEU 150 123.659 9.057 49.062 1.00 21.25

1258 CD1 LEU 150 123.054 8.510 47.780 1.00 18.26

1259 CD2 LEU 150 123.739 7.976 50.118 1.00 19.18

1260 H LEU 150 127.125 11.076 48.382 1.00 25.00

1261 N TYR 151 124.652 12.706 49.301 1.00 20.18

1262 CA TYR 151 123.892 13.818 49.858 1.00 20.96

1263 C TYR 151 123.533 14.798 48.738 1.00 19.39

1264 0 TYR 151 122.380 15.204 48.592 1.00 21.76

1265 CB TYR 151 124.723 14.535 50.929 1.00 20.29

1266 CG TYR 151 124.115 15.828 51.418 1.00 22.32

1267 CD1 TYR 151 123.202 15.834 52.470 1.00 20.29

1268 CD2 TYR 151 124.432 17.047 50.811 1.00 21.17

1269 CE1 TYR 151 122.614 17.021 52.907 1.00 20.42

1270 CE2 TYR 151 123.850 18.236 51.237 1.00 21.39

1271 CZ TYR 151 122.940 18.214 52.285 1.00 22.07

1272 OH TYR 151 122.337 19.377 52.696 1.00 21.54

1273 H TYR 151 125.542 12.522 49.655 1.00 25.00

1274 HH TYR 151 121.769 19.210 53.457 1.00 25.00

12775 N GLU 152 124.532 15.194 47.959 1.00 21.41

1276 CA GLU 152 124.316 16.128 46.863 1.00 19.05

1277 C GLU 152 123.388 15.546 45.800 1.00 23.34

1278 0 GLU 152 122.540 16.259 45.260 1.00 21.99

1279 CB GLU 152 125.653 16.544 46.235 1.00 23.58

1280 CG GLU 152 126.641 17.236 47.198 1.00 23.54

1281 CD GLU 152 126.245 18.662 47.577 1.00 27.07

1282 OE1 GLU 152 125.046 19.009 47.529 1.00 30.35

1283 OE2 GLU 152 127.145 19.444 47.935 1.00 23.20

1284 H GLU 152 125.434 14.851 48.136 1.00 25.00

1285 N ALA 153 123.530 14.248 45.526 1.00 24.42

1286 CA ALA 153 122.706 13.565 44.526 1.00 22.61

1287 C ALA 153 121.251 13.409 44.964 1.00 19.49

1288 0 ALA 153 120.342 13.450 44.138 1.00 21.30

1289 CB ALA 153 123.300 12.203 44.186 1.00 21.47

1290 H ALA 153 124.211 13.731 46.006 1.00 25.00

1291 N SER 154 121.026 13.262 46.264 1.00 16.33

1292 CA SER 154 119.672 13.105 46.776 1.00 21.77 4k

ωcoωcoωωωωωωcoωcoωωuωωωωωωωωωωωωuωωωωωωωcoωωωωcococorororor t t is)

4k 4k 4k 4k CO CO CO CO CO C eoeo coco ro ro ro ro ro ro rorororo o _-, __ __ _-, _ _ _-, o o O O O O O O O O O CO tO CO CO CO CO CO co ro o oto oo vien oι 4k < co ro oo (0 oo vi oo en 4k coro o o(00ovi en oi 4k co ro O CO OO v| OO CΛ 4k CO tO o o cθ OO v| CO CΛ 4k CO

XOOOOOOZ_ =-^^XIZZOZOOOOOOZXOOOOOOZXXXZOOZOOOOOZXX o o o o o co > ii r D ro o X X X X π x roxoNmooco > OOCD ro o > m roo r ron m o σ M σ o o cα > o ro to o __

H H HH H H HH> > > > > >> > > > > > > > > > > < < < < < < < < X XX X X X X XX X X X X C Co ω CΛ COCθ

J 7Z3^7 Z7C3J73i^73^73373^77G37Ω37Ω37G37G37G37Ω37G37Ω37G3737Ω37Ω37G37G37Ω37G3>^>^>r->r->r->r->r->r-ωCΛcωΛUUiiϋωiϋωi(ωΛtoυi n (Λωω^ 73-7n3-7n3^737-n3-7n3

Ol Ol OI Ol Ol Ol OI Ol OI OI Ol Cn CΛ CΛ Ol CΛ Cn CΛ CΛ CΛ Ol OI OI Ol Ol CΛ CΛ CΛ CΛ CΛ OI OI CΛ CΛ CΛCΛ CΛ CΛ CΛ CΛ CΛ CΛ CΛ Cn CΛ Cn cn Cn Ol CΛ CΛ Ol C e 00 C 00 C e O0 v| vl v| v| v| v| vi vi v| v| v| v| v| vi vl v| v| en cncn cn cncn cn cn oi encn cn en en cn cnoi cn cn cn en *- 4k J^ 4k 4k 4k

_ _ _ _ _ _ _ _ _ _ _ _ _ _ -k -k _k -k -k _k _ _ _ __ -k _k roιo o _ _ -- -k _k roto o o o ro o _ _ _ _ _ _ ro o _ _ _

4 c roM o ^ ocopro c ωc c 4k 4k 4k4kc 4k po vi ∞ρop ppo vj c-ocDtocoo co ω o o co vieo i v|vi v| o ro toeΛiΛ iob to bo toco vi vi robcΛ 4k toroM θ(θ co en cΛ vi c oeΛ CΛ eo 4k o viro o vi cn o co toep(n ro ιo oo 4k(oenen e c eo o cΛ θι oo ω r o oo o oi (θ o cn cn {θ 4k Mc c eo (θ 4k o c e)o * cn(θ (θ (θ o _k ^ cΛ eo c c vi - n o o cn (o co to o o co cn ro ∞ co o ro o r e ro 4k oi 4k ro 4k 4k co ro ro eo ro 4k eo c 4k cn 4k c cn 4k 4 cn oi (-o vi c oo oo c)o vi p vi vi O0 Cn CΛ 4k CO Cθ rθ 4k 4k 4 co "vi 4k o o bo to n to jsj io vi b o o io cβ vi ro io ro iΛ to to vi to b to to '4k '4k b o σ. bo o to to to vi ik bo ro to bo io to co o o o oo en O 4k cn v| co OO Vl o vi e -Λ o - t -o - o o - cn CtoD CcΛΛ 4k vl c —n vi t — ro co to 4k e -n -r- cn ro o o ro oo o oi co to oi 4k cn ■vi co co co —oo co cΛ co 4- cD o σo eo o vi 4k 83 cD o o oo to vi vi ocoen o co to ro o 4k 4k ro ro eo 4k (001 vl 0 C0 C000 o o 00 C0

4k CO CO C0 r- r- r- r*- r. r,'- r*- r- o ooeo eo k 0) 0) 0) 0) C0000) 0)

4k vib i bι b io bo to b ro io 4k roc c o _ co cnco cn■, o c —o co o oo oo o — vi r i ro n o o _ cθ _ o OO c4_

4k

O

coco cococo ωωcocoωcoωωcowco coco cococoωωωco ωwωωωω coco cocoto coco coωωωω ω coω coωco co wco co co p(θ _ eo _ cnoooooo oop ca _ co cβ vi viv| vi v|vi vi v| vi vi cocnenen cn o (ncn en e ^ eo t o θ(oe vjcnt ωMo o _ oovi c c 4k c M o oeooo vien e 4k e ιoo θ (θ c vi encΛ 4^ o coooo >zxo OoOoOoCDooo o ro o >zxo OoOooDooo to o >zxo OoOoOoCDooo to o >zxo coooo >zx mx rooxz o mo to mo o σz o σo -k oo cooo >z Ω _ r m- rm- rm- rm- rm;FmPmPmPmFmFmFmFmFfπw>o>co>co>w>ω>w>cow> >w> > > > > > > > > > >> > > X X X X X X X X X X X X X H

cn cnen cn cncncn cn cn iΛ oi oi oi oi oi oi oi oi oi oi oi oi oi

- -k -k -k OO OO OO -

_ _ _ _ _ _ _ _ _k _k _k __ _k _ __000o __ __ _. _k __ __ __ __ _-. __ __ __ _k __ _ ____ _000000 OOOOOOO o — vienencn cn 4k cnvip pcn pp 4kro p ca _ ppco o ro ro 4k 4k 4k peo ioo o o __ o p cncn pcncn v| CO v| v| p lO CO O o foooeneoo o kcorovi oco ^ ∞en too o toeo bcoto toiΛin o ^ ro io ioiΛio oto ∞ ioto io co co o o o co oprooi uico eoeoooop eo o Q o co eo ro o c to -o. e _n. o cn cnoc roo _ cn ro ocn cn oo to vi cn oo o co co cneo coen o co rθCOCOO CΛ o 4_coeΛ 04k C04k C04kCΛ CO 2 cn vj _ MC 4 _ 4 (oco 4k( eΛ vi oo e co 4k vi oo θ 4k cocn ro o to vi coo oo o to en

00 CD 00 v| OO 4k ro to co 4k Ol 4k 4 Ol 4k Ol Ol k vi oo vi ooeo ooeo rooι eΛ 4k co co o ro o bιO '_ 4k 4 vi c_o boo inι benι vi o cn ep eo oo bo C04k tΛ rI bU] 4kbC-) COetΛnb' . vii ω io to j- ro vi 4k co co -vi p oo (cpp vv|ivviicono en ro eo J- _ eo p o Q- o r cn p vi o (O o cneo vi cn vi ro to ro eo 2 J>. O o __ vj k ro co co oo o CΛ o

4k o _ - o 4k θoco ro o oto co ooo

4k 4k 4k 4k k k . 4 4k 4k 4k 4k 4k 4 4k 4k k 4 4k 4k 4k 4k 4. k 4k 4k 4k 4k 4k C _O k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k CO e Oni coo vviioσo αooo 4-k rroo 44kkco 4k vvii coo oei oirroorroo 44kk 4kk 44kkoo cn 4kkcpo oo oo oo trOo 44k CcOo trOo • oo oooo o _ o ooo o co o ro co o co o _ ro to b34k bobo b 4ktobι 4k co 4k bιbbobo vi p to vito' vvji ecnneinnob oboorroo oinoeinnrroo ebn o coo o co en pio p o ro ro to co oi 4k vi o co oo

Sop(ocooo to -vi __ coeo cn - 4-k- v „|iDO0004' e~n eo o (oe —o vi oooo o oo ooo o o 4k co 4k p vi r -o 4-k P-- c-n 4 o vi

O ->lθ O( vθlo Olι vo|5 CO " cncΛcocn "cncΛCΛcoo oocn ooocn l to viroooo cocoo rooeorocooi vioi oo cnJk cn i cn -vi ro cn vl vl

ooooooooooooooooooooσooooooooooooooooooooooooooooooo ooooooooooooooooooooooooooooooooooooσooooooooooooooo co coco co co ro σo 4kcn 4k 4k 4k 4 4k to vi en en enco 4k 4 4k roe eo ωp 4k 4k 4k 4k to ro coco c co roro oto ro to roro co coro ro to o cnro ω -vi p ppp vi ro p cn eo vi cocn vi 4kenen enroeo 4 4k o __o o en cn vicn to cn en en ω > oo 4k tocn eocovi cn cΛ iniΛCΛ in b ωto --. lθ in io vi bρb oσ viro cocnro ococΛ iorθ 4k viro 4k θ 4k enco cnvi b b b bi vi vi oo o o oo cn co vi p eo co vj co -oo vi c jj c cn en vi vioeo ooeΛ ttea vi cDO ocΛo jktoco vicn o o oω

4k 4k 4k 4k 4k k 4 4k 4 4 4k 4k 4k 4k k 4k 4k 4k 4k 4k 4 4k 4 k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 CO CO CO 4k4k eoωeoeoeopeo eoωcoMt MioMroMtororoo_ _ _-. _ __-. _ _ _ o ooo oo oooo cD co cD oo vi oo 014k eo ro o eo oo vi cn CΛ ^ co ιo o otoe vi cncΛ 4k _o to o o (θ oo vi co oι 4kco ro o o co oovi cn en 4k eo ro o o co oo vi oooooozxoooozxo oo OOOOOOO

OoOO CDooo >zxo CDooo >zxo O σ o o CD > oo > OoOoOoCDooo >z oo o m m σ o co > ro o ro o ro o tO o oo

TJ TJ TJTJTJ TJ TJTJ; xxxxxxxx! mrπmmrπmrπrπmj OOOOOOOOOO m m m rn mrnmmrnrnmm _________

vi v4 vi vi vi v| vivicD coen (n cn cncn cncn en cncncnen(nuooooooooouo oo oo oooo oooooo oo oo oo oo oocn cn cn cn cn cn cn cn oo oo oo oo(θ (n(θ (θ (o eocβ oo oo e)o eeoooooo viv| vi vi vi vi en cn ene σ) (ncn cnen cn cΛ CΛeΛ eΛ cn cn cn en cn 4k 4k 4- ^ to toro ro roM ωjs) is)oω o bb ώ to vj cΛ (θ vi 4k oooιc een

enCΛ Cn v| COCD OO COo θ O O o __ θ eΛ CΛ 4kCO M I rθ o cβpp p θθ p pp vip p cp vi vi p p pC v| vl cθ p ∞ vl CO 00 ifl i i i 4k 4 4kk inifl to into en to 4k 'vi io bio4k o ^ r o to 4^ vi ro — cn vi co eo c 4 Mmcvicnvico4k ωcΛOT CCΛi op∞(oω cocΛ(θ! vio oι wω co co cooo ro co o ~ o — en oeororo eo . cn k v| _k cnc eoS oM roro(oe co e e ιo oo o o 4k M M cn o coco c ro(o 2 4k CO CO

CΛ CΛ CΛ CΛ CΛ CΛ CΛ CΛ Ol enoioi oi oi CΛ Cn CΛ CΛ CΛ 4k CΛ CΛ CΛ CΛ CΛ CΛ Cn C „Λ.01. 01. Cn.4 _k en 4 en oi . oi en 4 4 k 4k coen 4k 4 θocn oι oιco vienen ro ro 4_ _ o o eo o o o o c 4k co eo too vi o ooo o co o ocooocncn co oo vi vicnoιen en4kcoc ao 8. b t>o- b u iwo'vvii rrosibuiiiU _- _ __ _. _ _ oι bι o inioroiobι bo bo oiro o v||N ro _ o p r p | t enp p v|i5 p oliC enP ω'' , c~ne mo(mθ( ron ooon o 4k cncnenrococoooro o

Is.opvipcoroeo vip coto eo to oitoco oen KviS oWio-' Cn O. O ul ul N CD I . - CO O CO OO CO cΛ

-k k — 4k 00 CO CΛ 00 CO k en oi en ro o ro 4k cD o co to cooι co o vi oι oo vi ro o oι

OoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOoOo oooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooo coeororo coeo ro coro eo co eococoio ro ro ro ro ω co rocoro roeoeoeo co ro vi vi cn cn 4k 4k 4k co ro cn <-n cn cn co co co coco !o co ro co o oeD vi -k top vi vi ro to p 4k |0(04kOien 4k C004k Ol 4k 4k vi -ko p p vi p p coeo o co en en ro ro cn o cn cn io io io in to to o vib bto to cn wbio bi 4k vi o o ro eoocn 4k b b b b b roto to 4k o ∞ b 4k to bo b to vi ιcnin b oι vi bι eo cΛ o ro oeo 4k θθ θo o oco cΛθ o eno eo vi - c-oc-o c-n o- e-n o roen vi oen *. (Oto ooo ro o o ro o co co o o cn ro vi o co 4k eo

to

O

CΛ4 4k4k4 4k4k4 4 4 4 4 4 4k4k4k4 4k4 4 4k4k4 4k4k4k4k4-4k4k4k4k4k -44k44kk44kk 44k4kk44k4k.4-k4k4kk44k4kk4 4-k44 44k 4k 4k 4k θ(θ_(θ(θ(op(θ(o_(θ_(ooecόoooeoocβviviv|vivivivivivivicncn(ncnOT Ol Ol Ol Ol 4k θ(θoovicneΛ kc Moo_covicooι4ke M ocoooviencΛ4ke Mooooov4cncΛ4 eoιooθ(ocnv4cnoι4^ O O xoOoOoOoCDooo>zxmxoxzoozoooooz OOOCD > O OoOoCDo o >: xxooooo Z X OOO roo ro — mr mooocD > oo oooozxxo o ro o ro o _ ro o O 03 > N m m ro r-r-r-r-r-r-r-r-r-ixxxixiixxx mmmmmm j ----------ωxx ^mm -ω-ω , ,m-pmpmpmpmpmpmpiHHHHHH-HHHCococococoωcoωτjτJTJTj

73i7373i73i73i73x73x73i73m73-7π3m73m73m73737373mm m

S v!SN vJS v|S M v|SSvJ S vl SSv| Mv|v| vlv! Mv|v! v| v|v|vJv| M v|vl v| S v|v| S v|v! enoιθ!θioι oι oιoιoι 4k 4k 4 4 4 4k 4k 4 4 4k 4k 4 4k _ e e e c c eoc c ι M ro ι M ro ro ro ro o _ _ _ _ _ _ _ o o o o

MIOtOI MMMrO MMIOI MI MMMr lorol MM orO totoiororso rororororororo rorofororotorororotoo ro ro ro oo(vi ivi vi vi p ^^ en vie k -kjόK5 o 4 4kK5 o o o _k θ o eo oro to r c 4 c to o cD 4k co

'-k _ oto 4k to ώ ∞tobo roeo'4k tobo*vi'vi 4k ro io roρoio So O OO COCOOOCΛ CDCO rOCOω vi vi vieo oo eo co oo oooi ro to o 4 4kk oooooooooo Mro e(oo troo vvii vviicΛ _opeΛ θo(θωoco enen ro keo _ o po eogi o vi k ω ωp oi oo rocn cn to o ro en oo o vic ω vi vi >! io (O m o o oo o __ __ _oooco ocn ιo to oi to oo ro to oo B o cn o oo c -o - c -o 4kvi oo vi _ oo co ro vi cn eo en

ooooooooooooooooooooooooooooo ooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooo

Mo___rororocotorotocoeoco4k4keocoeocororoen4k4k4ktoco cΛcocopoovico4kpρpρρpcocoιoιorooovioιooωooιo4ko cocorotoo — roroeororororocorocoiorotoroeoroeo vi4k ppp4kcopenenenenocnoeneocoeneoooen bbov|vi4kto Λ4 bbb e beΛvibvivibbcoc 4k(X)b_ biobbtovic vicnovibb4kob4kvitobcoi vi oao4ken4kcoooviooooicoo_oorooirocotoorotocntotoo ro(θooroeococn(θooroooooooo(θ4kθooco(θvi

1501 N GLU 176 126.781 14.535 59.524 1.00 23.45

1502 CA GLU 176 126.7221 15.374 60.717 1.00 29.31

1503 C GLU 176 127.596 14.788 61.814 1.00 29.58

1504 0 GLU 176 128.222 15.519 62.580 1.00 30.33

1505 CB GLU 176 125.292 15.477 61.247 1.00 28.86

1506 CG GLU 176 124.338 16.265 60.381 1.00 41.02

1507 CD GLU 176 122.976 16.431 61.032 1.00 50.96

1508 OE1 GLU 176 122.409 15.422 61.511 1.00 58.24

1509 OE2 GLU 176 122.474 17.574 61.069 1.00 53.02

1510 H GLU 176 125.956 14.127 59.182 1.00 25.00

1511 N SER 177 127.615 13.461 61.890 1.00 31.99

1512 CA SER 177 128.394 12.746 62.894 1.00 33.70

1513 C SER 177 129.905 12.777 62.620 1.00 29.73

1514 0 SER 177 130.710 12.952 63.541 1.00 31.31

1515 CB SER 177 127.896 11.299 62.986 1.00 33.08

1516 OG SER 177 128.446 10.626 64.103 1.00 42.66

1517 H SER 177 127.077 12.944 61.259 1.00 25.00

1518 HG SER 177 128.220 11.094 64.907 1.00 25.00

1519 N ALA 178 130.283 12.652 61.352 1.00 26.67

1520 CA ALA 178 131.692 12.641 60.970 1.00 25.61

1521 C ALA 178 132.351 14.013 60.858 1.00 28.58

1522 0 ALA 178 133.540 14.162 61.153 1.00 23.60

1523 CB ALA 178 131.862 11.884 59.665 1.00 22.60

1524 H ALA 178 129.599 12.566 60.656 1.00 25.00

1525 N ALA 179 131.568 15.018 60.475 1.00 25.11

1526 CA ALA 179 132.068 16.376 60.268 1.00 25.17

1527 C ALA 179 133.071 16.983 61.254 1.00 25.37

1528 0 ALA 179 134.141 17.430 60.844 1.00 25.58

1529 CB ALA 179 130.903 17.340 60.044 1.00 21.50

1530 H ALA 179 130.617 14.840 60.325 1.00 25.00

1531 N PRO 180 132.771 16.963 62.564 1.00 27.61

1532 CA PRO 180 133.680 17.541 63.565 1.00 28.57

1533 C PRO 180 135.132 17.058 63.584 1.00 30.64

1534 0 PRO 180 135.994 17.724 64.155 1.00 37.22

1535 CB PRO 180 132.988 17.206 64.889 1.00 25.80

1536 CG PRO 180 131.540 17.118 64.518 1.00 31.06

1537 CD PRO 180 131.597 16.360 63.221 1.00 30.35

1538 N HIS 181 135.414 15.910 62.980 1.00 28.35

1539 CA HIS 181 136.772 15.377 63.013 1.00 27.57

1540 C HIS 181 137.470 15.237 61.672 1.00 26.99

1541 0 HIS 181 138.529 14.611 61.584 1.00 29.22

1542 CB HIS 181 136.764 14.035 63.740 1.00 30.76

1543 CG HIS 181 136.153 14.103 65.104 1.00 32.51

1544 ND1 HIS 181 134.893 13.619 65.379 1.00 34.64

1545 CD2 HIS 181 136.607 14.652 66.257 1.00 34.04

1546 CE1 HIS 181 134.593 13.870 66.641 1.00 35.16

1547 NE2 HIS 181 135.615 14.495 67.196 1.00 38.60

1548 H HIS 181 134.717 15.429 62.478 1.00 25.00

1549 HD1 HIS 181 134.298 13.158 64.739 1.00 25.00

1550 HE2 HIS 181 135.666 14.802 68.128 1.00 25.00

1551 N LEU 182 136.890 15.827 60.635 1.00 22.56

1552 CA LEU 182 137.468 15.750 59.303 1.00 22.65 1553 C LEU 182 138.532 16.821 59.103 1.00 24.98

1554 0 LEU 182 138.494 17.878 59.741 1.00 22.99

1555 CB LEU 182 136.372 15.900 58.243 1.00 25.05

1556 CG LEU 182 135.271 14.835 58.205 1.00 23.65

1557 CD1 LEU 182 134.178 15.274 57.249 1.00 17.28

1558 CD2 LEU 182 135.849 13.483 57.786 1.00 20.03

1559 H LEU 182 136.072 16.351 60.762 1.00 25.00

1560 N LYS 183 139.494 16.528 58.236 1.00 22.16

1561 CA LYS 183 140.556 17.469 57.926 1.00 25.90

1562 C LYS 183 139.982 18.573 57.045 1.00 30.39

1563 0 LYS 183 138.898 18.429 56.468 1.00 31.71

1564 CB LYS 183 141.696 16.767 57.183 1.00 27.62

1565 CG LYS 183 141.274 16.122 555.871 1.00 37.10

1566 CD LYS 183 142.437 15.441 55.169 1.00 45.13

1567 CE LYS 183 141.974 14.764 53.885 1.00 50.33

1568 NZ LYS 183 143.088 14.040 53.210 1.00 57.79

1569 H LYS 183 139.473 15.658 57.786 1.00 25.00

1570 1 HZ LYS 183 143.846 14.713 52.975 1.00 25.00

1571 2HZ LYS 183 143.463 13.311 53.852 1.00 25.00

1572 3HZ LYS 183 142.736 13.592 52.341 1.00 25.00

1573 N SER 184 140.714 19.674 56.944 1.00 27.77

1574 CA SER 184 140.304 20.802 56.122 1.00 28.80

1575 C SER 184 140.970 20.675 54.752 1.00 27.61

1576 0 SER 184 142.084 20.158 54.645 1.00 26.37

1577 CB SER 184 140.702 22.109 56.805 1.00 28.03

1578 OG SEER 184 140.003 22.254 58.031 1.00 32.93

1579 H SER 184 141.565 19.725 57.420 1.00 25.00

1580 HG SER 184 140.193 21.517 58.620 1.00 25.00

1581 N PRO 185 140.312 21.171 53.689 1.00 26.21

1582 CA PRO 185 139.003 21.834 53.680 1.00 23.45

1583 C PRO 185 137.767 20.926 53.597 1.00 24.54

1584 0 PRO 185 136.636 21.425 53.589 1.00 23.22

1585 CB PRO 185 139.109 22.737 52.458 1.00 21.98

1586 CG PRO 185 139.858 21.876 51.503 1.00 21.03

1587 CD PRO 185 140.949 21.263 52.361 1.00 21.80

1588 N LEU 186 137.969 19.608 53.570 1.00 21.43

1589 CA LEU 186 136.852 18.666 53.483 1.00 21.42

1590 C LEU 186 135.780 18.964 54.522 1.00 22.24

1591 0 LEU 186 134.586 18.987 54.210 1.00 20.84

1592 CB LEU 186 137.331 17.220 53.654 1.00 23.63

1593 CG LEU 186 136.217 16.160 53.646 1.00 21.09

1594 CD1 LEU 186 135.491 16.145 52.292 1.00 20.03

1595 CD2 LEU 186 136.800 14.800 53.943 1.00 21.57

1596 H LEU 186 138.882 19.259 53.605 1.00 25.00

1597 N ARG 187 136.221 19.208 55.751 1.00 16.73

1598 CA ARG 187 135.326 19.515 56.859 1.00 22.57

1599 C ARG 187 134.427 20.723 56.564 1.00 27.49

1600 0 ARG 187 133.225 20.693 56.848 1.00 26.35

1601 CB ARG 187 136.146 19.777 58.117 1.00 17.71

1602 CG ARG 187 135.325 20.087 59.343 1.00 21.93

1603 CD ARG 137 136.235 20.478 60.483 1.00 31.75

1604 NE ARG 187 135.507 20.685 61.727 1.00 46.15 1605 CZ ARG 187 136.087 20.961 62.891 1.00 58.70

1606 NH1 ARG 187 137.412 21.066 62.970 1.00 57.84

1607 NH2 ARG 187 135.344 21.111 63.982 1.00 58.69

1608 H ARG 187 137.182 19.161 55.923 1.00 25.00

1609 HE ARG 187 134.530 20.613 61.708 1.00 25.00

1610 1 HH1 ARG 187 137.977 20.941 62.156 1.00 25.00

1611 2HH1 ARG 187 137.843 21.275 63.848 1.00 25.00

1612 1 HH2 ARG 187 134.351 21.012 63.926 1.00 25.00

1613 2HH2 ARG 187 135.779 21.316 64.858 1.00 25.00

1614 N GLU 188 135.010 21.782 56.001 1.00 28.09

1615 CA G GLLUU 188 134.255 22.993 55.667 1.00 26.62

16116 C GGLLUU 188 133.293 22.726 54.516 1.00 22.97

1617 0 GGLLUU 188 132.203 23.296 54.462 1.00 21.14

1618 CB GGLLUU 188 135.192 24.153 55.305 1.00 24.01

1619 CG GGLLUU 188 135.934 24.768 56.482 1.00 32.71

1620 CD GGLLUU 188 137.045 23.878 57.014 1.00 42.50 1 1662211 O 0EE11 GGLLUU 188 138.030 23.657 56.279 1.00 43.53

1622 0E2 GLU 188 136.936 23.403 58.165 1.00 47.38

1623 H GLU 188 135.965 21.747 55.798 1.00 25.00

1624 N GLN 189 133.702 21.853 53.601 1.00 19.36

1625 CA GLN 189 132.872 21.496 52.460 1.00 20.62

1626 C GLN 189 131.636 20.728 52.927 1.00 22.47

1627 0 GLN 189 130.522 21.010 52.483 1.00 25.58

1628 CB GLN 189 133.672 20.662 51.461 1.00 17.31

1629 CG GLN 189 132.915 20.359 50.187 1.00 24.12

1630 CD GLN 189 133.796 19.780 49.104 1.00 25.67

1631 OE1 G GLLNN 189 133.691 20.162 47.939 1.00 28.92

1632 NE2 G GLLNN 189 134.666 18.850 49.477 1.00 28.68

1633 H G GLLNN 189 134.590 21.445 53.695 1.00 25.00

1634 1HE2 GLN 189 135.235 18.480 48.773 1.00 25.00

1635 2HE2 GLN 189 134.704 18.576 50.413 1.00 25.00

1636 N VAL 190 131.833 19.783 53.846 1.00 22.03

1637 CA VAL 190 130.734 18.983 54.388 1.00 22.50

1638 C VAL 190 129.778 19.864 55.198 1.00 22.00

1639 0 VAL 190 128.565 19.846 54.977 1.00 26.49

1640 CB VAL 190 131.255 17.808 55.274 1.00 18.21

1641 CG1 VAL 190 130.093 17.093 55.947 1.00 19.13

1642 CG2 VAL 190 132.037 16.815 54.422 1.00 13.74

1643 H VAL 190 132.742 19.618 54.168 1.00 25.00

1644 N T THHRR 191 130.335 20.638 56.124 1.00 20.35

1645 CA T THHRR 191 129.555 21.541 56.967 1.00 23.43

1646 C T THHRR 191 128.733 22.504 56.116 1.00 23.79

1647 0 T THHRR 191 127.564 22.772 56.410 1.00 27.12

1648 CB THR 191 130.478 22.350 57.903 1.00 29.00

1649 0G1 THR 191 131.124 21.454 58.814 1.00 35.12

1650 CG2 THR 191 129.688 23.385 58.691 1.00 32.22

1651 H THR 191 131.304 20.599 56.257 1.00 25.00

1652 HG1 THR 191 131.661 20.824 58.321 1.00 25.00

1653 N HIS 192 129.345 23.015 55.054 1.00 22.27

1654 CA HIS 192 128.658 23.935 54.168 1.00 24.21

1655 C HIS 192 127.530 23.226 53.417 1.00 24.78

1656 O HIS 192 126.421 23.756 53.326 1.00 20.41 1657 CB HIS 192 129.632 24.564 53.173 1.00 17.98

1658 CG HIS 192 128.965 25.446 52.169 1.00 21.55

1659 ND1 HIS 192 128.506 26.707 52.480 1.00 21.86

1660 CD2 HIS 192 128.637 25.234 50.872 1.00 20.40

1661 CE1 HIS 192 127.919 27.234 51.420 1.00 20.03

1662 NE2 HIS 192 127.985 26.360 50.432 1.00 20.23

1663 H HIS 192 130.278 22.766 54.870 1.00 25.00

1664 HD1 HIS 192 128.594 27.143 53.355 1.00 25.00

1665 HE2 HIS 192 127.614 26.486 49.551 1.00 25.00

1666 N ALA 193 127.826 22.038 52.8888 1.00 22.45

1667 CA ALA 193 126.854 21.242 52.139 1.00 20.56

1668 C ALA 193 125.601 20.963 52.964 1.00 22.26

1669 O ALA 193 124.485 21.072 52.459 1.00 21.49

1670 CB ALA 193 127.483 19.938 51.679 1.00 18.73

1671 H ALA 193 128.729 21.672 53.002 1.00 25.00

1672 N LEU 194 125.791 20.623 54.236 1.00 23.86

1673 CA LEU 194 124.678 20.344 55.136 1.00 25.16

1674 C LEU 194 123.757 21.551 55.298 1.00 26.76

1675 O LEU 194 122.573 21.391 55.579 1.00 28.61

1676 CB LEU 194 125.194 19.902 56.509 1.00 23.10

1677 CG LEU 194 125.924 18.556 56.579 1.00 26.60

1678 CD1 LEU 194 126.426 18.319 57.992 1.00 20.06

1679 CD2 LEU 194 124.998 17.433 56.149 1.00 18.24

1680 H LEU 194 126.710 20.552 54.574 1.00 25.00

1681 N GLU 195 124.309 22.754 55.149 1.00 33.01

1682 CA GLU 195 123.529 23.987 55.277 1.00 34.61

1683 C GLU 195 123.005 24.448 53.923 1.00 26.09

1684 O GLU 195 121.952 25.074 53.834 1.00 29.66

1685 CB GLU 195 124.385 25.102 55.884 1.00 38.35

1686 CG GLU 195 124.885 24.816 57.288 1.00 59.66

1687 CD GLU 195 125.945 25.803 57.751 1.00 72.22

1688 OE1 GLU 195 126.800 26.203 56.927 1.00 75.42

1689 OE2 GLU 195 125.931 26.169 58.947 1.00 82.70

1690 H GLU 195 125.263 22.814 54.944 1.00 25.00

1691 N GLN 196 123.747 24.130 52.871 1.00 22.78

1692 CA GLN 196 123.376 24.529 51.527 1.00 20.33

1693 C GLN 196 123.891 23.520 50.515 1.00 19.79

1694 O GLN 196 125.094 23.463 50.258 1.00 24.78

1695 CB GLN 196 123.980 25.903 51.219 1.00 20.38

1696 CG GLN 196 123.727 26.397 49.807 1.00 24.47

1697 CD GLN 196 122.253 26.591 49.524 1.00 28.74

1698 OE1 GLN 196 121.622 27.490 50.074 1.00 32.30

1699 NE2 GLN 196 121.694 25.744 48.667 1.00 21.06

1700 H GLN 196 124.554 23.592 52.995 1.00 25.00

1701 1HE2 GLN 196 120.741 25.876 48.480 1.00 25.00

1702 2HE2 GLN 196 122.247 25.045 48.258 1.00 25.00

1703 N CYS 197 122.992 22.727 49.942 1.00 19.52

1704 CA CYS 197 123.399 21..749 48.944 1.00 17.94

1705 C CYS 197 123.782 22.497 47.669 1.00 18.82

1706 O CYS 197 123.316 23.614 47.428 1.00 19.62

1707 CB CYS 197 122.278 20.743 48.669 1.00 21.42

1708 SG CYS 197 120.832 21.394 47.800 1.00 42.82 1709 H CYS 197 122.056 22.808 50.202 1.00 25.00

1710 N LEU 198 124.626 21.878 46.856 1.00 19.01

1711 CA LEU 198 125.094 22.489 45.620 1.00 20.23

1712 C LEU 198 123.986 22.760 44.610 1.00 23.16 1713 O LEU 198 123.868 23.867 44.096 1.00 26.68

1714 CB LEU 198 126.174 21.608 44.981 1.00 13.53

1715 CG LEU 198 126.762 22.058 43.640 1.00 20.37

1716 CD1 LEU 198 127.388 23.440 43.773 1.00 19.35

1717 CD2 LEU 198 127.789 21.044 43.158 1.00 18.28

1718 H LEU 198 124.968 21.004 47.109 1.00 25.00

1719 N HIS 199 123.160 21.752 44.354 1.00 24.27

1720 CA HIS 199 122.079 21.859 43.379 1.00 22.48

1721 C C HIS 199 121.089 23.001 43.608 1.00 19.15

1722 o 0 HIS 199 120.586 23.582 42.653 1.00 19.66

1723 CB HIS 199 121.327 20.523 43.277 1.00 22.51

1724 CG HIS 199 120.225 20.519 42.261 1.00 16.72

1725 ND1 HIS 199 120.452 20.697 40.911 1.00 19.56

1726 CD2 HIS 199 118.885 20.360 42.396 1.00 15.14

1727 CE1 HIS 199 119.303 20.648 40.261 1.00 15.68

1728 NE2 HIS 199 118.338 20.444 41.138 1.00 19.96

1729 H HIS 199 123.297 20.912 44.822 1.00 25..00

1730 HD1 HIS 199 121.340 20.834 40.498 1.00 25.00

1731 HE2 HIS 199 117.376 20.343 40.929 1.00 25.00

1732 N LYS 200 120.811 23.323 44.864 1.00 18.06

1733 CA LYS 200 119.853 24.377 45.170 1.00 19.34

1734 C LYS 200 120.463 25.726 45.548 1.00 21.28

1735 0 LYS 200 119.755 26.617 46.012 1.00 20.62

1736 CB LYS 200 118.898 23.893 46.264 1.00 17.06

1737 CG LYS 200 118.144 22.630 45.875 1.00 17.06

1738 CD LYS 200 117.287 22.086 47.005 1.00 18.82

1739 CE LYS 200 116.597 20.804 46.559 1.00 16.83

1740 NZ LYS 200 115.820 20.155 47.645 1.00 19.41

1741 H LYS 200 121.264 22.869 45.599 1.00 25.00

1742 1HZ LYS 200 1166.454 19.923 48.436 1.00 25.00

1743 2HZ LYS 200 115.081 20.807 47.978 1.00 25.00

1744 3HZ LYS 200 115.377 19.285 47.288 1.00 25.00

1745 N GLY 201 121.768 25.881 45.343 1.00 23.54

1746 CA GLY 201 122.424 27.136 45.675 1.00 19.60

1747 C GLY 201 122.583 28.062 44.482 1.00 19.35

1748 0 GLY 201 122.569 27.613 43.338 1.00 21.61

1749 H GLY 201 122.299 25.166 44.933 1.00 25.00

1750 N VAL 202 122.685 29.363 44.734 1.00 17.34

1751 CA VAL 202 122.871 30.327 43.653 1.00 17.16

1752 C VAL 202 124.281 30.084 43.108 1.00 20.63

1753 0 VAL 202 125.248 30.059 43.874 1.00 22.87

1754 CB VAL 202 122.722 31.778 44.168 1.00 17.85

1755 CG1 VAL 202 123.062 32.782 43.071 1.00 19.32

1756 CG2 VAL 202 121.301 32.003 44.645 1.00 15.75

1757 H VAL 202 122.625 29.676 45.655 1.00 25.00

1758 N PRO 203 124.414 29.905 41.780 1.00 18.06

1759 CA PRO 203 125.705 29.652 41.128 1.00 19.86

1760 C PRO 203 126.889 30.506 41.588 1.00 23.15 1761 0 PRO 203 127.827 29.974 42.172 1.00 27.00

1762 CB PRO 203 125.378 29.840 39.650 1.00 21.47

1763 CG PRO 203 123.982 29.300 39.574 1.00 19.55

1764 CD PRO 203 123.332 29.952 40.780 1.00 17.62

1765 N ARG 204 126.844 31.817 41.365 1.00 21.91

1766 CA ARG 204 127.949 32.683 41.781 1.00 20.91

1767 C ARG 204 128.283 32.568 43.265 1.00 20.45

1768 0 ARG 204 129.455 32.598 43.638 1.00 25.04

1769 CB ARG 204 127.681 34.149 41.426 1.00 22.61

1770 CG ARG 204 127.940 34.519 39.972 1.00 18.14

1771 CD ARG 204 129.420 34.487 39.618 1.00 21.89

1772 NE ARG 204 129.852 33.202 39.074 1.00 23.42

1773 CZ ARG 204 130.953 33.027 38.345 1.00 28.33

1774 NH1 ARG 204 131.747 34.055 38.069 1.00 25.07

1775 NH2 ARG 204 131.248 31.827 37.862 1.00 26.89

1776 H ARG 204 126.071 32.201 40.913 1.00 25.00

1777 HE ARG 204 129.297 32.416 39.258 1.00 25.00

1778 1 HH1 ARG 204 131.521 34.967 38.404 1.00 25.00

1779 2HH1 ARG 204 132.570 33.921 37.522 1.00 25.00

1780 1 HH2 : ARG 2004 130.647 31.051 38.047 1.00 25.00

1781 2HH2 ARG 204 132.077 31.699 37.316 1.00 25.00

1782 N VAL 205 127.264 32.431 44.108 1.00 17.32

1783 CA VAL 205 127.496 32.312 45.545 1.00 18.99

1784 C VAL 205 128.267 31.034 45.866 1.00 20.53

1785 0 VAL 205 129.220 31.048 46.647 1.00 24.18

1786 CB VAL 205 126.175 32.309 46.339 1.00 19.83

1787 CG1 VAL 205 126.442 32.022 47.811 1.00 14.97

1788 CG2 VAL 205 125.473 33.642 46.190 1.00 21.52

1789 H VAL 205 126.353 32.398 43.764 1.00 25.00

1790 N GLU 206 127.862 29.933 45.249 1.00 22.23

1791 CA GLU 206 128.519 28.649 45.478 1.00 22.70

1792 C GLU 206 129.919 28.601 44.876 1.00 18.65

1793 0 GLU 206 130.836 28.029 45.469 1.00 20.84

1794 CB GLU 206 127.648 27.506 44.957 1.00 17.73

1795 CG GLU 206 126.317 27.413 45.683 1.00 20.17

1796 CD GLU 206 126.478 27.407 47.201 1.00 26.03

1797 OE1 GLU 206 127.190 26.523 47.721 1.00 21.64

1798 OE2 GLU 206 125.895 28.283 47.876 1.00 20.28

1799 H GLU 206 127.111 29.981 44.620 1.00 25.00

1800 N THR 207 130.081 29.223 43.714 1.00 18.09

1801 CA THR 207 131.369 29.291 43.038 1.00 21.23

1802 C THR 207 132.373 30.057 43.909 1.00 25.71

1803 0 THR 207 133.474 29.568 44.179 1.00 28.93

1804 CB THR 207 131.219 29.984 41.672 1.00 24.22

1805 OG1 THR 207 130.529 29.1077 40.770 1.00 28.95

1806 CG2 THR 207 132.573 30.379 41.088 1.00 23.10

1807 H THR 207 129.311 29.644 43.289 1.00 25.00

1808 HG1 THR 207 131.030 28.287 40.685 1.00 25.00

1809 N ARG 208 131.973 31.238 44.374 1.00 24.65

1810 CA ARG 208 132.825 32.070 45.221 1.00 25.56

1811 C ARG 208 133.292 31.273 46.432 1.00 25.87

1812 0 ARG 208 134.472 31.289 46.780 1.00 27.73 1813 CB ARG 208 132.059 33.314 45.682 1.00 25.72

1814 CG ARG 208 132.836 34.258 46.588 1.00 31.65

1815 CD ARG 208 134.062 34.826 45.892 1.00 39.53

1816 NE ARG 208 134.374 36.184 46.344 1.00 46.43

1817 CZ ARG 208 135.283 36.488 47.266 1.00 47.18

1818 NH11 ARG 208 135.991 35.534 47.858 1.00 54.31

1819 NH2 ARG 208 135.492 37.754 47.592 1.00 54.01

1820 H ARG 208 131.077 31.566 44.139 1.00 25.00

1821 HE ARG 208 133.881 36.924 45.937 1.00 25.00

1822 1 HH1 ARG 208 135.847 34.577 47.610 1.00 25.00

1823 2HH1 ARG 208 136.673 35.775 48.548 1.00 25.00

1824 1 HH2 ARG 208 134.962 38.478 47.150 1.00 25.00

1825 2HH2 ARG 208 136.172 37.986 48.287 1.00 25.00

1826 N PHE 209 132.364 30.556 47.056 1.00 25.17

1827 CA PHE 209 132.688 29.750 48.224 1.00 23.72

1828 C PHE 209 133.677 28.632 47.908 1.00 24.69

1829 O PHE 209 134.656 28.442 48.626 1.00 24.23

1830 CB PHE 209 131.430 29.135 48.838 1.00 22.94

1831 CG PHE 209 131.721 28.195 49.976 1.00 22.62

1832 CD1 PHE 209 132.019 28.691 51.242 1.00 22.83

1833 CD2 PHE 209 131.745 26.817 49.773 1.00 20.76

1834 CE1 PHE 209 132.336 27.824 52.293 1.00 22.43

1835 CE2 PHE 209 132.060 25.946 50.813 1.00 24.13

1836 CZ PHE 209 132.358 26.450 52.075 1.00 22.16

1837 H PHE 209 131.439 30.580 46.728 1.00 25.00

1838 N PHE 210 133.399 27.872 46.856 1.00 24.89

1839 CA PHE 210 134.263 26.765 46.486 1.00 21.48

1840 C PHE 210 135.671 27.241 46.172 1.00 23.23

1841 O PHE 210 136.645 26.676 46.671 1.00 24.15

1842 CB PHE 210 133.688 25.989 45.296 1.00 18.25

1843 CG PHE 210 134.4776 24.754 44.944 1.00 20.04

1844 CD1 PHE 210 134.506 23.661 45.811 1.00 17.95

1845 CD2 PHE 210 135.212 24.694 43.763 1.00 19.06

1846 CE1 PHE 210 135.260 22.525 45.510 1.00 17.28

1847 CE2 PHE 210 135.972 23.563 43.450 1.00 21.18

1848 CZ PHE 210 135.995 22.476 44.329 1.00 18.42

1849 H PHE 210 132.602 28.062 46.315 1.00 25.00

1850 N ILE 211 135.781 28.290 45.368 1.00 26.53

1851 CA ILE 211 137.086 28.818 44.997 1.00 27.06

1852 C ILE 211 137.917 29.248 46.205 1.00 27.01

1853 O ILE 211 138.953 28.652 46.490 1.00 25.02

1854 CB ILE 211 136.967 30.015 44.023 1.00 23.08

1855 CG1 ILE 211 136.317 29.574 42.713 1.00 22.07

1856 CG2 ILE 211 138.344 30.603 43.737 1.00 18.73

1857 CD1 ILE 211 136.163 30.700 41.701 1.00 22.59

1858 H ILE 211 134.968 28.712 45.022 1.00 25.00

1859 N SER 212 137.430 30.233 46.949 1.00 26.45

1860 CA SER 212 138.174 30.758 48.087 1.00 29.47

1861 C SER 212 138.263 29.914 49.355 1.00 29.82

1862 O SER 212 139.317 29.873 49.993 1.00 31.08

1863 CB SER 212 137.691 32.173 48.425 1.00 28.90

1864 OG SER 212 136.311 32.186 48.742 1.00 48.04 1865 H SER 212 136.550 30.622 46.740 1.00 25.00

1866 HG SER 212 136.156 31.647 49.517 1.00 25.00

1867 N SER 213 137.175 29.249 49.728 1.00 25.54

1868 CA SER 213 137.173 28.447 50.949 1..0025.42

1869 C SER 213 137.555 26.969 50.823 1.00 23.90

1870 0 SER 213 138.019 26.371 51.794 1.00 29.58

1871 CB SER 213 135.820 28.566 51.662 1.00 19.77

1872 OG SER 213 135.503 29.920 51.942 1.00 36.00

1873 H SER 213 136.366 29.279 49.173 1.00 25.00

1874 HG SER 213 135.449 30.406 51.120 1.00 25.00

1875 N ILE 214 137.390 26.376 49.645 1.00 20.94

1876 CA ILE 214 137.701 24.958 49.502 1.00 20.03

1877 C ILE 214 138.869 24.617 48.591 1.00 20.98

1878 0 ILE 214 139.914 24.174 49.065 1.00 23.05

1879 CB ILE 214 136.463 24.144 49.041 1.00 20.03

1880 CG1 ILE 214 135.255 24.455 49.932 1.00 15.38

1881 CG2 ILE 214 136.778 22.640 49.046 1.00 14.86

1882 CD1 ILE 214 135.488 24.207 51.418 1.00 14.56

1883 H ILE 214 137.066 26.887 48.873 1.00 25.00

1884 N TYR 215 138.696 24.823 47.289 1.00 18.70

1885 CA TYR 215 139.733 24.490 46.323 1.00 22.93

1886 C TYR 215 141.076 25.168 46.582 1.00 25.73

1887 0 TYR 215 142.128 24.545 46.450 1.00 25.96

1888 CB TYR 215 139.258 24.777 44.899 1.00 19.89

1889 CG TYR 215 139.859 23.834 43.884 1.00 17.39

1890 CD1 TYR 215 139.726 22.455 44.030 1.00 18.08

1891 CD2 TYR 215 140.557 24.315 42.782 1.00 19.17

1892 CE1 TYR 215 140.275 21.575 43.102 1.00 17.39

1893 CE2 TYR 215 141.113 23.445 41.843 1.00 16.77

1894 CZ TYR 215 140.967 22.076 42.010 1.00 21.36

1895 OH TYR 215 141.517 21.212 41.088 1.00 25.91

1896 H TYR 215 137.858 25.217 46.973 1.00 25.00

1897 HH TYR 215 141.317 20.302 41.340 1.00 25.00

1898 N ASP 216 141.037 26.434 46.969 1.00 26.71

1899 CA ASP 216 142.254 27.184 47.250 1.00 32.33

1900 C ASP 216 143.057 26.532 48.377 1.00 32.46

1901 0 ASP 216 144.288 26.589 48.387 1.00 33.87

1902 CB ASP 216 141.895 28.621 47.636 1.00 35.77

1903 CG ASP 216 143.111 29.514 47.769 1.00 36.73

1904 OD1 ASP 216 143.842 29.670 46.769 1.00 37.16

1905 OD2 ASP 216 143.327 30.062 48.871 1.00 41.08

1906 H ASP 216 140.170 26.885 447.054 1.00 25.00

1907 N LYS 217 142.350 25.910 49.316 1.00 31.70

1908 CA LYS 217 142.978 25.255 50.459 1.00 29.37

1909 C LYS 217 143.134 23.745 50.269 1.00 30.32

1910 0 LYS 217 143.506 23.029 51.200 1.00 31.00

1911 CB LYS 217 142.170 25.553 51.724 1.00 26.09

1912 CG LYS 217 142.062 27.033 52.017 1.00 27.73

1913 CD LYS 217 141.185 27.312 53.213 1.00 35.35

1914 CE LYS 217 141.091 28.807 53.463 1.00 40.60

1915 NZ LYS 217 140.124 29.115 54.551 1.00 49.88

1916 H LYS 217 141.376 25.876 49.235 1.00 25.00 1917 1 HZ LYS 217 140.429 28.650 55.430 1.00 25.00

1918 2HZ LYS 217 140.083 30.143 54.698 1.00 25.00

1919 3HZ LYS 217 139.181 28.767 54.284 1.00 25.00

1920 N GLU 218 142.864 23.271 49.057 1.00 31.03

1921 CA GLU 218 142.961 21.855 48.750 1.00 33.23

1922 C GLU 218 144.391 21.489 48.357 1.00 42.71

1923 0 GLU 218 144.932 22.012 47.381 1.00 41.53

1924 CB GLU 218 141.983 21.492 47.626 1.00 32.79

1925 CG GLU 218 141.873 20.007 47.345 1.00 49.16

1926 CD GLU 218 141.324 19.228 48.526 1.00 61.57

1927 OE1 GLU 218 140.147 19.456 48.886 1.00 66.99

1928 OE2 GLU 218 142.066 18.391 49.092 1.00 62.96

1929 H GLU 218 142.616 23.896 48.343 1.00 25.00

1930 N GLN 219 144.974 20.551 49.098 1.00 48.16

1931 CA GLN 219 146.339 20.089 48.858 1.00 52.73

1932 C GLN 219 146.533 19.487 47.467 1.00 49.21 1933 O GLN 219 147.594 19.622 46.870 1.00 51.36

1934 CB GLN 219 146.733 19.063 49.929 1.00 62.56

1935 CG GLN 219 148.127 19.262 50.531 1.00 81.40

1936 CD GLN 219 148.498 18.186 51.534 1.00 90.93

1937 OE1 GLN 219 148.863 17.072 51.156 1.00 97.11

1938 NE2 GLN 219 148.408 18.512 52.825 1.00 96.41

1939 H GLN 219 144.450 20.162 49.821 1.00 25.00 1940 1HE2 GLN 219 148.113 19.389 53.115 1.00 25.00

1941 2HE2 GLN 219 148.656 17.793 53.455 1.00 25.00

1942 N SER 220 145.496 18.842 46.950 1.00 47.51

1943 CA SER 220 145.552 18.199 45.636 1.00 47.04

1944 C SER 220 144.945 19.020 44.487 1.00 45.29 1945 O SER 220 144.577 18.467 43.446 1.00 47.02

1946 CB SER 220 144.862 16.833 45.713 1.00 51.73

1947 OG SER 220 143.585 16.948 46.327 1.00 55.26

1948 H SER 220 144.658 18.796 47.447 1.00 25.00

1949 HG SER 220 143.671 17.280 47.217 1.00 25.00

1950 N LYS 221 144.849 20.332 44.679 1.00 38.03

1951 CA LYS 221 144.270 21.233 43.682 1.00 32.98

1952 C LYS 221 145.037 21.284 42.363 1.00 30.63 1953 O LYS 221 146.249 21.077 42.328 1.00 33.91

1954 CB LYS 221 144.206 22.649 44.255 1.00 33.08

1955 CG LYS 221 145.584 23.257 44.500 1.00 40.24

1956 CD LYS 221 145.512 24.563 45.257 1.00 53.13 19557 CE LYS 221 146.902 25.093 45.561 1.00 55.90

1958 NZ LYS 221 146.843 26.358 46.344 1.00 67.32

1959 H LYS 221 145.198 20.720 45.508 1.00 25.00

1960 1HZ LYS 221 146.350 26.191 47.244 1.00 25.00

1961 2HZ LYS 221 147.807 26.698 46.533 1.00 25.00

1962 3HZ LYS 221 146.326 27.080 45.800 1.00 25.00

1963 N ASN 222 144.322 21.536 41.273 1.00 28.13

1964 CA ASN 222 144.958 21.675 39.970 1.00 25.27

1965 C ASN 222 145.154 23.174 39.816 1.00 30.00

1966 O ASN 222 144.187 23.933 39.707 1.00 29.84

1967 CB ASN 222 144.077 21.149 38.843 1.00 22.73

1968 CG ASN 222 144.688 21.390 37.473 1.00 24.93 1969 OD1 ASN 222 144.914 22.534 37.072 1.00 31.82

1970 ND2 ASN 222 144.973 20.317 36.755 1.00 23.78

1971 H ASN 222 143.353 21.640 41.343 1.00 25.00

1972 1 HD2 ASN 222 145.364 20.460 35.868 1.00 25.00

1973 2HD2 ASN 222 144.784 19.432 37.125 1.00 25.00

1974 N ASN 223 146.412 23.596 39.819 1.00 31.07

1975 CA ASN 223 146.759 25.009 39.726 1.00 26.94

1976 C ASN 223 146.273 25.730 38.477 1.00 25.82

1977 O ASN 223 145.933 26.910 38.538 1.00 27.88

1978 CB ASN 223 148.261 25.185 39.915 1.00 23.98

1979 CG ASN 223 148.739 24.633 41.242 1.00 28.15

1980 OD1 ASN 223 148.586 25.271 42.281 1.00 30.20

1981 ND2 ASN 223 149.291 23.423 41.219 1.00 25.49

1982 H ASN 223 147.118 22.925 39.901 1.00 25.00

1983 1HD2 ASN 223 149.595 23.063 42.082 1.00 25.00

1984 2HD2 ASN 223 149.377 22.938 40.382 1.00 25.00

1985 N VAL 224 146.224 25.036 37.346 1.00 24.73

1986 CA VAL 224 145.743 25.667 36.124 1.00 27.15

1987 C VAL 224 144.263 26.026 36.304 1.00 28.87

1988 O VAL 224 143.852 27.150 36.019 1.00 29.97

1989 CB VAL 224 145.914 24.742 34.900 1.00 31.17

1990 CG1 VAL 224 145.359 25.404 33.651 1.00 30.27

1991 CG2 VAL 224 147.382 24.400 34.707 1.00 30.28

1992 H VAL 224 146.488 24.096 37.329 1.00 25.00

1993 N LEU 225 143.486 25.089 36.843 1.00 25.78

1994 CA LEU 225 142.057 25.303 37.069 1.00 25.90

1995 C LEU 225 141.792 26.380 38.125 1.00 26.51

1996 O LEU 225 140.900 27.214 37.956 1.00 26.55

1997 CB LEU 225 141.366 23.991 37.463 1.00 20.07

1998 CG LEU 225 141.398 22.848 36.441 1.00 21.81

1999 CD1 LEU 225 140.664 21.638 36.991 1.00 10.56

2000 CD2 LEU 225 140.780 23.295 35.126 1.00 19.02

2001 H LEU 225 143.883 24.229 37.092 1.00 25.00

2002 N LEU 226 142.566 26.369 39.207 1.00 22.12

2003 CA LEU 226 142.400 27.367 40.261 1.00 27.39

2004 C LEU 226 142.724 28.775 39.743 1.00 28.78

2005 O LEU 226 141.967 29.720 39.969 1.00 34.36

2006 CB LEU 226 143.282 27.033 41.468 1.00 25.60

2007 CG LEU 226 143.170 27.984 42.6665 1.00 26.39

2008 CD1 LEU 226 141.731 28.037 43.183 1.00 20.17

2009 CD2 LEU 226 144.110 27.532 43.763 1.00 26.04

2010 H LEU 226 143.249 25.673 39.298 1.00 25.00

2011 N ARG 227 143.842 28.904 39.036 1.00 28.64

2012 CA ARG 227 144.270 30.183 38.473 1.00 30.51

2013 C ARG 227 143.186 30.688 37.508 1.00 29.19

2014 O ARG 227 142.770 31.849 37.567 1.00 25.86

2015 CB ARG 227 145.607 29.989 37.742 1.00 30.51

2016 CG ARG 227 146.171 31.215 37.037 1.00 32.00

2017 CD ARG 227 146.883 32.162 37.981 1.00 35.49

2018 NE ARG 227 147.414 33.314 37.256 1.00 34.46

2019 CZ ARG 227 147.799 34.454 37.822 1.00 32.62

2020 NH1 ARG 227 147.727 34.611 39.136 1.00 33.39 2021 NH2 ARG 227 148.214 35.460 37.066 1.00 35.87

2022 H ARG 227 144.402 28.114 38.884 1.00 25.00

2023 HE ARG 227 147.480 33.245 36.292 1.00 25.00

2024 1 HH1 ARG 227 147.381 33.871 39.712 1.00 25.00

2025 2HH1 ARG 227 148.020 35.470 39.554 1.00 25.00

2026 1 HH2 ! ARG 227 148.236 35.359 36.073 1.00 25.00

2027 2HH2 ! ARG 227 148.505 36.315 37.491 1.00 25.00

2028 N PHE 228 142.723 29.788 36.645 1.00 28.49

2029 CA PHE 228 141.678 30.063 35.656 1.00 30.24

2030 C PHE 228 140.411 30.575 36.369 1.00 29.56

2031 0 PHE 228 139.909 31.662 36.068 1.00 31.17

2032 CB PHE 228 141.394 28.752 34.892 1.00 32.31

2033 CG PHE 228 140.441 28.879 33.721 1.00 30.15

2034 CD1 PHE 228 139.889 30.103 33.348 1.00 29.90

2035 CD2 PHE 228 140.084 27.740 32.999 1.00 24.53

2036 CE1 PHE 228 138.994 30.186 32.277 1.00 28.21

2037 CE2 PHE 228 139.193 27.811 31.930 1.00 23.61

2038 CZ PHE 228 138.646 29.036 31.568 1.00 29.31

2039 H PHE 228 143.108 28.886 36.672 1.00 25.00

2040 N ALA 229 139.935 29.809 37.344 1.00 25.42

2041 CA ALA 229 138.737 30.156 38.099 1.00 25.11

2042 C ALA 229 138.808 31.533 38.764 1.00 29.20

2043 0 ALA 229 137.847 32.310 38.703 1.00 26.99

2044 CB ALA 229 138.456 29.085 39.135 1.00 20.89

2045 H ALA 229 140.406 28..Θ82 37.565 1.00 25.00

2046 N LYS 230 139.944 31.838 39.389 1.00 29.21

2047 CA LYS 230 140.127 33.121 40.068 1.00 29.75

2048 C LYS 230 140.100 34.306 39.109 1.00 30.11

2049 0 LYS 230 139.405 35.298 39.350 1.00 30.69

2050 CB LYS 230 141.434 33.136 40.866 1.00 30.27

2051 CG LYS 230 141.422 32.247 42.100 1.00 29.79

2052 CD LYS 230 142.686 32.430 42.923 1.00 24.40

2053 CE LYS 230 142.595 31.664 44.227 1.00 29.55

2054 NZ LYS 230 143.790 31.883 45.079 1.00 36.37

2055 H LYS 230 140.676 31.183 39.394 1.00 25.00

2056 1HZ LYS 230 143.881 32.896 45.296 1.00 25.00

2057 2HZ LYS 230 143.689 31.356 45.965 1.00 25.00

2058 33HZ LYS 230 144.640 31.560 44.573 1.00 25.00

2059 N LEU 231 140.852 34.201 38.016 1.00 31.56

2060 CA LEU 231 140.911 35.275 37.032 1.00 30.17

2061 C LEU 231 139.549 35.506 36.394 1.00 30.20

2062 0 LEU 231 139.085 36.645 36.299 1.00 26.72

2063 CB LEU 23T 141.941 34.959 35.941 1.00 29.21

2064 CG LEU 231 143.408 34.790 36.340 1.00 26.11

2065 CD1 LEU 231 144.232 34.631 35.077 1.00 22.49

2066 CD2 LEU 231 143.890 35.990 37.139 1.00 22.48

2067 H LEU 231 141.374 33.380 37.869 1.00 25.00

2068 N ASP 232 138.898 34.417 35.995 1.00 29.28

2069 CA ASP 232 137.593 34.490 35.351 1.00 28.41

2070 C ASP 232 136.549 35.149 36.247 1.00 25..56

2071 0 ASP 232 135.820 36.044 35.813 1.00 25.21

2072 CB ASP 232 137.131 33.097 34.932 1.00 26.05 2073 CG ASP 232 136.143 33.143 33.793 1.00 33.93

2074 0D1 ASP 232 136.587 33.188 32.627 1.00 32.45

2075 0D2 ASP 232 134.927 33.157 34.060 1.00 29.97

2076 H ASP 232 139.310 33.539 36.141 1.00 25.00

2077 N PHE 233 136.510 34.730 37.507 1.00 24.45

2078 CA PHE 233 135.569 35.286 38.466 1.00 22.77

2079 C PHE 233 135.788 36.788 38.603 1.00 28.10

2080 0 PHE 233 134.835 37.568 38.516 1.00 31.99

2081 CB PHE 233 135.732 34.605 39.831 1.00 19.36

2082 CG PHE 233 134.714 35.035 40.854 1.00 22.51

2083 CD1 PHE 233 1344.857 36.241 41.540 1.00 22.18

2084 CD2 PHE 233 133.604 34.237 41.127 1.00 23.90

2085 CE1 PHE 233 133.906 36.646 42.481 1.00 26.05

2086 CE2 PHE 233 132.650 34.631 42.065 1.00 23.08

2087 CZ PHE 233 132.801 35.839 42.743 1.00 24.51

2088 H PHE 233 137.126 34.022 37.802 1.00 25.00

2089 N ASN 234 137.044 37.189 38.801 1.00 28.39

2090 CA ASN 234 137.393 38.602 38.965 1.00 28.37

2091 C ASN 234 137.079 39.446 37.743 1.00 27.25

2092 O ASN 234 136.606 40.575 37.868 1.00 32.70

2093 CB ASN 234 138.867 38.762 39.342 1.00 27.32

2094 CG ASN 234 139.152 38.353 40.776 1.00 30.63

2095 OD1 ASN 234 138.242 38.219 41.595 1.00 29.34

2096 ND2 ASN 234 140.426 38.166 41.092 1.00 37.28

2097 H ASN 234 137.753 36.513 38.851 1.00 25.00

2098 1 HD2 ASN 234 140.628 37.901 42.015 1.00 25.00

2099 2HD2 ASN 234 141.114 38.292 40.408 1.00 25.00

2100 N LEU 235 137.339 38.902 36.561 1.00 28.66

2101 CA LEU 235 137.059 39.616 35.321 1.00 29.93

2102 C LEU 235 135.551 39.830 35.167 1.00 30.84

2103 0 LEU 235 135.106 40.949 34.908 1.00 31.89

2104 CB LEU 235 137.625 38.852 34.119 1.00 29.05

2105 CG LEU 235 137.476 39.509 32.742 1.00 30.21

2106 CD1 LEU 235 138.045 40.922 32.769 1.00 29.02

2107 CD2 LEU 235 138.173 38.667 31.684 1.00 31.45

2108 H LEU 235 137.721 38.001 36.525 1.00 25.00

2109 N LEU 236 134.766 38.769 35.352 1.00 29.90

2110 CA LEU 236 133.311 38.875 35.245 1.00 28.94

2111 C LEU 236 132.774 39.874 36.263 1.00 28.31

2112 0 LEU 236 131.833 40.623 35.979 1.00 29.04

2113 CB LEU 236 132.632 37.518 35.463 1.00 26.96

2114 CG LEU 236 132.722 36.463 34.359 1.00 32.49

2115 CD1 LEU 236 131.797 35.299 34.694 1.00 28.63

2116 CD2 LEU 236 132.326 37.068 33.026 1.00 30.07

2117 H LEU 236 135.173 37.900 35.561 1.00 25.00

2118 N GLN 237 133.362 39.870 37.454 1.00 25.46

2119 CA GLN 237 132.953 40.777 38.521 1.00 25.58

2120 C GLN 237 133.059 42.231 38.062 1.00 27.92

2121 0 GLN 2337 132.201 43.054 38.387 1.00 29.65

2122 CB GLN 237 133.807 40.549 39.769 1.00 20.55

2123 CG GLN 237 133.342 41.314 40.993 1.00 23.60

2124 CD GLN 237 134.216 41.046 42.197 1.00 31.25 2125 OE1 GLN 237 135.435 41.196 42.134 1.00 31.93

2126 NE2 GLN 237 133.602 40.634 43.298 1.00 28.03

2127 H GLN 237 134.094 39.237 37.625 1.00 25.00

2128 1 HE2 : GLN 237 134.156 40.446 44.081 1.00 25.00

2129 2HE2 : GLN 237 132.635 40.519 43.287 1.00 25.00

2130 N MET 238 134.096 42.537 37.286 1.00 28.91

2131 CA MET 238 134.288 43.888 36.776 1.00 33.08

2132 C MET 238 133.084 44.282 35.924 1.00 33.53

2133 0 MET 238 132.562 45.391 36.049 1.00 37.31

2134 CB MET 238 135.573 43.976 35.954 1.00 32.86

2135 CG MET 238 136.836 43.837 36.782 1.00 39.06

2136 SD MET 238 138.318 43.815 35.763 1.00 43.74

2137 CE MET 238 139.508 43.186 36.929 1.00 46.28

2138 H MET 238 134.751 41.842 37.055 1.00 25.00

2139 N LEU 239 132.624 43.356 35.087 1.00 31.84

2140 CA LEU 239 131.465 43.599 34.233 1.00 30.89

2141 C LEU 239 130.219 43.801 35.097 1.00 28.36

2142 0 LEU 239 129.450 44.742 34.885 1.00 32.90

2143 CB LEU 239 131.255 42.427 33.271 1.00 29.61

2144 CG LEU 239 129.969 42.432 32.436 1.00 29.85

2145 CD1 LEU 239 129.929 43.636 31.499 1.00 25.22

2146 CD2 LEU 239 129.870 41.138 31.649 1.00 26.65

2147 H LEU 239 133.084 42.491 35.043 1.00 25.00

2148 N HIS 240 130.042 42.942 36.095 1.00 25.85

2149 CA HIS 240 128.891 43.042 36.990 1.00 28.32

2150 C HIS 240 128.885 44.406 37.671 1.00 30.20

2151 0 HIS 240 127.824 44.974 37.940 1.00 30.10

2152 CB HIS 240 128.925 41.926 38.036 1.00 25.55

2153 CG HIS 240 128.881 40.545 37.448 1.00 24.20

2154 ND1 HIS 240 129.449 39.455 38.058 1.00 25.29

2155 CD2 HIS 240 128.358 40.103 36.283 1.00 21.44

2156 CE1 HIS 240 129.289 38.394 37.302 1.00 27.58

2157 NE2 HIS 240 128.627 38.750 36.209 1.00 21.74

2158 H HIS 240 130.713 42.244 36.233 1.00 25.00

2159 HD11 HIS 240 129.918 39.455 38.924 1.00 25.00

2160 HE2 HIS 240 128.362 38.151 35.470 1.00 25.00

2161 N LYS 241 130.079 44.926 37.935 1.00 34.60

2162 CA LYS 241 130.239 46.230 38.563 1.00 32.03

2163 C LYS 241 129.855 47.374 37.613 1.00 31.99

2164 0 LYS 241 129.280 48.374 38.045 1.00 29.66

2165 CB LYS 241 131.675 46.391 39.072 1.00 32.10

2166 CG LYS 241 131.984 45.614 40.356 1.00 34.40

2167 CD LYS 241 133.447 45.807 40.758 1.00 41.19

2168 CE LYS 241 133.701 45.417 42.208 1.00 49.51

2169 NZ LYS 241 135.044 45.881 42.698 1.00 56.06

2170 H LYS 241 130.875 44.403 37.703 1.00 25.00

2171 1 HZ LYS 241 135.111 46.916 42.625 1.00 25.00

2172 2HZ LYS 241 135.179 45.610 43.698 1.00 25.00

2173 3HZ LYS 241 135.803 45.446 42.135 1.00 25.00

2174 N GLN 242 130.121 47.201 36.316 1.00 34.13

2175 CA GLN 242 129.799 48.211 35.303 1.00 38.39

2176 C GLN 242 128.288 48.278 35.161 1.00 39.98 2177 0 GLN 242 127.702 49.353 34.990 1.00 45.19

2178 CB GLN 242 130.376 47.827 33.942 1.00 42.52

2179 CG GLN 242 131.883 47.683 33.920 1.00 60.88

2180 CD GLN 242 132.417 47.252 32.574 1.00 69.61

2181 0E1 GLN 242 131.663 47.052 31.620 1.00 75.13

2182 NE2 GLN 242 133.730 47.102 32.488 1.00 78.40

2183 H GLN 242 130.490 46.358 35.996 1.00 25.00

2184 1HE2 GLN 242 134.0772 46.820 31.621 1.00 25.00

2185 2HE2 GLN 242 134.282 47.272 33.272 1.00 25.00

2186 N GLU 243 127.674 47.105 35.219 1.00 33.89

2187 CA G GLLUU 243 126.233 46.975 35.107 1.00 28.66

2188 C G GLLUU 243 125.568 47.591 36.325 1.00 28.27

2189 0 G GLLUU 243 124.635 48.381 36.193 1.00 32.26

2190 CB G GLLUU 243 125.857 45.505 34.982 1.00 25.09

2191 CG G GLLUU 243 126.416 44.820 33.741 1.00 24.03

2192 CD G GLLUU 243 126.182 43.329 33.738 1.00 26.58

2193 OE1 G GLLUU 243 125.633 42.810 34.726 1.00 24.63

2194 OE2 G GLLUU 243 126.556 42.665 32.750 1.00 29.69

2195 H G GLLUU 243 128.248 46.333 35.341 1.00 25.00

2196 N L LEEUU 244 126.078 47.267 37.508 1.00 24.94

2197 CA L LEEUU 244 125.522 47.798 38.745 1.00 30.48

2198 C L LEEUU 244 125.635 49.324 38.766 1.00 36.45

2199 0 L LEEUU 244 124.700 50.021 39.163 1.00 35.07

2200 CB L LEEUU 244 126.233 47.185 39.957 1.00 28.96

2201 CG L LEEUU 244 125.765 47.658 41.339 1.00 29.10

2202 CD1 L LEEUU 244 124.249 47.527 41.484 1.00 25.23

2203 CD2 L LEEUU 244 126.464 46.859 42.423 1.00 27.57

2204 H L LEEUU 244 126.855 46.662 37.535 1.00 25.00

2205 N A ALLAA 245 126.778 49.832 38.318 1.00 37.15

2206 CA A ALLAA 245 127.023 51.268 38.270 1.00 38.62

2207 C A ALLAA 245 126.030 51.937 37.325 1.00 39.57 2 2220088 0 0 A A ALLLAAA 245 125.352 52.902 37.692 1.00 43.21

2209 CB A ALLAA 245 128.452 51.539 37.802 1.00 35.23

2210 H A ALLAA 245 127.477 49.215 38.032 1.00 25.00

2211 N G GLLNN 246 125.920 51.380 36.123 1.00 35.82

2212 CA G GLLNN 246 125.025 51.888 35.086 1.00 40.78

2213 C G GLLNN 246 123.577 51.989 35.566 1.00 43.61

2214 0 G GLLNN 246 122.907 53.016 35.404 1.00 43.37

2215 CB G GLLNN 246 125.088 50.963 33.872 1.00 42.45

2216 CG G GLLNN 246 124.151 51.350 32.733 1.00 59.73

2217 CD G GLLNN 246 124.146 50.338 31.610 1.00 65.77

2218 0E1 G GLLNN 246 125.149 49.663 31.357 1.00 67.95

2219 NE2 G GLLNN 246 123.009 50.223 30.920 1.00 66.48

2220 H G GLLNN 246 126.450 50.576 35.964 1.00 25.00

2221 1HE2 GLN 246 123.038 49.559 30.198 1.00 25.00

2222 2HE2 GLN 246 122.232 50.763 31.132 1.00 25.00

2223 N VAL 247 123.115 50.916 36.185 1.00 39.07

2224 CA VAL 247 121.762 50.830 36.692 1.00 37.02

2225 C VAL 247 121.538 51.732 37.908 1.00 40.33

2226 0 VAL 247 120.435 52.248 38.106 1.00 39.92

2227 CB VAL 247 121.387 49.341 36.946 1.00 35.95

2228 CG1 VAL 247 120.417 49.201 38.091 1.00 37.82 2229 CG2 VAL 247 120.794 48.754 35.686 1.00 32.90

2230 H VAL 247 123.730 50.170 36.340 1.00 25.00

2231 N S SEERR 248 122.579 51.926 38.715 1.00 44.51

2232 CA S SEERR 248 122.483 52.798 39.887 1.00 46.80

2233 C S SEERR 248 122.250 54.234 39.410 1.00 47.29

2234 0 S SEERR 248 121.454 54.976 39.997 1.00 46.67

2235 CB S SEERR 248 123.759 52.727 40.726 1.00 44.77

2236 OG S SEERR 248 123.859 51.479 41.381 1.00 45.74

2237 H S SEERR 248 123.423 51.465 38.531 1.00 25.00

2238 HG S SEERR 248 123.876 50.777 40.722 1.00 25.00

2239 N A ARRGG 249 122.938 54.615 38.334 1.00 44.35

2240 CA A ARRGG 249 122.789 55.943 37.750 1.00 48.22

2241 C A ARRGG 249 121.354 56.097 37.256 1.00 47.00

2242 0 A ARRGG 249 120.710 57.119 37.504 1.00 47.12

2243 CB A ARRGG 249 123.785 56.147 36.604 1.00 52.69

2244 CG A ARRGG 249 125.165 56.590 37.075 1.00 66.38

2245 CD A ARRGG 249 126.154 56.712 35.924 1.00 73.20

2246 NE A ARRGG 249 126.919 55.484 35.712 1.00 75.40

2247 CZ A ARRGG 249 126.922 54.778 334.584 1.00 77.33

2248 NH1 A ARRGG 249 126.194 55.165 33.542 1.00 74.66

2249 NH2 ARG 249 127.669 53.686 34.493 1.00 83.65

2250 H ARG 249 123.579 53.986 37.936 1.00 25.00

2251 HE ARG 249 127.471 55.153 36.453 1.00 25.00

2252 1HH1 ARG 249 125.633 55.990 33.598 1.00 25.00

2253 2HH1 ARG 249 126.203 54.625 32.700 1.00 25.00

2254 1HH2 ARG 24. 128.229 53.396 35.269 1.00 25.00

2255 2HH2 ARG 249 127.675 53.153 33.646 1.00 25.00

2256 N TRP 250 120.848 55.053 36.603 1.00 46.33

2257 CA T TRRPP 250 119.480 55.024 36.092 1.00 43.84

2258 C T TRRPP 250 118.488 55.311 37.230 1.00 46.38

2259 0 T TRRPP 250 117.566 56.118 37.075 1.00 44.72

2260 CB T TRRRRIP 250 119.201 53.652 35.456 1.00 38.48

2261 CG T TRRPP 250 117.747 53.324 35.232 1.00 37.37

2262 CD1 T TRRPP 250 116.986 53.661 34.150 1.00 33.31

2263 CD2 TRP 250 116.891 52.569 36.105 1.00 36.85

2264 NE1 TRP 250 115.713 53.164 34.293 1.00 34.01

2265 CE2 T TRRPP 250 115.626 52.490 35.483 1.00 36.82

2266 CE3 TTRRPP 250 117.070 51.952 37.352 1.00 34.91

2267 CZ2 TTRRPP 250 114.543 51.816 36.065 1.00 39.04

2268 CZ3 TTRRPP 250 115.992 51.281 37.932 1.00 39.64

2269 CH2 TRP 250 114.746 51.220 37.286 1.00 39.49

2270 H TRP 250 121.423 54.272 36.448 1.00 25.00

2271 HE1 T TRRPP 250 114.984 53.281 33.650 1.00 25.00

2272 N TTRRPP 251 118.718 54.683 38.382 1.00 46.65

2273 CA TTRRPP 251 117.859 54.851 39.551 1.00 54.20

2274 C TTRRPP 251 117.864 56.279 40.089 1.00 59.43

2275 0 TTRRPP 251 116.814 56.823 40.445 1.00 62.13

2276 CB TTRRPP 251 118.284 53.889 40.657 1.00 51.89

2277 CG TTRRPP 251 117.358 53.872 41.836 1.00 58.17

2278 CD1 TTRRPP 251 117.596 54.402 43.071 1.00 60.91

2279 CD2 TRP 251 116.069 53.246 41.908 1.00 60.72

2280 NE1 TRP 251 116.541 54.136 43.912 1.00 64.22 2281 CE2 TRP 251 1 15.589 53.429 43.225 1.00 60.87

2282 CE3 TRP 251 115.274 52.546 40.989 1.00 56.90

2283 CZ2 TRP 251 1 14.351 52.934 43.648 1.00 58.08

2284 CZ3 TRP 251 1 14.042 52.054 41.410 1.00 53.15

2285 CH2 TRP 251 113.594 52.252 42.729 1.00 53.35

2286 H TRP 251 119.485 54.076 38.442 1.00 25.00

2287 HE1 TRP 251 1 16.481 54.409 44.851 1.00 25.00

2288 N LYS 252 119.049 56.875 40.167 1.00 64.71

2289 CA LYS 252 119.191 58.241 40.661 1.00 68.07

2290 C LYS 252 1 18.440 59.227 39.779 1.00 65.20

2291 0 LYS 252 117.831 60.169 40.283 1.00 65.28

2292 CB LYS 252 120.668 58.621 40.755 1.00 75.64

2293 CG LYS 252 121.400 57.815 41.803 1.00 85.57

2294 CD LYS 252 122.890 57.818 41.588 1.00 92.92

2295 CE LYS 252 123.526 56.776 42.486 1.00 95.43

2296 NZ LYS 252 124.902 56.526 42.101 1.00 94.64

2297 H LYS 252 119.849 56.379 39.887 1.00 25.00

22998 1 HZ LYS 252 125.056 56.256 41.101 1.00 25.00

2299 2HZ LYS 252 125.376 57.437 42.219 1.00 25.00

2300 3HZ LYS 252 125.417 55.867 42.716 1.00 25.00

2301 N ASP 253 118.453 58.983 38.469 1.00 63.40

2302 CA ASP 253 117.762 59.846 37.515 1.00 63.30

2303 C ASP 253 116.265 59.872 37.796 1.00 63.95

2304 0 ASP 253 115.635 60.925 37.729 1.00 68.15

2305 CB ASP 253 118.003 59.376 36.077 1.00 68.18

2306 CG ASP 253 119.467 59.453 35.664 1.00 76.46

2307 OD1 ASP 253 120.293 60.015 36.419 1.00 78.84

2308 OD2 ASP 253 119.793 58.943 34.570 1.00 79.35

2309 H ASP 253 118.948 58.203 38.137 1.00 25.00

2310 N LEU 254 115.697 58.710 38.105 1.00 66.44

2311 CA LEU 254 114.271 58.611 38.409 1.00 65.57

2312 C LEU 254 113.947 59.482 39.616 1.00 67.65

2313 0 LEU 254 112.815 59.931 39.784 1.00 68.72

2314 CB LEU 254 113.885 57.162 38.698 1.00 61.14

2315 CG LEU 254 114.124 56.166 37.564 1.00 57.75

2316 CD1 LEU 254 113.718 54.785 38.021 1.00 58.43

2317 CD2 LEU 254 113.343 56.571 36.328 1.00 55.32

2318 H LEU 254 116.252 57.902 38.125 1.00 25.00

2319 N ASP 255 114.947 59.661 40.475 1.00 73.64

2320 CA ASP 255 114.842 60.490 41.670 1.00 78.31

2321 C ASP 255 113.664 60.123 42.574 1.00 79.28

2322 0 ASP 255 113.079 60.985 43.230 1.00 81.76

2323 CB ASP 255 114.777 61.971 41.261 1.00 83.27

2324 CG ASP 255 115.238 62.915 42.364 1.00 87.17

2325 OD1 ASP 255 115.719 62.443 43.420 1.00 86.98

2326 OD2 ASP 255 115.121 64.144 42.165 1.00 87.49

2327 H ASP 255 115.805 59.226 40.294 1.00 25.00

2328 N PHE 256 113.357 58.834 42.659 1.00 80.00

2329 CA PHE 256 112.254 58.378 43.500 1.00 84.32

2330 C PHE 256 112.504 58.649 44.976 1.00 89.15

2331 0 PHE 256 111.562 58.742 45.759 1.00 87.59

2332 CB PHE 256 111.987 56.887 43.290 1.00 81.00 2333 CG PHE 256 111.352 56.566 41.972 1.00 76.86

2334 CD1 PHE 256 110.671 57.544 41.251 1.00 76.59

2335 CD2 PHE 256 111.431 55.283 41.449 1.00 73.54

2336 CE1 PHE 256 110.080 57.247 40.030 1.00 76.03

2337 CE2 PHE 256 110.844 54.976 40.229 1.00 71.61

2338 CZ PHE 256 110.167 55.958 39.518 1.00 74.95

2339 H PHE 256 113.874 58.189 42.139 1.00 25.00

2340 N VAL 257 113.774 58.796 45.344 1.00 97.79

2341 CA VAL 257 114.160 59.053 46.730 1.00104.36

2342 C VAL 257 113.428 60.269 47.303 1.00105.53

2343 0 VAL 257 112.952 60.239 48.439 1.00106.91

2344 CB VAL 257 115.692 59.270 46.854 1.00107.20

2345 CG1 VAL 257 116.092 59.432 48.316 1.00107.16

2346 CG2 VAL 257 116.445 58.101 46.220 1.00106.33

2347 H VAL 257 114.464 58.732 44.658 1.00 25.00

2348 N THR 258 113.332 61.329 46.5506 1.00105.84

2349 CA THR 258 112.660 62.550 46.935 1.00104.41

2350 C THR 258 111.183 62.608 46.531 1.00104.31

2351 0 THR 258 110.339 63.047 47.314 1.00104.07

2352 CB THR 258 113.392 63.805 46.408 1.00104.30

2353 0G1 THR 258 113.620 63.674 45.000 1.00104.41

2354 CG2 THR 258 114.729 63.982 47.117 1.00105.42

2355 H THR 258 113.711 61.308 45.603 1.00 25.00

2356 HG1 THR 258 114.068 64.458 44.669 1.00 25.00

2357 N THR 259 110.872 62.161 45.317 1.00103.41

2358 CA THR 259 109.497 62.182 44.825 1.00100.89

2359 C THR 259 108.599 61.133 45.482 1.00101.97

2360 0 THR 259 107.414 61.375 45.707 1.00103.53

2361 CB THR 259 109.445 62.022 43.289 1.00 97.37

2362 0G1 THR 259 110.219 60.883 42.894 1.00 95.69

2363 CG2 THR 259 109.988 63.267 42.602 1.00 95.50

2364 H THR 259 111.579 61.811 44.728 1.00 25.00

2365 HG1 THR 259 109.870 60.086 43.290 1.00 25.00

2366 N LEU 260 109.164 59.969 45.783 1.00102.18

2367 CA LEU 260 108.415 58.884 46.412 1.00103.22

2368 C LEU 260 109.112 58.431 47.696 1.00106.86

2369 0 LEU 260 109.742 57.372 47.732 1.00107.73

2370 CB LEU 260 108.282 57.700 45.445 1.00 98.81

2371 CG LEU 260 107.552 57.928 44.119 1.00 94.81

2372 CD1 LEU 260 107.620 56.670 43.269 1.00 89.99

2373 CD2 LEU 260 106.108 58.320 44.380 1.00 92.83

2374 H LEU 260 110.112 59.844 45.595 1.00 25.00

2375 N PRO 261 108.963 59.204 48.784 1.00110.17

2376 CA PRO 261 109.580 58.889 50.077 1.00112.52

2377 C PRO 261 108.951 57.726 50.855 1.00114.04

2378 0 PRO 261 108.783 57.813 52.073 1.00117.31

2379 CB PRO 261 109.441 60.207 50.836 1.00113.40

2380 CG PRO 261 108.124 60.715 50.347 1.00112.70

2381 CD PRO 261 108.223 60.477 48.856 1.00111.17

2382 N TYR 262 108.599 56.646 50.163 1.00113.40

2383 CA TYR 262 108.012 55.479 50.822 1.00112.08

2384 C TYR 262 108.608 54.178 50.284 1.00112.01 2385 0 TYR 262 108.125 53.086 50.582 1.00110.30

2386 CB TYR 262 106.477 55..478 50.702 1.00109.31

2387 CG TYR 262 105.931 55.286 49.303 1.00104.93

2388 CD1 TYR 262 105.777 56.369 48.440 1.00103.18

2389 CD2 TYR 262 105.555 54.021 48.846 1.00102.84

2390 CE1 TYR 262 105.262 56.201 47.159 1.00101.09

2391 CE2 TYR 262 105.040 53.842 47.565 1.00100.35

2392 CZ TYR 262 104.897 54.938 46.727 1.00100.07

2393 OH TYR 262 104.386 54.781 45.459 1.00 97.25

2394 H TYR 262 108.755 56.615 49.199 1.00 25.00

2395 HH TYR 262 104.276 53.862 45.236 1.00 25.00

2396 N ALA 263 109.671 54.310 49.497 1.00113.1 1

2397 CA ALA 263 110.360 53.166 48.913 1.00114.09

2398 C ALA 263 1 11.856 53.343 49.146 1.00114.75

2399 0 ALA 263 112.375 54.457 49.055 1.00115.90

2400 CB ALA 263 110.064 53.077 47.428 1.00112.96

2401 H ALA 263 110.034 55.202 49.305 1.00 25.00

2402 N ARG 264 112.543 52.252 49.467 1.00113.69

2403 CA ARG 264 1 13.979 52.309 49.726 1.00114.09

2404 C ARG 264 114.847 51.948 48.526 1.00109.03

2405 0 ARG 264 114.394 51.280 47.594 1.00109.80

2406 CB ARG 264 114.355 51.448 50.945 1.00116.51

2407 CG ARG 264 113.434 50.258 51.235 1.00118.71

2408 CD ARG 264 113.486 49.190 50.151 1.00120.73

2409 NE ARG 264 112.543 48.105 50.418 1.00118.02

2410 CZ ARG 264 111.607 47.696 49.565 1.00115.79

2411 NH1 ARG 264 111.479 48.277 48.380 1.00114..07

2412 NH2 ARG 264 110.788 46.709 49.904 1.00113.33

2413 H ARG 264 112.079 51.393 49.495 1.00 25.00

2414 HE ARG 264 112.602 47.651 51.284 1.00 25.00

2415 1HH1 ARG 264 112.083 49.029 48.120 1.00 25.00

2416 2HH1 ARG 264 110.766 47.967 47.751 1.00 25.00

2417 1HH2 ARG 264 110.868 46.283 50.807 1.00 25.00

2418 2HH2 ARG 264 110.074 46.408 49.273 1.00 25.00

2419 N ASP 265 116.089 52.421 48.550 1.00103.18

2420 CA ASP 265 117.045 52.152 47.485 1.00 97.60

2421 C ASP 265 117.480 50.688 47.579 1.00 92.70

2422 0 ASP 265 118.533 50.371 48.138 1.00 96.57

2423 CB ASP 265 118.255 53.086 47.619 1.00100.16

2424 CG ASP 265 1199.317 52.826 46.565 1.00106.00

2425 OD1 ASP 265 118.992 52.887 45.363 1.00107.25

2426 OD2 ASP 265 120.479 52.556 46.940 1.00109.23

2427 H ASP 265 116.373 52.965 49.310 1.00 25.00

2428 N ARG 266 116.654 49.799 47.041 1.00 82.19

2429 CA ARG 266 116.942 48.372 47.073 1.00 73.27

2430 C ARG 266 117.613 47.910 45.775 1.00 63.23

2431 0 ARG 266 117.711 46.712 45.511 1.00 66.31

2432 CB ARG 266 115.646 47.585 47.320 1.00 77.54

2433 CG ARG 266 115.801 46.402 48.274 1.00 83.80

2434 CD ARG 266 114.480 45.672 48.520 1.00 86.40

2435 NE ARG 266 114.015 44.911 47.358 1.00 87.97

2436 CZ ARG 266 114.383 43.661 47.077 1.00 87.83 2437 NH1 ARG 266 1 15.229 43.014 47.869 1.00 86.43

2438 NH2 ARG 266 1 13.895 43.049 46.005 1.00 80.67

2439 H ARG 266 1 15.816 50.1 12 46.631 1.00 25.00

2440 HE ARG 266 1 13.386 45.348 46.747 1.00 25.00

2441 1 HH1 ARG 266 115.600 43.463 48.681 1.00 25.00

2442 2HH1 ARG 266 1 15.502 42.079 47.647 1.00 25.00

2443 1 HH2 ARG 266 1 13.246 43.525 45.410 1.00 25.00

2444 2HH2 ARG 266 1 14.170 42.111 45.794 1.00 25.00

2445 N VAL 267 118.130 48.859 45.000 1.00 54.00

2446 CA VAL 267 118.778 48.560 43.722 1.00 46.85

2447 C VAL 267 1 19.865 47.496 43.784 1.00 44.14

2448 O VAL 267 119.911 46.609 42.935 1.00 45.14

2449 CB VAL 267 1 19.361 49.827 43.076 1.00 45.45

2450 CG1 VAL 267 119.991 49.499 41.733 1.00 42.99

2451 CG2 VAL 267 118.273 50.848 42.892 1.00 51.05

2452 H VAL 267 118.072 49.785 45.299 1.00 25.00

2453 N VAL 268 120.738 47.576 44.781 1.00 40.56

2454 CA VAL 268 121.813 46.597 44.910 1.00 38.21

2455 C VAL 268 121.242 45.185 45.125 1.00 35.40

2456 O VAL 268 121.708 44.220 44.513 1.00 29.56

2457 CB VAL 268 122.785 46.976 46.046 1.00 40.34

2458 CG1 VAL 268 123.983 46.055 46.040 1.00 41.41

2459 CG2 VAL 268 123.239 48.414 45.880 1.00 43.02

2460 H VAL 268 120.663 48.303 45.428 1.00 25.00

2461 N GLU 269 120.202 45.081 45.952 1.00 33.49

2462 CA GLU 2669 119.553 43.796 46.220 1.00 31.75

2463 C GLU 269 118.910 43.278 44.936 1.00 31.29

2464 O GLU 269 119.023 42.095 44.607 1.00 34.74

2465 CB GLU 269 118.477 43.940 47.300 1.00 30.42

2466 CG GLU 269 118.998 44.124 48.719 1.00 41.96

2467 CD GLU 269 119.777 45.418 48.921 1.00 53.70

2468 OE1 GLU 269 119.387 46.465 48.356 1.00 52.14

2469 OE2 GLU 269 120.785 45.385 49.658 1.00 60.44

2470 H GLU 269 119.849 45.888 46.369 1.00 25.00

2471 N CYS 270 118.258 44.179 44.204 1.00 25.87

2472 CA CYS 270 117.603 43.829 42.948 1.00 31.04

2473 C CYS 270 118.628 43.330 41.944 1.00 31.66

2474 0 CCYYSS 270 118.352 42.406 41.170 1.00 34.14

2475 CB CCYYSS 270 116.841 45.029 42.380 1.00 31.00

2476 SG CCYYSS 270 115.468 45.566 43.429 1.00 41.23

2477 H CCYYSS 270 118.204 45.102 44.523 1.00 25.00

2478 N T TYYRR 271 119.817 43.927 41.968 1.00 30.55

2479 CA TTYYRR 271 120.875 43.506 41.065 1.00 29.41

2480 C TTYYRR 271 121.365 42.109 41.459 1.00 29.51

2481 0 TTYYRR 271 121.662 41.284 40.592 1.00 30.16

2482 CB TTYYRR 271 122.048 44.496 41.048 1.00 27.85

2483 CG TTYYRR 271 123.125 44.061 40.077 1.00 27.35

2484 CD1 TTYYRR 271 123.006 44.327 38.714 1.00 25.72

2485 CD2 TYR 271 124.198 43.279 40.502 1.00 20.62

2486 CE1 TYR 271 123.923 43.813 37.798 1.00 22.98

2487 CE2 TYR 271 125.116 42.762 39.593 1.00 27.42

2488 CZ TYR 271 124.970 43.030 38.245 1.00 21.79 2489 OH TYR 271 125.859 42.497 37.343 1.00 23.43

2490 H TYR 271 119.985 44.662 42.594 1.00 25.00

2491 HH TYR 271 126.485 41.987 37.843 1.00 25.00

2492 N PHE 272 121.453 41.845 42.760 1.00 26.47

2493 CA PHE 272 121.892 40.535 43.220 1.00 28.71

2494 C PHE 272 120.957 39.486 42.633 1.00 31.32

2495 0 PHE 272 121.408 38.470 42.102 1.00 31.50

2496 CB PHE 272 121.881 40.442 44.747 1.00 32.54

2497 CG PHE 272 122.165 39.058 45.264 1.00 34.15

2498 CD1 PHE 272 123.471 38.577 45.323 1.00 32.37

2499 CD2 PHE 272 121.120 38.211 45.638 1.00 34.09

2500 CE11 PHE 272 123.732 37.271 45.739 1.00 35.66

2501 CE2 PHE 272 121.369 36.902 46.055 1.00 34.18

2502 CZ PHE 272 122.679 36.431 46.105 1.00 36.58

2503 H PHE 272 121.228 42.541 43.413 1.00 25.00

2504 N TRP 273 119.656 39.744 42.712 1.00 29.73

2505 CA TRP 273 118.670 38.817 42.167 1.00 30.60

2506 C TRP 273 118.924 38.551 40.685 1.00 30.33

2507 0 TRP 273 118.971 37.396 40.250 1.00 32.10

2508 CB TRP 273 117.255 39.357 42.365 1.00 28.17

2509 CG TRP 273 116.707 39.092 43.721 1.00 33.41

2510 CD1 TRP 273 117.241 39.478 44.915 1.00 37.71

2511 CD2 TRP 273 115.506 38.381 44.029 1.00 41.82

2512 NE1 TRP 273 116.445 39.053 45.950 1.00 39.11

2513 CE2 TRP 273 115.372 38.378 45.435 1.00 43.90

2514 CE3 TRP 273 114.528 37.747 43.253 1.00 47.13

2515 CZ2 TRP 273 114.296 37.764 46.083 1.00 49.35

2516 CZ3 TRP 273 113.458 37.136 43.898 1.00 53.38

2517 CH2 TRP 273 113.352 37.150 45.300 1.00 53.17

2518 H TRP 273 119.359 40.569 43.153 1.00 25.00

2519 HE1 TRP 273 116.622 39.201 46.903 1.00 25.00

2520 N ALA 274 119.117 39.617 39.915 1.00 26.20

2521 CA ALA 274 119.371 39.472 38.489 1.00 25.12

2522 C ALA 274 120.638 38.657 38.263 1.00 27.03

2523 0 ALA 274 120.686 37.816 37.366 1.00 29.08

2524 CB ALA 274 119.491 40.832 37.831 1.00 22.68

2525 H ALA 274 119.0884 40.514 40.313 1.00 25.00

2526 N LEU 275 121.646 38.886 39.104 1.00 26.74

2527 CA LEU 275 122.922 38.175 39.011 1.00 23.65

2528 C LEU 275 122.727 36.689 39.329 1.00 20.19

2529 0 LEU 275 123.432 35.825 38.798 1.00 18.69

2530 CB LEU 275 123.945 38.802 39.963 1.00 22.77

2531 CG LEU 275 125.377 38.280 39.867 1.00 22.23

2532 CD1 LEU 275 125.859 38.352 38.427 1.00 20.45

2533 CD2 LEU 275 126.274 39.097 40.779 1.00 24.10

2534 H LEU 275 121.532 39.552 39.808 1.00 25.00

2535 N GLY 276 121.765 36.406 40.204 1.00 19.17

2536 CA GLY 276 121.453 35.035 40.561 1.00 19.61

2537 C GLY 276 120.811 34.299 39.392 1.00 25.48

2538 0 GLY 276 121.060 33.108 39.199 1.00 28.59

2539 H GLY 276 121.266 37.137 40.623 1.00 25.00

2540 N VAL 277 120.000 35.006 38.603 1.00 20.84 2541 CA VAL 277 119.323 34.415 37.440 1.00 19.19

2542 C VAL 277 120.304 34.028 36.319 1.00 19.17

2543 0 VAL 277 120.086 33.048 35.606 1.00 21.35

2544 CB VAL 277 118.201 35.355 36.904 1.00 21.19

2545 CG1 VAL 277 117.560 34.777 35.650 1.00 15.33

2546 CG2 VAL 277 1 17.138 35.550 37.976 1.00 11.13

2547 H VAL 277 1 19.858 35.954 38.810 1.00 25.00

2548 N TYR 278 121.345 34.834 36.137 1.00 21.16

2549 CA TYR 278 122.401 34.587 35.150 1.00 24.77

2550 C TYR 278 123.583 35.532 35.351 1.00 29.35

2551 0 TYR 278 123.405 36.738 35.531 1.00 27.69

2552 CB TYR 278 121.910 34.611 33.687 1.00 25.96

2553 CG TYR 278 120.741 35.517 33.341 1.00 26.89

2554 CD1 TYR 278 120.580 36.768 33.937 1.00 25.88

2555 CD2 TYR 278 119.800 35.116 32.388 1.00 27.14

2556 CE1 TYR 278 119.508 37.595 33.594 1.00 29.19

2557 CE2 TYR 278 118.729 35.934 32.037 1.00 31.49

2558 CZ TYR 278 118.587 37.171 32.643 1.00 31.78

2559 OH TYR 278 117.522 37.976 32.301 1.00 31.66

2560 H TYR 278 121.419 35.652 36.684 1.00 25.00

2561 HH TYR 278 117.022 37.548 31.600 1.00 25.00

2562 N PHE 279 124.789 34.968 35.332 1.00 31.85

2563 CA PHE 279 126.017 35.732 35.549 1.00 28.28

2564 C PHE 279 126.910 35.844 34.318 1.00 28.86

2565 0 PHE 279 127.855 36.636 34.310 1.00 28.24

2566 CB PHE 279 126.829 35.087 36.678 1.00 24.38

2567 CG PHE 279 127.334 33.707 36.344 1.00 23.04

2568 CD1 PHE 279 128.563 33.535 35.706 1.00 16.44

2569 CD2 PHE 279 126.557 32.582 36.616 1.00 22.61

2570 CE1 PHE 279 129.005 32.265 35.339 1.00 22.82

2571 CE2 PHE 279 126.989 31.309 36.254 1.00 22.81

2572 CZ PHE 279 128.214 31.149 35.613 1.00 20.63

2573 H PHE 279 124.845 34.006 35.181 1.00 25.00

2574 N GLU 280 126.653 35.010 33.315 1.00 25.83

2575 CA GLU 280 127.450 34.995 32.093 1.00 25.96

2576 C GLU 280 127.464 36.347 31.384 1.00 32.09

2577 0 GLU 280 126.461 37.067 31.378 1.00 33.29

2578 CB GLU 280 126.947 33.909 31.140 1.00 29.64

2579 CG GLU 280 127.116 32.479 31.652 1.00 31.98

2580 CD GLU 280 125.873 31.921 32.338 1.00 41.40

2581 OE1 GLU 280 125.089 32.696 32.938 1.00 33.42

2582 OE2 GLU 280 125.681 30.688 32.273 1.00 43.76

2583 H GLU 280 125.894 34.421 33.402 1.00 25.00

2584 N PRO 281 128.593 36.687 30.735 1.00 34.75

2585 CA PRO 281 128.736 37.961 30.018 1.00 32.48

2586 C PRO 281 127.718 38.182 28.899 1.00 30.11

2587 0 PRO 281 127.273 39.309 28.675 1.00 33.55

2588 CB PRO 281 130.177 37.901 : 229.492 1.00 33.45

2589 CG PRO 281 130.447 36.426 29.366 1.00 34.83

2590 CD PRO 281 129.824 35.882 30.625 1.00 32.94

2591 N GLN 282 127.319 37.106 28.226 1.00 30.38

2592 CA GLN 282 126.350 37.195 27.134 1.00 31.74 2593 C GLN 282 124.980 37.704 27.600 1.00 33.53

2594 0 GLN 282 124.194 38.202 26.792 1.00 34.52

2595 CB GLN 282 126.183 35.829 26.462 1.00 35.52

2596 CG GLN 282 125.442 34.819 27.323 1.00 47.53

2597 CD GLN 282 125.543 33.400 26.807 1.00 54.68

2598 OE1 GLN 282 126.378 32.624 27.273 1.00 58.66

2599 NE2 GLN 282 124.675 33.040 25.866 1.00 55.48

2600 H GLN 282 127.685 36.233 28.468 1.00 25.00

2601 1 HE2 GLLN 282 124.740 32.122 25.538 1.00 25.00

2602 2HE2 GLN 282 124.018 33.690 25.551 1.00 25.00

2603 N TYR 283 124.698 37.577 28.896 1.00 27.81

2604 CA TYR 283 123.417 38.015 29.447 1.00 26.64

2605 C TYR 283 123.470 39.392 30.099 1.00 29.80

2606 0 TYR 283 122.615 39.732 30.922 1.00 29.85

2607 CB TYR 283 122.885 36.982 30.444 1.00 24.82

2608 CG TYR 283 122.670 35.614 29.840 1.00 26.77

2609 CD1 TYR 283 121.786 35.432 28.775 1.00 28.94

2610 CD2 TYR 283 123.373 34.506 30.313 1.00 26.51

2611 CE1 TYR 283 121.610 34.174 28.192 1.00 32.76

2612 CE2 TYR 283 123.205 33.247 29.740 1.00 28.52

2613 CZ TYR 283 122.324 33.086 28.680 1.00 30.97

2614 OH TYR 283 122.164 31.845 28.104 1.00 25.13

2615 H TYR 283 125.361 37.198 29.509 1.00 25.00

2616 HH TYR 283 122.723 31.208 28.556 1.00 25.00

2617 N SER 284 124.449 40.196 29.697 1.00 30.66

2618 CA SER 284 124.620 41.539 30.239 1.00 33.15

2619 C SER 284 123.375 42.412 30.040 1.00 32.37

2620 0 SER 284 122.858 42.999 30.999 1.00 32.25

2621 CB SER 284 125.848 42.201 29.609 1.00 32.60

2622 OG SER 284 126.037 43.511 30.110 1.00 38.65

2623 H SER 284 125.090 39.876 29.027 1.00 25.00

2624 HG SER 284 126.140 43.520 31.058 1.00 25.00

2625 N GLN 285 122.882 42.477 28.805 1.00 35.28

2626 CA GLN 285 121.693 43.273 28.505 1.00 36.59

2627 C GLN 285 120.489 42.735 29.284 1.00 33.06

2628 0 GLN 285 119.713 43.504 29.856 1.00 33.43

2629 CB GLN 285 121.399 43.255 27.002 1.00 36.57

2630 CG GLN 285 120.138 44.020 26.611 1.00 48.54

2631 CD GLN 285 119.829 43.943 25.123 1.00 54.77

2632 OE1 GLN 285 120.079 42.927 24.470 1.00 55.77

2633 NE2 GLN 285 119.280 45.024 24.581 1.00 56.33

2634 H GLN 285 123.323 41.984 28.086 1.00 25.00

2635 1HE2 GLN 285 119.084 44.982 23.621 1.00 25.00

2636 2HE2 GLN 285 119.099 45.802 25.141 1.00 25.00

2637 N ALA 286 120.364 41.410 29.324 1.00 32.38

2638 CA ALA 286 119.272 40.750 30.032 1.00 28.79

2639 C ALA 286 119.254 41.117 31.512 1.00 26.70

2640 0 ALA 286 118.200 41.438 32.060 1.00 31.71

2641 CB ALA 286 119.370 39.244 29.859 1.00 30.35

2642 H ALA 286 121.023 40.859 28.861 1.00 25.00

2643 N ARG 287 120.422 41.097 32.152 1.00 26.48

2644 CA ARG 287 120.517 41.442 33.568 1.00 27.31 2645 C ARG 287 120.056 42.870 33.826 1.00 27.08

2646 0 ARG 287 1 19.290 43.118 34.760 1.00 28.78

2647 CB ARG 287 121.946 41.266 34.096 1.00 28.17

2648 CG ARG 287 122.240 39.891 34.652 1.00 25.50

2649 CD ARG 287 123.566 39.859 35.396 1.00 24.46

2650 NE ARG 287 124.703 40.191 34.535 1.00 20.40

2651 CZ ARG 287 125.252 39.373 33.641 1.00 23.12

2652 NH1 ARG 287 124.781 38.146 33.473 1.00 23.32

2653 NH2 ARG 287 126.268 39.793 32.897 1.00 22.53

2654 H ARG 287 121.232 40.840 31.670 1.00 25.00

2655 HE ARG 287 125.093 41.059 34.627 1.00 25.00

2656 1 HH1 ARG 287 124.002 37.833 34.014 1.00 25.00

2657 2HH1 ARG 287 125.192 37.542 32.796 1.00 25.00

2658 1 HH2 ARG 287 126.623 40.719 33.014 1.00 25.00

2659 2HH2 ARG 287 126.677 39.179 32.225 1.00 25.00

2660 N VAL 288 120.512 43.802 32.992 1.00 30.28

2661 CA V VAALL 288 120.144 45.208 33.148 1.00 29.94

2662 C VVAALL 288 1 18.628 45.388 33.043 1.00 28.55

2663 0 VVAALL 288 118.018 46.044 33.890 1.00 35.55

2664 CB VVAALL 288 120.874 46.106 32.120 1.00 35.29

2665 CG1 VVAALL 288 120.536 47.572 32.363 1.00 30.30

2666 CG2 VAL 288 122.378 45.896 32.221 1.00 31.86

2667 H VAL 288 121.107 43.535 32.256 1.00 25.00

2668 N M MEETT 289 118.018 44.775 32.031 1.00 27.91

2669 CA M MEETT 289 116.567 44.856 31.854 1.00 27.36

2670 C M MEETT 289 115.857 44.248 33.066 1.00 27.49

2671 0 M MEETT 289 114.938 44.845 33.627 1.00 29.43

2672 CB M MEETT 289 116.136 44.129 30.572 1.00 28.18

2673 CG M MEETT 289 116.578 44.819 29.282 1.00 28.82

2674 SD M MEETT 289 116.207 43.882 27.770 1.00 38.33

2675 CE M MEETT 289 114.526 44.384 27.438 1.00 39.91

2676 H M MEETT 289 118.554 44.257 31.391 1.00 25.00

2677 N L LEEUU 290 116.335 43.089 33.511 1.00 25.99

2678 CA L LEEUU 290 115.743 42.408 34.654 1.00 25.33

2679 C L LEEUU 290 115.805 43.222 35.949 1.00 26.44

2680 0 L LEEUU 290 114.815 43.289 36.687 1.00 30.04

2681 CB L LEEUU 290 116.393 41.035 34.843 1.00 25.26

2682 CG L LEEUU 290 115.880 40.125 35.964 1.00 25.88

2683 CD1 L LEEUU 290 114.357 40.043 35.951 1.00 19.53

2684 CD2 L LEEUU 290 116.499 38.741 35.796 1.00 18.49

2685 H L LEEUU 290 117.098 42.681 33.057 1.00 25.00

2686 N V VAALL 291 116.947 43.857 36.210 1.00 27.54

2687 CA V VAALL 291 117.124 44.667 37.421 1.00 28.37

2688 C V VAALL 291 116.101 45.799 37.502 1.00 27.52

2689 0 V VAALL 291 115.487 46.023 38.5550 1.00 27.61

2690 CB V VAALL 291 118.544 45.289 37.507 1.00 28.94

2691 CG1 V VAALL 291 118.706 46.054 38.803 1.00 25.65

2692 CG2 VAL 291 119.592 44.214 37.431 1.00 36.38

2693 H VAL 291 117.687 43.782 35.573 1.00 25.00

2694 N L LYYSS 292 115.911 46.502 36.392 1.00 27.46

2695 CA LLYYSS 292 114.968 47.611 36.345 1.00 28.57

2696 C LLYYSS 292 113.546 47.158 36.677 1.00 30.77 2697 0 LYS 292 112.834 47.824 37.433 1.00 31.18

2698 CB LYS 292 115.029 48.285 34.976 1.00 29.35

2699 CG LYS 292 116.391 48.890 34.676 1.00 29.57

2700 CD LYS 292 116.463 49.431 33.261 1.00 34.35

2701 CE LYS 292 117.810 50.079 32.999 1.00 37.92

2702 NZ LYS 292 117.909 50.619 31.619 1.00 40.64

2703 H LYS 292 116.413 46.260 35.581 1.00 25.00

2704 1 HZ LYS 292 117.780 49.846 30.936 1.00 25.00

2705 2HZ LYS 292 117.169 51.334 31.476 1.00 25.00

2706 3HZ LYS 292 118.844 51.052 31.483 1.00 25.00

2707 N THR 293 113.146 46.010 36.137 1.00 34.24

2708 CA THR 293 111.817 45.463 36.395 1.00 27.43

2709 C THR 293 111.657 45.123 37.872 1.00 31.58

2710 0 THR 293 110.655 45.493 38.491 1.00 28.71

2711 CB THR 293 111.561 44.214 35.534 1.00 25.43

2712 OG1 THR 293 111.354 44.616 34.175 1.00 30.49

2713 CG2 THR 293 110.348 43.433 36.029 1.00 22.44

2714 H THR 293 113.756 45.525 35.533 1.00 25.00

2715 HG1 THR 293 110.577 45.180 34.129 1.00 25.00

2716 N ILE 294 112.647 44.439 38.440 1.00 30.35

2717 CA ILE 294 112.596 44.064 39.853 1.00 30.45

2718 C ILE 294 112.481 45.317 40.725 1.00 28.69

2719 0 ILE 294 111.709 45.348 41.685 1.00 30.57

2720 CB ILE 294 113.837 43.230 40.272 1.00 29.95

2721 CG1 ILE 294 113.948 41.977 39.399 1.00 24.34

2722 CG2 ILE 294 113.733 42.818 41.734 1.00 18.35

2723 CD1 ILE 294 115.165 41.133 39.687 1.00 30.84

2724 H ILE 294 113.432 44.182 37.906 1.00 25.00

2725 N SER 295 113.219 46.361 40.359 1.00 32.61

2726 CA SER 295 113.196 47.623 41.097 1.00 37.07

2727 C SER 295 111.820 48..276 41.002 1.00 35.65

2728 0 SER 295 111.227 48.673 42.011 1.00 33.09

2729 CB SER 295 114.246 48.584 40.533 1.00 35.83

2730 OG SER 295 115.543 48.024 40.608 1.00 42.38

2731 H SER 295 113.804 46.290 39.575 1.00 25.00

2732 HG SER 295 115.756 47.823 41.523 1.00 25.00

2733 N MET 296 111.306 48.342 39.779 1.00 34.54

2734 CA MET 296 110.017 48.951 39.506 1.00 35.02

2735 C MET 296 108.864 48.263 40.230 1.00 36.33

2736 0 MET 296 108.080 48.919 40.923 1.00 35.61

2737 CB MET 296 109.768 48.966 37.999 1.00 39.18

2738 CG MET 296 109.109 50.234 37.507 1.00 49.37

2739 SD MET 296 109.993 51.708 38.067 1.00 51.57

2740 CE MET 296 108.888 52.271 39.359 1.00 53.40

2741 H MET 296 111.819 47.966 39.036 1.00 25.00

2742 N ILE 297 108.780 46.941 40.103 1.00 37.42

2743 CA ILE 297 107.709 46.185 40.745 1.00 34.54

2744 C ILE 297 107.813 46.267 42.267 1.00 36.45

2745 0 ILE 297 106.817 46.101 42.976 1.00 35.56

2746 CB ILE 297 107.675 44.709 40.265 1.00 36.67

2747 CG1 ILE 297 106.342 44.059 40.648 1.00 30.90

2748 CG2 ILE 297 108.858 43.925 40.821 1.00 34.15 2749 CD1 ILE 297 105.135 44.654 39.935 1.00 28.47

2750 H ILE 297 109.454 46.468 39.576 1.00 25.00

2751 N SER 298 109.015 46.559 42.761 1.00 37.95

2752 CA SER 298 109.250 46.696 44.195 1.00 40..22

2753 C SER 298 108.531 47.961 44.673 1.00 38.96

2754 0 SER 298 107.934 47.979 45.753 1.00 36.43

2755 CB SER 298 110.751 46.791 44.481 1.00 43.72

2756 OG SER 298 1 11.00 9 46.764 45.873 1.00

62.08

2757 H SER 298 109.775 46.674 42.153 1.00 25.00

2758 HG SER 298 110.573 47.504 46.304 1.00 25.00

2759 N ILE 299 108.582 49.011 43.857 1.00 39.57

2760 CA ILE 299 107.912 50.271 44.175 1.00 40.91

2761 C ILE 299 106.412 49.996 44.293 1.00 40.75

2762 0 ILE 299 105.771 50.378 45.276 1.00 40.26

2763 CB ILE 299 108.128 51.329 43.060 1.00 37.27

2764 CG1 ILE 299 109.614 51.653 42.908 1.00 37.90

2765 CG2 ILE 299 1077.345 52.592 43.370 1.00 42.54

2766 CD1 ILE 299 110.260 52.146 44.173 1.00 39.79

2767 H ILE 299 109.091 48.942 43.021 1.00 25.00

2768 N VAL 300 105.876 49.290 43.301 1.00 34.47

2769 CA VAL 300 104.462 48.949 43.267 1.00 33.70

2770 C VAL 300 104.050 48.145 44.497 1.00 38.81

2771 0 VAL 300 103.020 48.431 45.116 1.00 39.02

2772 CB VAL 300 104.1"16 48.166 41.990 1.00 35.45

2773 CG1 VAL 300 102.629 47.848 41.951 1.00 37.16

2774 CG2 VAL 300 104.522 48.970 40.762 1.00 29.01

2775 H VAL 300 106.459 48.994 42.572 1.00 25.00

2776 N ASP 301 104.866 47.162 44.865 1.00 39.28

2777 CA ASP 301 104.585 46.327 46.030 1.00 39.76

2778 C ASP 301 104.477 47.200 47.281 1.00 43.93

2779 0 ASP 301 103.588 47.002 48.113 1.00 43.98

2780 CB ASP 301 105.684 45.270 46.205 1.00 41.93

2781 CG ASP 301 105.401 44.299 47.348 1.00 47.18

2782 OD1 ASP 301 104.219 44.006 47.633 1.00 52.50

2783 OD2 ASP 301 106.375 43.817 47.959 1.00 53.58

2784 H ASP 301 105.672 46.984 44.338 1.00 25.00

2785 N ASP 302 105.373 48.175 47.401 1.00 48.10

2786 CA ASP 302 105.371 49.088 48.541 1.00 51.62

2787 C ASP 302 104.090 49.918 48.560 1.00 50.46

2788 0 ASP 302 103.480 50.114 49.615 1.00 51.17

2789 CB ASP 302 106.587 50.017 48.487 1.00 55.75

2790 CG ASP 302 107.904 49.271 48.619 1.00 62.15

2791 OD1 ASP 302 107.922 48.165 49.207 1.00 63.08

2792 OD2 ASP 302 108.928 49.798 48.133 1.00 68.25

2793 H ASP 302 106.056 48.281 46.704 1.00 25.00

2794 N THR 303 103.684 50.388 47.383 1.00 50.52

2795 CA THR 303 102.479 51.192 47.230 1.00 50.05

2796 C THR 303 101.260 50.472 47.808 1.00 51.84

2797 0 THR 303 100.563 51.013 48.668 1.00 56.07

2798 CB THR 303 102.222 51.512 45.745 1.00 50.09

2799 OG1 THR 303 103.377 52.153 45.190 1.00 45.79 2800 CG2 THR 303 101.015 52.425 45.593 1.0050.31

2801 H THR 303 104.219 50.190 46.581 1.0025.00

2802 HG1 THR 303 103.480 52.938 45.719 1.0025.00

2803 N PHE 304 101.025 49.246 47.352 1.0050.29

2804 CA PHE 304 99.893 48.450 47.817 1.0053.29

2805 C PHE 304 99.997 48.024 49.275 1.0059.68

2806 O PHE 304 98.981 47.832 49.940 1.0062.17

2807 CB PHE 304 99.744 47.182 46.971 1.0043.62

2808 CG PHE 304 99.065 47.398 45.654 1.0037.53

2809 CD1 PHE 304 99.780 47.857 44.555 1.0032.17

2810 CD2 PHE 304 97.711 47.113 45.506 1.0035.92

2811 CE1 PHE 304 99.156 48.029 43.326 1.0036.26

2812 CE2 PHE 304 97.079 47.280 44.283 1.0029.26

2813 CZ PHE 304 97.802 47.739 43.189 1.0034.73

2814 H PHE 304 101.636 48.860 46.683 1.0025.00

2815 N ASP 305 101.223 47.873 49.765 1.0069.36

2816 CA ASP 305 101.450 47.405 51.129 1.0078.46

2817 C ASP 305 101.326 48.406 52.279 1.0080.92

2818 O ASP 305 100.774 48.064 53.329 1.0079.13

2819 CB ASP 305 102.798 46.675 51.210 1.0084.84

2820 CG ASP 305 102.851 45.663 52.345 1.0090.63

2821 OD1 ASP 305 102.142 44.635 52.265 1.0090.70

2822 OD2 ASP 305 103.610 45.891 53.312 1.0092.23

2823 H ASP 305 101.996 48.072 49.197 1.0025.00

2824 N ALA 306 101.818 49.631 52.104 1.0084.70

2825 CA ALA 306 101.752 50.595 53.201 1.0089.65

2826 C ALA 306 101.457 52.057 52.874 1.0091.11

2827 O ALA 306 101.606 52.916 53.745 1.0093.41

2828 CB ALA 306 103.027 50.500 54.040 1.0089.50

2829 H ALA 306 102.229 49.879 51.249 1.0025.00

2830 N TYR 307 101.022 52.359 51.655 1.0090.94

2831 CA TYR 307 100.743 53.752 51.329 1.0092.48

2832 C TYR 307 99.374 54.011 50.701 1.0090.37

2833 O TYR 307 98.599 54.824 51.207 1.0091.55

2834 CB TYR 307 101.858 54.336 50.453 1.0098.27

2835 CG TYR 307 102.031 55.837 50.609 1.00106.75

2836 CD1 TYR 307 101.301 56.732 49.825 1.00109.71

2837 CD2 TYR 307 102.918 56.364 51.552 1.00107.24

2838 CE1 TYR 307 101.447 58.113 49.973 1.00107.24

2839 CE2 TYR 307 103.072 57.744 51.708 1.00106.57

2840 CZ TYR 307 102.332 58.611 50.915 1.00106.75

2841 OH TYR 307 102.477 59.971 51.060 1.00103.97

2842 H TYR 307 100.876 51.657 50.988 1.0025.00

2843 HH TYR 307 101.900 60.427 50.443 1.0025.00

2844 N GLY 308 99.079 53.325 49.603 1.0085.79

2845 CA GLY 308 97.808 53.522 48.930 1.0082.54

2846 C GLY 308 96.583 53.120 49.730 1.0081.67

2847 O GLY 308 96.589 52.105 50.428 1.0080.43

2848 H GLY 308 99.710 52.666 49.258 1.0025.00

2849 N THR 309 95.531 53.928 49.637 1.0082.42

2850 CA THR 309 94.282 53.649 50.338 1.0082.64

2851 C THR 309 93.397 52.796 49.433 1.0083.27 2852 0 THR 309 93.592 52.771 48.215 1.00 87.28

2853 CB THR 309 93.519 54.946 50.696 1.00 80.48

2854 OG1 THR 309 93.166 55.648 49.495 1.00 74.90

2855 CG2 THR 309 94.371 55.844 51.583 1.00 75.37

2856 H THR 309 95.600 54.729 49.085 1.00 25.00

2857 HG1 THR 309 92.598 55.106 48.954 1.00 25.00

2858 N VAL 310 92.383 52.172 50.025 1.00 80.18

2859 CA VAL 310 91.447 51.304 49.309 1.00 75.06

2860 C VAL 310 91.067 51.822 47.919 1.00 74.05

2861 0 VAL 310 91.209 51.115 46.921 1.00 73.13

2862 CB VAL 310 90.149 51.103 50.127 1.00 79.21

2863 CG1 VAL 310 89.284 50.020 49.494 1.00 80.28

2864 CG2 VAL 310 90.478 50.760 51.575 1.00 78.07

2865 H VAL 310 92.275 52.293 50.987 1.00 25.00

2866 N LYS 311 90.622 53.072 47.859 1.00 73.34

2867 CA LYS 311 90.210 53.682 46.600 1.00 71.58

2868 C LYS 311 91.366 53.946 45.639 1.00 67.72

2869 0 LYS 311 91.269 53.642 44.448 1.00 65.13

2870 CB LYS 311 89.433 54.977 46.866 1.00 79.85

2871 CG LYS 311 87.977 54.774 47.306 1.00 89.57

2872 CD LYS 311 87.842 53.976 48.607 1.00 98.38

2873 CE LYS 311 88.473 54.694 49.795 1.00102.39

2874 NZ LYS 311 87.808 55.997 50.082 1.00107.12

2875 H LYS 311 90.572 53.594 48.679 1.00 25.00

2876 1HZ LYS 311 87.884 56.617 49.250 1.00 25.00

2877 2HZ LYS 311 86.804 55.833 50.299 1.00 25.00

2878 3HZ LYS 311 88.268 56.452 50.896 1.00 25.00

2879 N GLU 312 92.461 54.495 46.162 1.00 64.41

2880 CA GLU 312 93.634 54.805 45.346 1.00 61.39

2881 C GLU 312 94.189 53.556 44.667 1.00 61.26

2882 0 GLU 312 94.533 53.585 43.483 1.00 59.48

2883 CB GLU 312 94.724 55.465 46.194 1.00 63.39

2884 CG GLU 312 94.348 56.830 46.748 1.00 70.79

2885 CD GLU 312 95.456 57.456 47.578 1.00 75.21

2886 0E1 GLU 312 95.879 56.840 48.579 1.00 77.19

2887 0E2 GLU 312 95.903 58.570 47.233 1.00 79.86

2888 H GLU 312 92.482 54.687 47.112 1.00 25.00

2889 N LEU 313 94.257 52.459 45.418 1.00 57.55

2890 CA LEU 313 94.765 51.198 44.891 1.00 52.69

2891 C LEU 313 93.885 50.678 43.762 1.00 52.82

2892 0 LEU 313 94.391 50.281 42.713 1.00 51.15

2893 CB LEU 313 94.883 50.158 46.005 1.00 48.63

2894 CG LEU 313 95.886 50.519 47.102 1.00 46.47

2895 CD1 LEU 313 95.941 49.416 48.140 1.00 48.38

2896 CD2 LEU 313 97.259 50.748 46.495 1.00 48.00

2897 H LEU 313 93.952 52.495 46.346 1.00 25.00

2898 N GLU 314 92.569 50.724 43.957 1.00 52.92

2899 CA GLU 314 91.634 50.269 42.933 1.00 54.92

2900 C GLU 314 91.840 51.087 41.651 1.00 52.05

2901 0 GLU 314 91.801 50.548 40.541 1.00 49.73

2902 CB GLU 314 90.189 50.400 43.431 1.00 58.82

2903 CG GLU 314 89.137 49.809 42.488 1.00 68.28 2904 CD GLU 314 89.281 48.303 42.292 1.00 74.40

2905 0E1 GLU 314 89.097 47.550 43.275 1.00 76.74

2906 0E2 GLU 314 89.568 47.871 41.152 1.00 74.09

2907 H GLU 314 92.221 51.057 44.810 1.00 25.00

2908 N ALA 315 92.088 52.383 41.813 1.00 51.92

2909 CA ALA 315 92.323 53.270 40.678 1.00 54.57

2910 C ALA 315 93.649 52.920 39.993 1.00 51.51

291 1 0 ALA 315 93.762 52.977 38.763 1.00 49.98

2912 CB ALA 315 92.335 54.722 41.142 1.00 52.19

2913 H ALA 315 92.103 52.753 42.723 1.00 25.00

2914 N TYR 316 94.640 52.542 40.796 1.00 49.90

2915 CA TYR 316 95.960 52.177 40.289 1.00 46.00

2916 C TYR 316 95.911 50.864 39.506 1.00 42.05

2917 0 TYR 316 96.503 50.756 38.424 1.00 36.96

2918 CB TYR 316 96.954 52.070 41.445 1.00 48.32

2919 CG TYR 316 98.405 52.154 41.029 1.00 52.17

2920 CD1 TYR 316 98.975 53.371 40.657 1.00 53.66

2921 CD2 TYR 316 99.218 51.023 41.033 1.00 58.41

2922 CE1 TYR 316 100.320 53.461 40.303 1.00 56.28

2923 CE2 TYR 316 100.566 51.101 40.681 1.00 63.22

2924 CZ TYR 316 101.110 52.323 40.319 1.00 58.59

2925 OH TYR 316 102.442 52.405 39.986 1.00 51.77

2926 H TYR 316 94.483 52.514 41.763 1.00 25.00

2927 HH TYR 316 102.631 53.311 39.758 1.00 25.00

2928 N THR 317 95.186 49.881 40.040 1.00 38.98

2929 CA THR 317 95.044 48.574 39.396 1.00 40.08

2930 C THR 317 94.391 48.732 38.025 1.00 41.19

2931 0 THR 317 94.755 48.046 37.065 1.00 40.64

2932 CB THR 317 94.189 47.619 40.245 1.00 39.21

2933 OG1 THR 317 94.658 47.632 41.598 1.00 40.99

2934 CG2 THR 317 94.277 46.198 39.698 1.00 41.75

2935 H THR 317 94.740 50.022 40.900 1.00 25.00

2936 HG1 THR 317 94.120 47.056 42.134 1.00 25.00

2937 N ASP 318 93.423 49.641 37.945 1.00 46.22

2938 CA ASP 318 92.719 49.920 36.700 1.00 44.99

2939 C ASP 318 93.631 50.595 35.693 1.00 38.74

2940 0 ASP 318 93.695 50.183 34.536 1.00 39.12

2941 CB ASP 318 91.497 50.799 36.959 1.00 55.80

2942 CG ASP 318 90.215 50.006 36.977 1.00 64.67

2943 OD1 ASP 318 89.924 49.364 38.010 1.00 73.33

2944 OD2 ASP 318 89.507 50.014 35.948 1.00 72.06

2945 H ASP 318 93.171 50.138 38.755 1.00 25.00

2946 N ALA 319 94.340 51.628 36.135 1.00 37.74

2947 CA ALA 319 95.258 52.347 35.260 1.00 40.21

2948 C ALA 319 96.245 51.360 34.644 1.00 42.98

2949 0 ALA 319 96.528 51.422 33.446 1.00 41.24

2950 CB ALA 319 95.995 53.426 36.039 1.00 42.19

2951 H ALA 319 94.240 51.923 37.067 1.00 25.00

2952 N ILE 320 96.727 50.423 35.462 1.00 41.94

2953 CA ILE 320 97.670 49.403 35.005 1.00 40.80

2954 C ILE 320 97.064 48.488 33.934 1.00 37.20

2955 0 ILE 320 97.711 48.200 32.923 1.00 31.26 4.

O

ω ωwC ωωωc MM r NWMMW MM r-MMMMNMMMNMM MrOr MMM M 00000000 _ tO (0 (0(0 (0(0(OCD(0 (0(0 (0 (0(0(0(0(0(0(0(0(0 (0 (0 (0 (0(0(0 (0(0 (0 (0 (0(0 (0(0 (0 (OCD (0(0 (0 (0 (0 oooooooo(D (θ(θ(D(o p(θ(θcθ(θooexicβooepe)oooe)oeo vi vi v| v4 vi v4 v| vi vi vienen (nencncnen cncno cΛ eΛ e^ vi en cΛ 4k co ro o o(θ oovi cnen -&c ro o o (o evi cneΛ ^ e to ooo (oex) vi cn cΛ 4k eoιo o o co c vi co e 4 co w o o>z mxxooooozoooooooz_oo_o^xιzzozoooooozro_i z o CD

UiU)7)7373737373737373737373737373737373737373737)7)7)7)73737373737373r-t-r-rr-r-r-r-r- m m m m m TJTJTJTJTJTJTJTJTJTJTJTJT TJTJTJTJTJOOOOOOOOOOOOOOOOOZZZZZZZZZZZZ

co coco co co cocococo coco coco coco co coco co cococococo cocococo cococo co co cococo co co co co coco co co co co co co co co co co

MMNI NMMMMMIO MM MMMIO MMf.MM MNMM M

4 k 4 -k co co co eo eoeoeo co eo coeo coeo coco co ro roMro M roroM ro .o o wro M io ro ro o _ _ _ _ _ _ _ _ _ _ _ o o o o o to to o o o o o o o co co co co i (0o (i0oi(0oΦ(0 (i0oi(0o(l0o0 (0 (0(0 v| vl CO So io _ coo o ro ro o -- o_ o-o o -o o _o d -.o- eo e en - -k e '-n (-n c o oo co oo - in in b bo ro to 4k bo io to S to o o e o o bo bo o co o o ro CΛ Sen cn oo 4k v| vi Jj cOJCe CcpO vi — o en. c -n. c -o . 4k vl tO CO o 4k ro cn to co o viroenro 0 -)0 -00 - 0)

tO Oθ 4k - CO vlOvlOCO COOO

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo cnCΛ rθM 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4kCΛ CΛ 4krθMrθM lθ θ vlvi vivlOT OCΛ CΛ 4k 4k 4kM ro rθ 4k 01 en(oeΛeΛro cn o ω ιo o ro o p _ o p eΛppen cΛp eoop roωro p p ppeΛ p _ to ro o cn co 4k ω vieΛ CΛ θ c iniιi bbbb σ) bώb b ro i)ivj bbbb b b '-K)b)bώcιi vj roM (ooιo o (θ θ 4k θooi vi o vi 4_ enoM coe oo ooo oo viroeocn vicn 4k 4k cn coo o o ιo cn ro co cD CD θ cooo 4k co eo ro

4.

c >oc>oc>o>co>crt>coFmFrnrFnFrnFrnFrnFmFrnFm^^ r-Or-Or-r- OO>>>>>>>>>>>FFFFFFFFF>> >> >

TJ TJTJTJ TJ TJ C CC CCCCC CCZ ZZ ZZ Z Z Z Z ZZ TJ TJ TJ TJ TJ TJ TJ

ωω ωωωωωc ω ωc ωωωc c c c ωωωωcoc ω ω ω ww c ωco ω c c ω ωω ωωωωω ω ω ωωω ω w - ω ro ro r rO M I tO torO M M M M MMtorororOMMMI MMM MI MMM M rO MMM W

(D(0(0 _ (0 (o eoo oooo oo co e)o „ c)oe)o v| v|vi v4 vivi v| v| v|vicn enenenencn cn cn (n cnen enen (0(0(0 (0(0 (0 (0(0 (0(0(0 (0 co " vi vi oo oo -vi 4kptn p p p vi to vib 4k co 4k vi b ι 4 eΛ O co cnro ro coeo o oi cD oo

rovito oi oi ro oo to to cn o o

eo coeo eo co eo cocoeo co eo co eo co eo eo co co co eo coeoeo co eoM M ro M M co M M eo ro M ω }k vi c cn 4- ro 4kC cn 4 c cn 4 ω o o ro o __ ω - M o vi ._. p vi _ r roo 44kk 44kk icno cenn toeo toeo vviitocoteoo rroo coo toen to(θcθo c cΛn ccnn tocn ccoDbo rroo —o totoooccnn cinntoco icoorroo r (OOO O CO OO vl 04k 4k ιocooo vlcocncΛcoo _ncocΛCΛ'~• -, eococncoe c enneeoocennt(ooocnoooo-kc(oθitoo c_o_ oc_ιc_ouc_nπo_- c_ou o-- cunjcunj vvi( r.i m Jk rn ro κι rn _k I en oι eo v| o _ co cooo co en -vi vi o co to oo Jk o oo ro oc —o o —o -o —ent -n- co rovi co ro ro co σo vi ro cn vi oo oo o ro cn

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo oo oo oo oo oo

(O∞ vivi vi vi M CΛCΛ cnoi cn vicncnro ocn enen cno cn en viM roM cnen σo oo vi vi cn cn M o en cn cn eΛ cn OT vi vi vi vi c cn oeΛ (θ(θ oeΛ ϋi ooc cne (θ oe 4k en cnto _ ( (θθov| oocΛ eΛeΛ vi eeo vi cn o oo4k eΛ eΛ e cn c3 vi roto oι vl vl 4k p ∞ 4k toco vi 4k oo cn o eno oro cn 4kcooo oooo en ρ vito cn (0(00oo o_k o oi to co roen o en en co ro co to tocn o bo to vi io o en coo oo o 4k oo oo o vico oeo en 4_ Ovl O v|OO o _ roeooo roooo oo o oo 4k θovi o oco o o o o oo ro cn ιo co o co ro cn cn cn o

o

ωωω ωwωc ωωωωω ω c ωc ωω ωωωuωωc ω ω ωωcowωω ω ω ω ωωω ω ωωωω - ωωωω ω - -

-v o _k _k _-, _k _k __ _-. _k _k __0000000000000000000000000000000000000000

- -k o o o o o o o o o o(0 (0 (0 (0(0 (p o (0 (0(o co cca co ee eoooc c vi vi vi vi vi vi v| vi vi vi cn cn cn cncn cn o) oo oo o o co e vi ene 5c too o(θ oovicoi 4k e to o o co c> vi en cn 4kCotoo θ (o ea vi c e 4k Cθ M o o (D ∞

OOOOOO XOOOOOOOZ OO O Z X OOOOOO Z ro o ?. =- I Z Z Z O O O O O OOCD > O O O CD > σ o cD > O O O CD > x x x x rn x i Nm o ocπ > o o to o X X X X ro o O O ro o

-j -H H H H -H H>> > > > > > > > TJ TJ TJ TJ TJ TJ T r~ JZ ^ I- Γ- Γ- r- r- > > > > > > > > > > > > > > > > > > > < ωωcnUi(n(n(Λ(n n7 73737 737373r}i™™™ i™

Λ J J π Λ 73 Λ TJTJ TJ TJ TJTJ TJTJ T O OOOOOOC C CCC C θ Q rτ) OQ O Q O θ Q OO TJ TJ

ωwco ω w w ωωωωωωω ωωc w ω c c-iωωco w ωc uωωc ωw ω ωωωω ω ω ω ω ωω ω ωω ωωω ω w ω ωωc ( ωωc ωωωωωωωωωωωωωc ωωcoωωωωωωωωωωωωuωωωωωωωωωωωωroroιo , SJK JS 5uω_uωωωuco MM r i ι ι ι --j - -- -^ -' θo oooo oo oooo ooooo(D(θ (θ ooo o o ro 0 (0 0 _ 000 (0 (0 tp o(θ φ θ (θ (θ (θ to o o ro to ro ro o co oro O 00 CΛ _ _pα )φijι j

P01004k 4k01 4k(0 vl 4k co cp co tobo 4 to4 ototo vl

4k coen ecnΛ eCnΛ oCDo 4k θ ~θ o o- ω ro o oeo en oo ro eooo(o co co *. t -o o —i o -o

*ro vi θo ro4k o oro oi o cn enen ro cp cnoioi oi oi oi cncn cn cn cn cncn cncncn cn cn cncn cn cn cn cn cn cn cn cn tn tn oi oi oi co cn oo oo eo ooeo co ceooro en e o vip i i vi co co co co o o ro co k toιH enι .nkιo αinrn _απmisi

CO v| vl -k CO vl o rO vi lo CO vl cO p o -k n C O CO en O vi ro tO OO ro 4k

4k(o o k oo otneooo -vi o S cn vi o ro o o to o 4k vi co _

4k 4- 4k 4k 4k 4k 4k 44-k 4k 4k 4 4k co eo eo co co coeo eo eo eo co co

(3) enc ι ι ω eo Mro o ro M eo4k en en -vi tooo -vicn 4k ioco cocDco4ktooρcnoocororoco ι o toioώtov4vitob4k ooι 4k o cocn roenp ∞ (θ (o eo o ρ o ro cDθo vi co ro coo e N) o _k oo o vio) S e e o

ro o 4k CΛ vi oo o _π o cn o co

oooooooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo cn cn cn cn cn cn cn roeo co oo vi cn cnvi tooocn t o to tΛoι o c co o i vΛi e4nk vi b io eΛ b"vi ioin i Sienn 44kk icoo oo rovi -

3112 CD2 TYR 334 101.690 57.289 45.929 1.00 68.64

3113 CE1 TYR 334 99.326 58.432 46.824 1.00 69.54

3114 CE2 TYR 334 100.682 56.482 46.446 1.00 69.64

3115 CZ TYR 334 99.504 57.058 46.892 1.00 70.47

3116 OH TYR 334 98.515 56.257 47.413 1.00 68.60

3117 H TYR 334 100.910 61.170 44.337 1.00 25.00

3118 HH TYR 334 97.786 56.812 47.691 1.00 25.00

3119 N MET 335 101.220 58.311 42.691 1.00 51.84

3120 CA MET 335 100.977 57.174 41.809 1.00 46.91

3121 C MET 335 101.236 57.558 40.356 1.00 46.00

3122 0 MET 335 101.540 56.701 39.525 1.00 49.65

3123 CB MET 335 99.552 56.646 41.969 1.00 41.83

3124 CG MET 335 99.268 56.054 43.333 1.00 37.39

3125 SD MET 335 97.625 55.322 43.450 1.00 44.89

3126 CE MET 335 97.914 54.042 44.666 1.00 45.77

3127 H MET 335 100.460 58.772 43.094 1.00 25.00

3128 N LYS 336 101.122 58.848 40.052 1.00 47.61

3129 CA LYS 336 101.366 59.340 38.699 1.00 48.27

3130 C LYS 336 102.836 59.143 38.325 1.00 46.89

3131 0 LYS 336 103.161 58.829 37.177 1.00 49.33

3132 CB LYS 336 101.000 60.824 38.588 1.00 51.58

3133 CG LYS 336 99.517 61.132 38.743 1.00 54.94

3134 CD LYS 336 99.233 62.600 38.446 1.00 60.67

3135 CE LYS 336 97.739 62.882 38.431 1.00 63.81

3136 NZ LYS 336 97.404 64.287 38.083 1.00 68.16

3137 H LYS 336 100.869 59.485 40.750 1.00 25.00

3138 1HZ LYS 336 97.836 64.931 38.776 1.00 25.00

3139 2HZ LYS 336 97.770 64.503 37.134 1.00 25.00

3140 3HZ LYS 336 96.371 64.409 38.092 1.00 25.00

3141 N ILE 337 103.719 59.321 39.303 1.00 44.56

3142 CA ILE 337 105.154 59.162 39.089 1.00 47.99

3143 C ILE 337 105.469 57.701 38.782 1.00 50.21

3144 0 ILE 3337 106.153 57.400 37.800 1.00 52.97

3145 CB ILE 337 105.957 59.595 40.336 1.00 51.57

3146 CG1 ILE 337 105.533 61.001 40.770 1.00 54.20

3147 CG2 ILE 337 107.455 59.569 40.034 1.00 49.66

3148 CD1 ILE 337 106.048 61.406 42.131 1.00 53.35

3149 H ILE 337 103.390 59.566 40.195 1.00 25.00

3150 N SER 338 104.951 56.802 39.618 1.00 46.40

3151 CA SER 338 105.161 55.364 39.458 1.00 41.92

3152 C SER 338 104.640 54.905 38.098 1.00 39.82

3153 0 SER 338 105.385 54.347 37.286 1.00 36.78

3154 CB SER 338 104.423 54.598 40.560 1.00 37.35

3155 OG SER 338 104.502 55.268 41.805 1.00 52.45

3156 H SER 338 104.411 57.109 40.381 1.00 25.00

3157 HG SER 338 105.419 55.324 42.084 1.00 25.00

3158 N TYR 339 103.363 55.183 37.848 1.00 39.53

3159 CA TYR 339 102.697 54.804 36.606 1.00 40.68

3160 C TYR 339 103.468 55.247 35.362 1.00 39.79

3161 0 TYR 339 103.719 54.444 34.458 1.00 39.78

3162 CB TYR 339 101.272 55.374 36.586 1.00 39.96

3163 CG TYR 339 100.388 54.833 35.480 1.00 44.71 3164 CD1 TYR 339 99.948 53.507 35.494 1.00 40.18

3165 CD2 TYR 339 99.992 55.646 34.416 1.00 42.64

3166 CE1 TYR 339 99.136 53.004 34.475 1.00 40.02

3167 CE2 TYR 339 99.180 55.151 33.393 1.00 46.52

3168 CZ TYR 339 98.758 53.830 33.431 1.00 40.74

3169 OH TYR 339 97.968 53.3422 32.417 1.00 44.28

3170 H TYR 339 102.843 55.668 38.522 1.00 25.00

3171 HH TYR 339 97.819 54.042 31.792 1.00 25.00

3172 N LYS 340 103.864 56.515 35.324 1.00 42.19

3173 CA LYS 340 104.599 57.032 34.179 1.00 42.37

3174 C LYS 340 105.930 56.306 33.992 1.00 40.71

3175 0 LYS 340 106.264 55.885 32.882 1.00 41.93

3176 CB LYS 340 104.826 58.541 34.306 1.00 48.48

3177 CG LYS 340 105.461 59.136 33.063 1.00 61.36

3178 CD LYS 340 105.412 60.647 33.041 1.00 76.14

3179 CE LYS 340 105.947 61.164 31.713 1.00 85.02

3180 NZ LYS 340 105.783 62.636 31.566 1.00 94.84

3181 H LYS 340 103.661 57.115 36.074 1.00 25.00

3182 1 HZ LYS 340 104.774 62.881 31.624 1.00 25.00

3183 2HZ LYS 340 106.302 63.119 32.327 1.00 25.00

3184 3HZ LYS 340 106.160 62.937 30.645 1.00 25.00

3185 N ALA 341 106.668 56.134 35.084 1.00 40.84

3186 CA ALA 341 107.963 55.455 35.052 1.00 36.82

3187 C ALA 341 107.837 54.053 34.469 1.00 35.10

3188 0 ALA 341 108.657 53.635 33.650 1.00 34.92

3189 CB ALA 341 108.548 55.388 36.451 1.00 37.09

3190 H ALA 341 106.336 56.478 35.942 1.00 25.00

3191 N ILE 342 106.796 53.338 34.884 1.00 32.81

3192 CA ILE 342 106.547 51.983 34.409 1.00 31.78

3193 C ILE 342 106.357 51.982 32.891 1.00 38.13

3194 0 ILE 342 107.061 51.269 32.163 1.00 37.84

3195 CB ILE 342 105.306 51.377 35.109 1.00 27.44

3196 CG1 ILE 342 105.585 51.219 36.606 1.00 30.45

3197 CG2 ILE 342 104.943 50.031 34.499 1.00 29.34

3198 CD1 ILE 342 104.399 50.759 37.420 1.00 30.40

3199 H ILE 342 106.179 53.740 35.532 1.00 25.00

3200 N LEU 343 105.447 52.827 32.414 1.00 44.76

3201 CA LEU 343 105.168 52.920 30.984 1.00 42.79

3202 C LEU 343 106.428 53.290 30.214 1.00 40.23

3203 0 LEU 343 106.706 52.724 29.153 1.00 39.11

3204 CB LEU 343 104.061 53.943 30.715 1.00 42.96

3205 CG LEU 343 102.731 53.704 31.436 1.00 46.89

3206 CD1 LEU 343 101.704 54.723 30.978 1.00 51.34

3207 CD2 LEU 343 102.233 52.302 31.166 1.00 44.17

3208 H LEU 343 104.954 53.403 33.039 1.00 25.00

3209 N ASP 344 107.202 54.218 30.770 1.00 40.93

3210 CA ASP 344 108.442 54.660 30.144 1.00 43.89

3211 C ASP 344 109.443 53.515 30.053 1.00 43.08

3212 0 ASP 344 110.049 53.299 29.001 1.00 38.31

3213 CB ASP 344 109.056 55.831 30.921 1.00 50.27

3214 CG ASP 344 108.259 57.124 30.775 1.00 58.66

3215 OD1 ASP 344 107.376 57.206 29.891 1.00 59.02 3216 OD2 ASP 344 108.525 58.070 31.549 1.00 62.70

3217 H ASP 344 106.928 54.612 31.623 1.00 25.00

3218 N LEU 345 109.585 52.764 31.144 1.00 40.54

3219 CA LEU 345 1 10.511 51.633 31.196 1.00 36.66 3220 C LEU 345 1 10.256 50.661 30.048 1.00 36.17

3221 0 LEU 345 111.188 50.256 29.343 1.00 35.58

3222 CB LEU 345 1 10.393 50.903 32.540 1.00 38.27

3223 CG LEU 345 1 11.284 49.672 32.755 1.00 35.02

3224 CD1 LEU 345 1 12.750 50.043 32.587 1.00 28.76 3225 CD2 LEU 345 111.030 49.087 34.132 1.00 30.95

3226 H LEU 345 109.050 52.975 31.934 1.00 25.00

3227 N TYR 346 108.992 50.304 29.844 1.00 35.43

3228 CA TYR 346 108.650 49.389 28.768 1.00 32.38

3229 C TYR 346 108.906 49.969 27.388 1.00 34.86 3230 0 TYR 346 109.183 49.228 26.446 1.00 36.74

3231 CB TYR 346 107.227 48.870 28.927 1.00 33.82

3232 CG TYR 346 107.173 47.798 29.980 1.00 31.79

3233 CD1 TYR 346 107.531 46.487 29.675 1.00 34.43

3234 CD2 TYR 346 106.856 48.107 31.302 1.00 34.30 3235 CE1 TYR 346 107.585 45.507 30.659 1.00 32.57

3236 CE2 TYR 346 106.906 47.137 32.296 1.00 34.14

3237 CZ TYR 346 107.275 45.839 31.965 1.00 34.31

3238 OH TYR 346 107.351 44.878 32.938 1.00 32.03

3239 H TYR 346 108.288 50.665 30.428 1.00 25.00 3240 HH TYR 346 107.610 44.036 32.562 1.00 25.00

3241 N LYS 347 108.861 51.295 27.276 1.00 44.24

3242 CA LYS 347 109.143 51.955 26.004 1.00 44.41

3243 C LYS 347 110.630 51.792 25.716 1.00 43.81

3244 0 LYS 347 111.030 51.558 24.572 1.00 42.39 3245 CB LYS 347 108.762 53.437 26.060 1.00 51.50

3246 CG LYS 347 107.268 53.672 25.945 1.00 55.25

3247 CD LYS 347 106.759 53.062 24.650 1.00 59.99

3248 CE LYS 347 105.251 52.978 24.608 1.00 60.17

3249 NZ LYS 347 104.841 52.152 23.446 1.00 53.42 3250 H LYS 347 108.627 51.840 28.057 1.00 25.00

3251 1HZ LYS 347 105.241 51.196 23.537 1.00 25.00

3252 2HZ LYS 347 103.803 52.090 23.409 1.00 25.00

3253 3HZ LYS 347 105.190 52.590 22.569 1.00 25.00

3254 N ASP 348 111.439 51.874 26.771 1.00 45.04 3255 CA ASP 348 112.884 51.712 26.654 1.00 47.19

3256 C ASP 348 113.178 50.289 26.211 1.00 44.53

3257 0 ASP 348 113.992 50.074 25.316 1.00 46.94

3258 CB ASP 348 113.582 51.981 27.991 1.00 55.77

3259 CG ASP 348 113.469 53.430 28.441 1.00 63.79 3260 OD1 ASP 348 113.017 54.288 27.648 1.00 66.77

3261 OD2 ASP 348 113.846 53.710 29.600 1.00 65.20

3262 H ASP 348 111.048 52.057 27.652 1.00 25.00

3263 N TYR 349 112.507 49.321 26.835 1.00 39.87

3264 CA TYR 349 112.692 47.913 26.491 1.00 40.93 3265 C TYR 349 112.412 47.704 25.008 1.00 41.26

3266 0 TYR 349 113.189 47.051 24.302 1.00 40.44

3267 CB TYR 349 111.752 47.015 27.310 1.00 35.88 3268 CG TYR 349 112.115 46.841 28.773 1.0033.98

3269 CD1 TYR 349 113.396 47.144 29.250 1.0029.99

3270 CD2 TYR 349 111.172 46.360 29.680 1.0027.01

3271 CE1 TYR 349 113.723 46.971 30.596 1.0027.43

3272 CE2 TYR 349 111.485 46.182 31.021 1.0032.24

3273 CZ TYR 349 112.759 46.491 31.476 1.0034.71

3274 OH TYR 349 113.045 46.346 32.813 1.0031.76

3275 H TYR 349 111.880 49.567 27.549 1.0025.00

3276 HH TYR 349 112.295 45.961 33.270 1.0025.00

3277 N GLU 350 111.302 48.269 24.541 1.0044.18

3278 CA GLU 350 110.911 48.156 23.140 1.0047.18

3279 C GLU 350 111.972 48.767 22.235 1.0045.46

3280 0 GLU 350 112.337 48.175 21.221 1.0045.14

3281 CB GLU 350 109.557 48.828 22.903 1.0048.54

3282 CG GLU 350 108.396 48.141 23.609 1.0052.79

3283 CD GLLU 350 107.076 48.883 23.473 1.0059.87

3284 0E1 GLU 350 107.070 50.040 23.000 1.0066.09

3285 OE2 GLU 350 106.037 48.304 23.852 1.0065.68

3286 H GLU 350 110.728 48.772 25.158 1.0025.00

3287 N LYS 351 112.497 49.923 22.636 1.0048.01

3288 CA LYS 351 113.530 50.618 21.871 1.0051.81

3289 C LYS 351 114.794 49.756 21.788 1.0052.11

3290 0 LYS 351 115.311 49.505 20.696 1.0048.04

3291 CB LYS 351 113.861 51.973 22.518 1.0053.86

3292 CG LYS 351 114.151 53.095 21.520 1.0060.98

3293 CD LYS 351 115.235 52.708 20.517 1.0068.26

3294 CE LYS 351 115.153 53.551 19.253 1.0075.67

3295 NZ LYS 351 115.951 52.975 18.132 1.0074.32

3296 H LYS 351 112.180 50.322 23.471 1.0025.00

3297 1HZ LYS 351 116.950 52.914 18.410 1.0025.00

3298 2HZ LYS 351 115.590 52.025 17.907 1.0025.00

3299 3HZ LYS 351 115.855 53.584 17.293 1.0025.00

3300 N GLU 352 115.275 49.297 22.944 1.0056.12

3301 CA GLU 352 116.474 48.461 23.031 1.0054.04

3302 C GLU 352 116.409 47.241 22.120 1.0052.28 3303 o GLU 352 117.410 46.851 21.514 1.0052.78

3304 CB G GLLUU 352 116.688 47.971 24.466 1.0058.92

3305 CG G GLLUU 352 117.135 49.023 25.460 1.0067.31

3306 CD G GLLUU 352 117.386 48.438 26.842 1.0071.98

3307 OE1 G GLLUU 352 118.383 47.694 27.004 1.0069.15

3308 OE2 GLU 352 116.582 48.718 27.760 1.0065.74

3309 H GLU 352 114.800 49.527 23.762 1.0025.00

3310 N L LEEUU 353 115.235 46.624 22.052 1.0049.88

3311 CA LLEEUU 353 115.053 45.435 21.233 1.0051.47

3312 C LLEEUU 353 114.701 45.732 19.772 1.0055.82

3313 0 LLEEUU 353 114.606 44.809 18.955 1.0056.53

3314 CB LEU 353 114.009 44.511 21.876 1.0044.77

3315 CG LEU 353 114.320 44.017 23.297 1.0040.31

3316 CD1 LEU 353 113.151 43.224 23.855 1.0035.62

3317 CD2 LEU 353 115.586 43.172 23.302 1.0033.71

3318 H LEU 353 114.478 46.975 22.571 1.0025.00

3319 N SER 354 114.538 47.012 19.437 1.0062.13 3320 CA SER 354 114.202 47.423 18.071 1.00 66.31

3322' I C SER 354 115.245 46.970 17.058 1.00 64.64

3322 0 SER 354 114.904 46.378 16.035 1.00 66.26

3323 CB SER 354 114.043 48.945 17.978 1.00 69.09

3324 OG SER 354 112.959 49.406 18.763 1.00 80.83

3325 H SER 354 114.623 47.710 20.121 1.00 25.00

3326 HG SER 354 112.888 50.360 18.684 1.00 25.00

3327 N SER 355 116.516 47.223 17.359 1.00 65.77

3328 CA SER 355 117.616 46.850 16.472 1.00 67.77

3329 C SER 355 117.631 45.364 16.110 1.00 68.81

3330 0 SER 355 118.082 44.990 15.028 1.00 69.36

3331 CB SER 355 118.956 47.245 17.099 1.00 66.08

3332 OG SER 355 119.067 46.741 18.419 1.00 68.44

3333 H SER 355 116.729 47.670 18.209 1.00 25.00

3334 HG SER 355 119.043 45.780 18.416 1.00 25.00

3335 N ALA 356 117.150 44.525 17.024 1.00 69.39

3336 CA ALA 356 117.115 43.082 16.802 1.00 68.66

3337 C ALA 356 115.741 42.585 16.347 1.00 69.25

3338 0 ALA 356 115.561 41.395 16.084 1.00 71.52

3339 CB ALA 356 117.549 42.347 18.067 1.00 64.46

3340 H ALA 356 116.806 44.884 17.867 1.00 25.00

3341 N GLY 357 114.773 43.493 16.270 1.00 67.77

3342 CA GLY 357 113.432 43.118 15.854 1.00 62.16

3343 C GLY 357 112.754 42.202 16.856 1.00 58.02

3344 0 GLY 357 111.969 41.327 16.481 1.00 58.07

3345 H GLY 357 114.965 44.428 16.477 1.00 25.00

3346 N ARG 358 113.039 42.416 18.138 1.00 53.28

3347 CA ARG 358 112.461 41.601 19.204 1.00 50.96

3348 C ARG 358 111.486 42.359 20.106 1.00 50.55

3349 0 ARG 358 110.885 41.774 20.999 1.00 51.85

3350 CB ARG 358 113.568 40.953 20.047 1.00 44.69

3351 CG ARG 358 114.360 39.872 19.314 1.00 43.66

3352 CD ARG 358 115.389 39.206 20.217 1.00 43.11

3353 NE ARG 358 114.768 38.503 21.338 1.00 42.40

3354 CZ ARG 358 114.997 38.783 22.618 1.00 43.84

3355 NH1 ARG 358 115.836 39.754 22.951 1.00 49.95

3356 NH2 ARG 358 114.389 38.089 23.571 1.00 45.03

3357 H ARG 358 113.664 43.136 18.368 1.00 25.00

3358 HE ARG 358 114.142 37.776 21.138 1.00 25.00

3359 1HH1 ARG 358 116.301 40.282 22.241 1.00 25.00

3360 2HH1 ARG 358 116.006 39.958 23.915 1.00 25.00

3361 1 HH2 ARG 358 113.755 37.355 23.327 1.00 25.00

3362 2HH2 ARG 358 114.562 38.301 24.533 1.00 25.00

3363 N SER 359 111.270 43.639 19.826 1.00 50.59

3364 CA SER 359 110.363 44.464 20.625 1.00 47.98

3365 C SER 359 108.948 43.888 20.767 1.00 48.46

3366 0 SER 359 108.247 44.177 21.737 1.00 46.16

3367 CB SER 359 110.315 45.879 20.050 1.00 51.38

3368 OG SER 359 110.450 45.839 18.639 1.00 63.31

3369 H SER 359 111.730 44.045 19.067 1.00 25.00

3370 HG SER 359 111.323 45.514 18.419 1.00 25.00

3371 N HIS 360 108.559 43.029 19.8829 1.00 46.52 3372 CA HIS 360 107.234 42.401 19.837 1.00 47.05

3373 C HIS 360 106.998 41.398 20.974 1.00 48.80

3374 0 HIS 360 105.893 40.871 21.124 1.00 46.79

3375 CB HIS 360 106.971 41.713 18.492 1.00 47.13

3376 CG HIS 360 108.026 40.724 18.100 1.00 47.23

3377 ND1 HIS 360 107.885 39.365 18.289 1.00 50.30

3378 CD2 HIS 360 109.242 40.899 17.532 1.00 49.82

3379 CE1 HIS 360 108.969 38.746 17.855 1.00 47.18

3380 NE2 HIS 360 109.808 39.655 17.391 1.00 46.40

3381 H HIS 360 109.183 42.837 19.111 1.00 25.00

3382 HD1 HIS 360 107.098 38.919 18.675 1.00 25.00

3383 HE2 HIS 360 110.702 39.494 16.992 1.00 25.00

3384 N ILE 361 108.042 41.098 21.741 1.00 47.17

3385 CA ILE 361 107.922 40.152 22.845 1.00 40.37

3386 C ILE 361 107.657 40.850 24.175 1.00 35.93

3387 0 ILE 361 107.118 40.240 25.103 1.00 41.86

3388 CB ILE 361 109.187 39.277 22.987 1.00 44.49

3389 CG1 ILE 361 110.392 40.152 23.346 1.00 39.20

3390 CG2 ILE 361 109.421 38.477 21.707 1.00 38.28

3391 CD1 ILE 361 111.680 39.405 23.464 1.00 49.02

3392 H ILE 361 108.913 41.517 21.574 1.00 25.00

3393 N VAL 362 108.007 42.131 24.256 1.00 29.83

3394 CA VAL 362 107.818 42.911 25.478 1.00 28.00

3395 C VAL 362 106.396 42.815 26.041 1.00 32.52

3396 0 VAL 362 106.209 42.788 27.262 1.00 34.43

3397 CB VAL 362 108.203 44.401 25.259 1.00 30.93

3398 CG1 VAL 362 107.851 45.233 26.484 1.00 28.70

3399 CG2 VAL 362 109.699 44.524 24.952 1.00 22.99

3400 H VAL 362 108.395 42.568 23.472 1.00 25.00

3401 N CYS 363 105.405 42.701 25.160 1.00 29.77

3402 CA CYS 363 104.011 42.610 25.592 1.00 31.29

3403 C CYS 363 103.757 41.470 26.581 1.00 29.63

3404 O CYS 363 102.942 41.610 27.499 1.00 25.93

3405 CB CYS 363 103.066 42.504 24.387 1.00 33.73

3406 SG CYS 363 103.387 41.126 23.270 1.00 40.61

3407 H CYS 363 105.612 42.677 24.204 1.00 25.00

3408 N HIS 364 104.480 40.362 26.421 1.00 26.78

3409 CA HIS 364 104.332 39.216 27.315 1.00 24.36

3410 C HIS 364 104.685 39.599 28.754 1.00 31.26

3411 0 HIS 364 104.029 39.163 29.703 1.00 32.48

3412 CB HIS 364 105.220 38.064 26.855 1.00 26.25

3413 CG HIS 364 104.826 37.486 25.531 1.00 29.86

3414 ND1 HIS 364 103.731 36.663 25.372 1.00 39.99

3415 CD2 HIS 364 105.398 37.588 24.308 1.00 32.37

3416 CE1 HIS 364 103.646 36.282 24.110 1.00 36.28

3417 NE2 HIS 364 104.646 36.829 23.444 1.00 32.87

3418 H HIS 364 105.139 40.332 25.695 1.00 25.00

3419 HD1 HIS 364 103.113 36.392 26.086 1.00 25.00

3420 HE2 HIS 364 104.819 36.718 22.488 1.00 25.00

3421 N ALA 365 105.711 40.431 28.911 1.00 28.85

3422 CA ALA 365 106.134 40.880 30.232 1.00 30.11

3423 C ALA 365 105.075 41.813 30.826 1.00 31.00 3424 0 ALA 365 104.727 41.708 32.005 1.00 31.25

3425 CB ALA 365 107.482 41.585 30.140 1.00 31.82

3426 H ALA 365 106.191 40.762 28.123 1.00 25.00

3427 N ILE 366 104.548 42.708 29.992 1.00 33.54

3428 CA ILE 366 103.512 43.653 30.417 1.00 33.21

3429 C ILE 366 102.287 42.889 30.922 1.00 29.56

3430 0 ILE 366 101.743 43.199 31.987 1.00 31.04

3431 CB ILE 366 103.086 44.582 29.255 1.00 33.17

3432 CG1 ILE 366 104.264 45.455 28.823 1.00 30.87

3433 CG2 ILE 366 101.908 45.453 29.674 1.00 28.96

3434 CD1 ILE 366 103.987 46.289 27.599 1.00 35..02

3435 H ILE 366 104.869 42.731 29.067 1.00 25.00

3436 N GLU 367 101.874 41.875 30.167 1.00 28.47

3437 CA GLU 367 100.726 41.061 30.548 1.00 30.13

3438 C GLU 367 100.945 40.439 31.929 1.00 30.58

3439 0 GLU 367 100.029 40.407 32.754 1.00 31.55

3440 CB GLU 367 100.461 39.966 29.507 1.00 38.78

3441 CG GLU 367 100.228 40.472 28.074 1.00 52.31

3442 CD GLU 367 99.180 41.585 27.970 1.00 62.83

3443 OE1 GLU 367 98.144 41.525 28.675 1.00 55.58

3444 OE2 GLU 367 99.395 42.523 27.168 1.00 63.90

3445 H GLU 367 102.351 41.673 29.337 1.00 25.00

3446 N ARG 368 102.167 39.985 32.196 1.00 28.25

3447 CA ARG 368 102.479 39.385 33.487 1.00 21.98

3448 C ARG 368 102.462 40.420 34.607 1.00 22.36

3449 0 ARG 368 102.080 40.108 35.738 1.00 22.36

3450 CB ARG 368 103.821 38.661 33.440 1.00 23.96

3451 CG ARG 368 103.796 37.364 32.642 1.00 17.80

3452 CD ARG 368 102.812 36.352 33.224 1.00 19.62

3453 NE ARG 368 103.008 35.034 32.626 1.00 19.60

3454 CZ ARG 368 102.516 33.897 33.113 1.00 20.41

3455 NH1 ARG 368 101.773 33.898 34.211 1.00 26.21

3456 NH2 ARG 368 102.843 32.743 32.548 1.00 22.02

3457 H ARG 363 102.868 40.046 31.510 1.00 25.00

3458 HE ARG 368 103.526 34.993 31.804 1.00 25.00

3459 1HH1 ARG 368 101.580 34.754 34.685 1.00 25.00

3460 2HH1 ARG 368 101.410 33.036 34.566 1.00 25.00

3461 1HH2 ARG 368 103.454 32.730 31.755 1.00 25.00

3462 2HH2 ARG 368 102.476 31.888 32.904 1.00 25.00

3463 N MET 369 102.849 41.654 34.293 1.00 23.19

3464 CA MET 369 102.845 42.716 35.295 1.00 20.55

3465 C MET 369 101.410 43.060 35.657 1.00 20.66

3466 0 MET 369 101.085 43.248 36.833 1.00 24.28

3467 CB MET 369 103.565 43.966 34.789 1.00 24.43

3468 CG MET 369 103.575 45.097 35.806 1.00 27.10

3469 SD MET 369 104.503 46.538 35.283 1.00 33.91

3470 CE MET 369 105.378 46.942 36.804 1.00 36.11

3471 H MET 369 103.151 41.852 33.380 1.00 25.00

3472 N LYS 370 100.550 43.142 34.645 1.00 27.52

3473 CA LYS 370 99.135 43.441 34.865 1.00 27.03

3474 C LYS 370 98.572 42.392 35.817 1.00 26.80

3475 0 LYS 370 97.854 42.720 36.766 1.00 31.01 O

cococococoeococococoeococococoeococococococoeocococoeoeococotococoeoeoco o co eo co eoeoco eo co eo co 101 Ol Ol Ol Ol Ol Ol OI 01 O1 OI 01 Ol O101 O101010l Ol Ol O101 Ol O1010l 4k 4k 4k 4k 4k 4k 4k 4k 4 4 4k 4k 4k 4k 4k 4k k 4k 4 4k 4 4k 4 r roorroorroorroorroorroorroorroo OoOoOoOoOoOoOoOoOoOoCcOoCcOo _ CcOo _ Cc _OoCt _OoCPD CeθD CCDD 2 eo co eo co e CO (O 0000000000 CO 0000 CD vl v| vl vl vicnen4kcoroooeooovio)en4keoto otooovioooι4keoro (O0ovicnen4kcotooo(oooviooen4kcorooo(ocovicn OooO

Λ

>>S>S>a>S>S>a>a>a>3>S>S>S>S>S>3>Λ><<>><><<>><><<>><<><><>><>< OnOO„OOOC)OOOC)C) )C)C)r rrr rr ri"rrrrrrrrccccccccccfl)tWM C CO CO CO CΛ

coeococoeococoeoeoeocoeoeocoeoeoeoeococoeoeoeocoeocoeoeocoeocoeocoeocoeocoeococoeocoeocoeoeococoeoeococo | | | | | vl l | | l l l | S S |SS | l S | v| | l | l v| | v| l | | N| 4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4k4kC eoC eoC e C C IorOfOIOrOMrotOo_k_k_k_k____vioOOOOOOOO e$eS (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (0 (00 (0 (0 (0 (0 (00000 (0 (000 (0 (00 cococo

Kl < CΛ 55 ci ϋι ι555S5c)icnσ CD O' 000 ~0 % viptoocororototooocoooo cococo

4k oi io in vi to ro t oo o c 4 4k v| CO CO CO rn bopixjoviio itoviro' co eo vi __ vi to 4ok t c _oo k to cnn t oo o _o CO oo JJS cpoencΛcocneorococncoenσ)4k4k42kθo— v „i ,ro viroroo kθ4kvieo " o ~ 4k oo o eo K " to bδ jfi o Oi4 0orococovicn4k0oorotocncor 2ocooSo2 vl o oocooi

C oOook CvOi CoOo 4ok 4 .ok. CtoO_ Co-OoCθp4k 4ok 4rok 4ok 4_k_4k r4okr4ok roincv|vi vivibotool_ ntoen p vioιvi o4kroc 4kovi -c -nc -noc c -nSp eoooocn4kcnooovicoeoootocovivio

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO is)r)K)MNK)4 ikuuuωrjωωιs)ωι ωωωuωωuN)K)^N)MMN)M po viωro o _k ^ o^pproo p v|vi 4k4 p4kcoo_ cnc e e c c θMe oo bbbbbbb∞o obbM 4k ωintobovibo'vibobobb4kboroiorobbbto ooooooooen(neneocneΛeΛ(θoovi_eo4ktooenoofocoenroviroovioωoooocncocoooooeooocnviιo

3528 N ASN 375 96.351 40.721 41.202 1.00 31.47

3529 CA ASN 375 96.458 39.883 42.388 1.00 28.79

3530 C ASN 375 96.897 40.652 43.625 1.00 26.40

3531 0 ASN 375 96.561 40.266 44.746 1.00 27.83

3532 CB ASN 375 97.359 38.683 42.112 1.00 35.49

3533 CG ASN 375 96.744 37.720 41.111 1.00 32.04

3534 0D1 ASN 375 95.982 38.125 40.237 1.00 33.82

3535 ND2 ASN 375 97.075 36.442 41.231 1.00 34.73

3536 H ASN 375 96.970 40.566 40.454 1.00 25.00

3537 1 HD2 ! ASN 375 96.671 35.822 40.590 1.00 25.00

3538 2HD2 : ASN 375 97.686 36.184 41.941 1.00 25.00

3539 N TYR 376 97.643 41.736 43.422 1.00 32.41

3540 CA TYR 376 98.075 42.599 44.526 1.00 36.00

3541 C TYR 376 96.803 43.220 45.101 1.00 36.51

3542 0 TYR 376 96.585 43.247 46.316 1.00 32.23

3543 CB TYR 376 98.960 43.739 44.010 1.00 34.19

3544 CG TYR 376 100.447 43.464 43.979 1.00 41.46

3545 CD1 TYR 376 100.993 42.339 44.601 1.00 40.12

3546 CD2 TYR 376 101.315 44.350 43.336 1.00 41.43

3547 CE1 TYR 376 102.365 42.104 44.580 1.00 38.75

3548 CE2 TYR 376 102.688 44.127 43.310 1.00 37.68

3549 CZ TYR 376 103.203 43.005 43.932 1.00 41.58

3550 OH TYR 376 104.560 42.785 43.895 1.00 43.07

3551 H TYR 376 97.915 41.956 42.506 1.00 25.00

3552 HH TYR 376 104.761 41.958 44.341 1.00 25.00

3553 N ASN 377 95.965 43.713 44.194 1.00 37.58

3554 CA ASN 377 94.704 44.343 44.550 1.00 36.82

3555 C ASN 377 93.807 43.352 45.285 1.00 35.16

3556 0 ASN 377 93.276 43.658 46.353 1.00 35.66

3557 CB ASN 377 94.011 44.846 43.287 1.00 38.60

3558 CG ASN 377 92.858 45.770 43.587 1.00 43.38

3559 OD1 ASN 377 92.949 46.628 44.462 1.00 38.97

3560 ND2 ASN 377 91.774 45.622 42.838 1.00 46.57

3561 H ASN 377 96.210 43.651 43.245 1.00 25.00

3562 1 HD2 ASN 377 91.023 46.218 43.029 1.00 25.00

3563 2HD2 ASN 377 91.765 44.936 42.143 1.00 25.00

3564 N VAL 378 93.683 42.147 44.735 1.00 32.14

3565 CA VAL 378 92.857 41.106 45.344 1.00 28.96

3566 C VAL 378 93.339 40.801 46.766 1.00 33.76

3567 0 VAL 378 92.532 40.647 47.690 1.00 32.35

3568 CB VAL 378 92.858 39.818 44.490 1.00 30.20

3569 CG1 VAL 378 92.051 38.732 45.169 1.00 28.32

3570 CG2 VAL 378 92.285 40.104 43.105 1.00 26.65

3571 H VAL 378 94.153 41.951 43.897 1.00 25.00

3572 N GLU 379 94.657 40.741 46.940 1.00 36.35

3573 CA GLU 379 95.258 40.478 48.246 1.00 38.43

3574 C GLU 379 94.875 41.598 49.209 1.00 36.80

3575 0 GLU 379 94.579 41.352 50.383 1.00 37.49

3576 CB GLU 379 96.780 40.395 48.114 1.00 43.01

3577 CG GLU 379 97.544 40.416 49.436 1.00 52.96

3578 CD GLU 379 99.055 40.403 49.250 1.00 61.44

3579 OE1 GLU 379 99.526 40.225 48.107 1.00 70.64 έ

co co eo co co co eocoeoeoco eoco cococo eo eo cococo eo eo coeo co eoeocoeoco eo co eo co co eo co eo eo eoco eo coco co eo co co co coeo en en(n en cncn cn cncocncn cno>cncn(n (n cn cncncn cn cn cncncncncncn cncn cn cn cn oioi oi oi oioi oioi oi oioi oi oi oi oioi oi oi

U U N N I M M M M N M M - - - J J - J - J J O O O O O po O O O O _ _ (0 (0 (O IO (0 _ (0 _ „ 0) ffl O) 00 _ „ o co oo vi -o-oo-ι 4-kc-o- t-o- o oto oovi - c -n e -n 4k c -o - -ro - o eo oo vi c _o cn 4- co ro θ (θ co vico cΛ 4k co ro oo — (o co vi σo oi 4kco ro -

OOOOZXOOOOOOOOOOZXXOOOOOZOOOOOOO

CD Nrπrπoo ODO m x N m Oo CoDoo >ozxxooooo r Ncorome rorπorooocD x Ωxo ro o o CD >zxo m ro

FFFFF JTJTJTJTJTJTJTJTJTJTJTJ-H-mHHHHH-HHHHHHHHHHHHHHHHωωωCOCΛωωωoO mmmmmii ii ^^^^^^^^^^^^^^^^ iii ii irππirnmmmmmr-r- mmxmmmmmmmmm j ττjτj jτjτ τj jτjτ τjτjτjτj3.33J 7Jππ^JΛ J3 ?_ J3J?ci3J7 cc m ωc ωω uωωωω c ωωωc ω coc ωωωωωωcjωω ωuωωc ωc coωc ω uωω ωωω ωc ωω ωωω ωω

O3θ) coc c -oc.c cocoαo)θ) α

S S 5 S 5ωωωωωωωωωωωωMr r MN)Mr M MNr MNiM W r - - - - -' -- -' -'θo o o oo oo(θ (o cooo coco coco co (cOoc(Oo (O (O (O ( (O (O (O (O 00 (D (O (D (O (O (O (O (O (O (O (O (O (O (O (O 00 (O 00 CO CD 00 (O (O (O (O (O CD to co co to co co co o ooto o o _ooi e'- C*Λ~ Ϊk cn ϊk ^ oMω r (o oro __ o _ o or o o o o _k _k orooooo eoo oro 4k θi 4k IO CO k Ol CO

O CO - 4,k- , 4k O cn ro cn oo to co co vl o Scn co Qoenoioiro ro o oro 4kO Qo 4k o ro coeno _i. r.o_ p_ n_o o cni --vvii r roo c eoo o co vi vi b in i io vi

CO O 00 cn enro 4koen ocn _ _k π rn ra E 4k v vii rcnn no roen -ok _ vvii (coO mc no K*. m(o Mro __ j>o nω rj rpo (ujS 1- It. vi c moo r->o r-> rcDn _ ro 4k vl CO rn 4_ v| o ooen oo toco ooocn o 2 O 2 CΛ 00

CO 4k en o enro vi ro eno co ooen o ooo 4k Oo o __ k o eo cn 4 ento eo vi o o o o k vi en

_k 4k vi cD 4k to oo 4k eoooocoσ cn oι vico 4k ne oo o cnvi e vi co vi e o oι o oι oσ) vi oo c ( —θviroroe oω oo -vi ro o 4k 2p

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

4k 4k 4k 4k 4krθ 4kCΛCΛ Cn 4k 4k 4k 4k 4k 4k 4k rθN0COC 4k 4k eθCθ 4k Cθ eo N0C CO C C rO M C C M C C C C r M o vj icoc en oop pvi ^p ^ M p vi j-k ro ω o ^ vivi ^ -k p p vicneo oc c^

2 _* ro o o iob ro vi χ) bio b 'vibb-4kωi o tor co o ιbvib o tob o v| vi c oe vi o cΛ vi oe enM(θ (o ooeΛeΛ ko ovic c ro o_k θco ooe eΛ θ e ro o oo oeo -vi cn eΛ o co o o

4. UI

o o

ωω ωωωωcoωωc ω wω ωc wωωω wωuωwc ωω ωωwwwωuω w ωωωw ω ωω ωωωωωωω ω ω θ)Φθ <no)θ) o>CAθoci)θ)θ)θ)Qci)θ)θ)θ>cnθ)α θ)θ) θ>ffi

Coα>oo co vi | i j i | vi j v|vicn c σ u u p σou u uθui ι ι ι ι cήc c cn cn 4k 4k 4k 4k k 4k 4k wι o _ coo vicnc 4 co M o oto oo vi c c 4k eoc o ocooo vi n cΛ 4k c M o o cocxι vj cn cΛ 4 C o o c to oozoooooozxxoooooozxxooooooooooozxooo :xoooooooozxooo > OOCD > o OO D

_k ro > i xNm romσr ooocD > > mmσocD > ooo

5-S22222222^^^^^^^^^_^_J_Jιi_J_J_^ιi_J_ _J_^

OOOOOOOOO OX Λ3J -Λ31J1 )Λ αΛ „ „ )30 „ Λ 7JΛ3)3) 3J 3)-< -< ^ ^C C CCCC C CC C m'

wωωωωωωcouωωωc ωωwω ωωωwc c uωω wωc www ωωwωωc wωc ωωωωwωωωwω w ωco cocoαc. ∞c- -oc()C ci9Coα>cαoo αco coc9

000(0(0 - ( —0 (0(0( -0- (0- δ eooccn e oooo oov| viv| v| vjv| vi viv|v| vi vj vi vi en cnen en cn cn oι oιoι oιoι oι oι oιoi 4k

CO tO CO CO CO tO CO CO C—O CO CO CO CO CO CO COCO CO GO CO CO SooΦ ∞co coc.co (θΦ αco c.coαα ∞ ∞∞oo m co∞ )CDα cDΦ t p -Λ ^ p ^ p oo o __ δ eo o o eo -J to vi oocnoo vi oooo o o oo co coootocoto cooicncn co vi cD v| v| p -k _ to o oo o oo cn cnroviv|o i4 oo vio 2 V| _ o icno oo eenn oo op oo vienoeooroenenrocno vi bi vi vi _ o co eo 4 vl 4k C04k 004k v|tO v| 04k 4k 00 o o SCCΛΛ'0eΛ10CX0>44kk (e0o 44kk (θ (θ co5eΛeo vien cnco eocn en eΛ 4k tooicn en 4k eo co

O O CO eneo r coco 4k co oo -vi en M MeΛ o| vi o 4k cnoo o c roto oιoι vi -- 2o o j&. , c-o eo oo ro ro ro co eo eo co coeo co co coco eo co co CO CO CO CO CO Cθ eθ tO C ,.O CO Cθ _4-k .C.O CO Cθ _4k _4k ,4_k -4_k- 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k vi vviit_oωco t_orroo oo oc_oo rrocco 4krroo 44kkctoo o ceo 4-- *4_kcncn envienen vi oo o vioo too ro o o ro ό ό o ro ro co vi p en

_ co io in b to " to en en oo en o _ ._ o -vi en o oro coσ o to ro σ>4k ooc coώ o oioio σ) ol_bo vi robι 4k epeoeo vio _ vi ooeo . oo ooroconocenn cΛ o _. _ 4___ cn ro o ro eo vi roeo cD 4k „ cn.c „o v ,it_o o 4kco coro p 4 vi co c 4- oo o co co eneoen eooi eo ooo 13o o

eooocn cn ro vi 4k (o o o vi co υιιo co cn rooo cΛ v| en e -vieo H to o vi jS cnen en en oi en oicncn e cnnccnn ocΛioθii ooiιooiι oι <Λ pι pι 4k pι oιoιoιoιoιoιoιoi (Λ θi (Λ oι oι oι cn en cn cn 4k θι oι oι oι oι oι pι en en en en en p __ __ r P p to t -oui icQ ^^^^ ^pppr pt t i ^ ^ ^ cncn vi pω J ϋl i -' CO * 0) v_ vι v^iι ιroo —^c 4- kbto io4kbviobcvi'- too^cobrooeotov^

4k (nroenen cn cn vien enoro eΛ ^ cn v| o vi cacn vi cooo to cnocn vioo ιo vi ρro ro , to coco cΛ ,4k co co oo rocn cn oι k Coen o cD oo 4 (o oooιo o 4_ to oo P M o 4k M e e eΛθ v| ι c ro 4k ro eo 4k θo 4k vi <Λ o cnoo to vi eno ro vi co o vi

oooooooooooooooooooooooooooooooooo oooooooooooooooooo oooooooooooooooooooooooooooooooooo oooooooooooooooooo

4k eo c e e ro 4k eoe c o ι co 4k 4k 4k 4k 4k 4 io ro cope co co c eo co 4k 4k 4k k ro k 4 k 4 .k . IO O -l.4- CΛ k 4k CΛ 4k 4 4 rθ 4 4 Mθoco to o to 4k 4k 4k CΛ θico co M CΛ to c θi oι ∞ kroM tπcoco co en eo ro e k t cΛ eΛ ro 4kθ co ro o ooeocn cΛ o en ro ώi t M i)b bb i v| sbώ ωbb j k b i J tn ωb b *k bb b ^ k j )gόι vi o en (o o ro o orocoooeoe4k enro 4k cno oenvi -- vi4k vi-- o)co oo cn .& θ 4kθ ro oo oooen o en oo(o roeocΛ θ co o

4.

coωωωωωc ωωc cotoωc ωωcoc ωωωc uc ωωc ωωωωωcowωωωcoωωωωωωωωωwwωωω

SSNSvJS v|Mv| M MSSvlNv|v| MMv| v|v|v|v| Sv|v|vlSCt)CI)O>0)0)O)CI)Cn0)O)O)a)O)O)O)CI) coe coeoωωMMMMMroMt roM-k o_k_k--k_k_k_k___oooooooooo _(ocD_ (D(θ (θ(θ(θc∞ c ke Moo(oevia)en4 c ιooo(θcvicnen4kc Moθ(Dθovicnen4kcoMoo(oevie cΛ4keorooocDooviooeΛ4^ oOoOoOoCDooo>zxxxoxoNomomoσo rooo ooocoooo> xoooooooozxx m tom oσocD > OOOZOOOO Ω 0 O0 XOOO CD00 > o o co > σ o D tO o to

C^CCCCCC-d^ ^ ^ _-J- _-J Λ θ θ co o_oc coω Λ< <<<<<<<TJTJTJTJ mmmmmmmm^^^-<!^-e;- ^^-c:- rrrrrrrrrrinnirnmniiiirnm> >>>>>>>73737373

C C C3J7J3J J7J^J3J )7J7J77J J JCC CCC CC3J I33 3 3J3)SJi- i-r-r-i-r-r-r-oOOO

eoeoeoeoeoeoeoeococoeoeoeocoeocococoeococoeoeoeocococoeocoeocoeoeoeoeoeocoeoeoeoeocoeoeoeococoeococococo

(D(D (0(0 (0(0 (0(0(P (p p (pP Pφ (p (p(p (p(Pφφ(0(θeθ(0 (0(0(0(0 (0 (0 (0 (0 (0(0 (00 (0 (0 (0(0 (0 (0 (0 (OCO CD (OCD eΛcncneΛc cne c S^*^ S*^ *^^**c c e toωt e c e e rorororoMt oroo_k_ ____k_kθooo CO(O CO (O CO 000000 CO oien4k4kcooo(ocoro

" eontoroiooccoobvitocntoco'oviit-o

eocnoviooo4k 2

oooooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooooo roMroMroMMroMM4k4ke 4kco4k4keoe c ι eoM4k4ke eocoMeoc e roMeΛ4kcoe eoeoMC eo4 eo4k4k 4kcvioooo(θoooo oro eΛpropωop oe op coo _ Λ poco-ocnvicΛviviMviooM b to tob to o _k tob b 4k iΛ vi _k∞ iΛ bb b-vi vi bb to∞ beΛCΛ to oto tobbe^ rovicooeoMoe oocoencnoooooocoo-ι-4kθc oo4kvicoe 4kCenooeΛ(o-oov4roovirooooc roooenotD

3736 H LEU 395 95.720 29.293 47.301 1.00 25.00

3737 N SER 396 95.620 30.324 44.093 1.00 29.97

3738 CA SER 396 95.239 30.836 42.780 1.00 32.88

3739 C SER 396 95.535 32.329 42.624 1.00 28.77

3740 0 SER 396 95.715 32.818 41.508 1.00 27.80

3741 CB SER 396 93.770 30.518 42.465 1.00 39.24

3742 OG SER 396 92.896 30.992 43.472 1.00 46.99

3743 H SER 396 94.943 29.866 44.642 1.00 25.00

3744 HG SER 396 92.971 31.948 43.546 1.00 25.00

3745 N ASN 397 95.597 33.046 43.745 1.00 25.18

3746 CA ASN 397 95.907 34.472 43.723 1.00 29.15

3747 C ASN 397 97.333 34.739 44.226 1.00 27.87

3748 0 ASN 397 98.106 35.459 43.588 1.00 28.50

3749 CB ASN 397 94.909 35.264 44.577 1.00 29.41

3750 CG ASN 397 95.146 36.770 44.505 1.00 35.89

3751 OD1 ASN 397 94.831 37.404 43.502 1.00 37.46

3752 ND2 ASN 397 95.715 37.343 45.564 1.00 30.17

3753 H ASN 397 95.421 32.602 44.603 1.00 25.00

3754 1 HD2 : ASN 397 95.872 38.310 45.510 1.00 25.00

3755 2HD2 ! ASN 397 95.953 36.794 46.336 1.00 25.00

3756 N ALA 398 97.682 34.123 45.351 1.00 26.89

3757 CA ALA 398 98.986 34.300 45.980 1.00 24.87

3758 C ALA 398 100.205 33.854 45.178 1.00 28.89

3759 0 ALA 398 101.303 34.358 45.395 1.00 31.67

3760 CB ALA 398 98.992 33.646 47.337 1.00 24.15

3761 H ALA 398 97.035 33.533 45.770 1.00 25.00

3762 N LEU 399 100.039 32.910 44.262 1.00 27.33

3763 CA LEU 399 101.181 32.464 43.474 1.00 29.45

3764 C LEU 399 101.755 33.589 42.617 1.00 32.27

3765 0 LEU 399 102.967 33.807 42.603 1.00 34.30

3766 CB LEU 399 100.823 31.254 42.611 1.00 25.44

3767 CG LEU 399 100.621 29.949 43.390 1.00 24.86

3768 CD1 LEU 399 100.172 28.853 42.451 1.00 20.68

3769 CD2 LEU 399 101.900 29.549 44.104 1.00 22.68

3770 H LEU 399 99.159 32.500 44.121 1.00 25.00

3771 N ALA 400 100.887 34.336 41.943 1.00 29.07

3772 CA ALA 400 101.343 35.434 41.094 1.00 31.03

3773 C ALA 400 101.939 36.601 41.882 1.00 29.34

3774 0 ALA 400 102.813 37.303 41.373 1.00 26.86

3775 CB ALA 400 100.215 35.925 40.192 1.00 32..40

3776 H ALA 400 99.932 34.143 42.022 1.00 25.00

3777 N THR 401 101.500 36.796 43.125 1.00 27.66

3778 CA THR 401 102.024 37.896 43.929 1.00 30.92

3779 C THR 401 103.505 37.728 44.303 1.00 35.35

3780 0 THR 401 104.118 38.649 44.847 1.00 36.05

3781 CB THR 401 101.170 38.174 45.194 1.00 27.88

3782 OG1 THR 401 101.106 37.007 46.021 1.00 27.11

3783 CG2 THR 401 99.768 38.593 44.803 1.00 25.60

3784 H THR 401 100.837 36.193 43.521 1.00 25.00

3785 HG1 THR 401 101.990 36.769 46.324 1.00 25.00

3786 N THR 402 104.076 36.558 44.016 1.00 30.98

3787 CA THR 402 105.492 36.310 44.295 1.00 28.76 3788 C THR 402 106.317 37.040 43.240 1.0028.41

3789 0 THR 402 107.509 37.248 43.422 1.0030.86

3790 CB THR 402 105.861 34.807 44.173 1.0024.70

3791 OG1 THR 402 105.656 34.372 42.820 1.0022.39

3792 CG2 THR 402 105.039 33.954 45.117 1.0021.26

3793 H THR 402 103.554 35.829 43.612 1.0025.00

3794 HG1 THR 402 105.851 33.431 42.770 1.0025.00

3795 N THR 403 105.656 37.373 42.130 1.0028.49

3796 CA THR 403 106.207 38.045 40.946 1.0025.51

3797 C THR 403 107.032 37.101 40.077 1.0027.25

3798 O THR 403 107.499 37.495 39.009 1.0029.50

3799 CB THR 403 107.060 39.323 41.246 1.0029.54

3800 OG1 THR 403 108.335 38.954 41.781 1.0024.64

3801 CG2 THR 403 106.339 40.267 42.203 1.0026.87

3802 H THR 403 104.707 37.143 42.086 1.0025.00

3803 HG1 THR 403 108.246 38.543 42.630 1.0025.00

3804 N TYR 404 107.120 35.833 40.474 1.0025.89

3805 CA TYR 404 107.914 34.860 39.728 1.0022.27 3 3880066 C T TYYRR 404 107.544 34.611 38.272 1.0024.30 3 3880077 0 TTYYRR 404 108.439 34.511 37.434 1.0026.21

3808 CB TTYYRR 404 108.062 33.551 40.509 1.0030.29

3809 CG TTYYRR 404 109.278 33.544 41.419 1.0030.18

3810 CD1 TTYYRR 404 109.800 34.736 41.922 1.0031.88

3811 CD2 TYR 404 109.925 32.352 41.755 1.0028.35

3812 CE1 TYR 404 110.937 34.747 42.732 1.0030.99

3813 CE2 T TYYRR 404 111.065 32.353 42.569 1.0029.01

3814 CZ T TYYRR 404 111.563 33.558 43.051 1.0029.70

3815 OH T TYYRR 404 112.683 33.593 43.847 1.0027.42

3816 H T TYYRR 404 106.644 35.551 41.285 1.0025.00

3817 HH TTYYRR 404 113.022 32.697 43.955 1.0025.00

3818 N TTYYRR 405 106.253 34.508 37.952 1.0024.23

3819 CA TTYYRR 405 105.844 34.306 36.553 1.0024.60

3820 C TTYYRR 405 106.361 35.507 35.766 1.0023.35

3821 0 TTYYRR 405 106.912 35.378 34.672 1.0023.93

3822 CB TTYYRR 405 104.317 34.292 36.406 1.0025.23

3823 CG TTYYRR 405 103.593 33.163 37.099 1.0024.35

3824 CD1 TTYYRR 405 103.561 31.879 36.548 1.0023.45

3825 CD2 TYR 405 102.894 33.390 38.282 1.0023.55

3826 CE1 TYR 4005 102.846 30.852 37.161 1.0023.28

3827 CE2 T TYYRR 405 102.179 32.374 38.901 1.0027.86

3828 CZ TTYYRR 405 102.155 31.111 38.337 1.0026.80

3829 OH TTYYRR 405 101.428 30.121 38.956 1.0026.06

3830 H TTYYRR 405 105.577 34.557 38.658 1.0025.00

3831 HH TTYYRR 405 101.510 29.308 38.452 1.0025.00

3832 N TTYYRR 406 106.160 36.676 36.363 1.0023.37

3833 CA TTYYRR 406 106.553 37.964 35.813 1.0021.93

3834 C TTYYRR 406 108.072 38.084 35.621 1.0025.55

3835 0 TTYYRR 406 108.535 38.439 34.538 1.0024.19

3836 CB TTYYRR 406 106.021 39.047 36.751 1.0022.96

3837 CG TTYYRR 406 106.379 40.468 36.408 1.0021.90

3838 CD1 TTYYRR 406 106.352 40.926 35.093 1.0020.58

3839 CD2 TYR 406 106.703 41.375 37.416 1.0027.70 3840 CE1 TYR 406 106.634 42.252 34.796 1.00 21.17

3841 CE2 TYR 406 106.985 42.700 37.128 1.00 24.51

3842 CZ TYR 406 106.947 43.131 35.820 1.00 23.02

3843 OH TYR 406 107.207 44.449 35.541 1.00 28.99

3844 H TYR 406 105.729 36.670 37.238 1.00 25.00

3845 HH TYR 406 107.398 44.923 36.351 1.00 25.00

3846 N LEU 407 108.844 37.750 36.652 1.00 25.38

3847 CA LEU 407 110.303 37.826 36.574 1.00 23.31

3848 C LEU 407 1 10.873 36.825 35.575 1.00 20.18

3849 0 LEU 407 111.803 37.147 34.836 1.00 22.15

3850 CB LEU 407 1 10.940 37.620 37.952 1.00 20.82

3851 CG LEU 407 110.514 38.602 39.048 1.00 25.79

3852 CD1 LEU 407 1 11.362 38.376 40.287 1.00 24.12

3853 CD2 LEU 407 110.636 40.045 38.562 1.00 15.72

3854 H LEU 407 108.434 37.445 37.475 1.00 25.00

3855 N ALA 408 110.299 35.625 35.539 1.00 14.35

3856 CA ALA 408 110.747 34.591 34.609 1.00 17.38

3857 C ALA 408 110.520 35.083 33.183 1.00 22.75

3858 0 ALA 408 111.382 34.931 32.318 1.00 25.21

3859 CB ALA 408 109.991 33.293 34.852 1.00 17.26

3860 H ALA 408 109.560 35.429 36.149 1.00 25.00

3861 N THR 409 109.362 35.695 32.949 1.00 23.86

3862 CA THR 409 109.037 36.228 31.632 1.00 22.93

3863 C THR 409 110.012 37.353 31.294 1.00 25.61

3864 0 THR 409 110.507 37.443 30.165 1.00 26.75

3865 CB THR 409 107.598 36.776 31.589 1.00 26.26

3866 OG1 THR 409 106.689 35.765 32.042 1.00 26.48

3867 CG2 THR 409 107.222 37.170 30.173 1.00 18.58

3868 H THR 409 108.709 35.780 33.672 1.00 25.00

3869 HG1 THR 409 106.917 35.516 32.932 1.00 25.00

3870 N THR 410 110.316 38.185 32.287 1.00 26.70

3871 CA THR 410 111.233 39.299 32.095 1.00 26.67

3872 C THR 410 112.650 38.835 31.757 1.00 29.09

3873 0 THR 410 113.298 39.411 30.877 1.00 29.16

3874 CB THR 410 111.281 40.208 33.333 1.00 28.30

3875 OG1 THR 410 109.962 40.684 33.626 1.00 30.05

3876 CG2 THR 410 112.189 41.404 33.082 1.00 28.81

3877 H THR 410 109.905 38.064 33.169 1.00 25.00

3878 HG1 THR 410 109.991 41.259 34.393 1.00 25.00

3879 N SER 411 113.105 37.760 32.399 1.00 24.71

3880 CA SER 411 114.452 37.254 32.155 1.00 24.18

3881 C SER 411 114.688 36.909 30.687 1.00 25.08

3882 0 SER 411 115.822 36.964 30.204 1.00 27.75

3883 CB SER 411 114.753 36.046 33.043 1.00 20.40

3884 OG SER 411 114.010 34.914 32.644 1.00 21.48

3885 H SER 411 112.534 37.287 33.041 1.00 25.00

3886 HG SER 411 114.205 34.667 31.738 1.00 25.00

3887 N TYR 412 113.613 36.573 29.979 1.00 23.79

3888 CA TYR 412 113.692 36.227 28.562 1.00 24.39

3889 C TYR 412 113.8774 37.44 27.655 1.00 25.24

3890 0 TYR 412 114.437 37.326 26.570 1.00 27.76

3891 CB TYR 412 112.419 35.511 28.116 1.00 25.37 3892 CG TYR 412 112.273 34.072 28.539 1.00 29.38

3893 CD1 TYR 412 113.043 33.531 29.569 1.00 29.32

3894 CD2 TYR 412 111.338 33.248 27.910 1.00 24.28

3895 CE1 TYR 412 112.878 32.199 29.964 1.00 26.36

3896 CE2 T TYYRR 412 11 1.169 31.927 28.291 1.00 25.08

3897 CZ T TYYRR 412 111.937 31.408 29.318 1.00 29.45

3898 OH T TYYRR 412 111.750 30.099 29.693 1.00 27.61

3899 H T TYYRR 412 1 12.738 36.552 30.423 1.00 25.00

3900 HH T TYYRR 412 112.347 29.879 30.418 1.00 25.00

3901 N L LEEUU 413 113.396 38.604 28.100 1.00 25.11

3902 CA L LEEUU 413 113.467 39.832 27.304 1.00 27.32

3903 C L LEEUU 413 114.835 40.149 26.726 1.00 30.49

3904 0 L LEEUU 413 114.957 40.434 25.533 1.00 30.50

3905 CB L LEEUU 413 112.959 41.039 28.103 1.00 23.58

3906 CG L LEEUU 413 111.476 41.081 28.478 1.00 31.45

3907 CD1 L LEEUU 413 111.179 42.362 29.242 1.00 31.49

3908 CD2 L LEEUU 413 110.613 40.996 27.231 1.00 30.34

3909 H L LEEUU 413 112.980 38.636 28.989 1.00 25.00

3910 N G GLLYY 414 115.859 40.098 27.573 1.00 28.96

3911 CA G GLLYY 414 117.203 40.404 27.129 1.00 27.47 3 3991122 C G GLLYY 414 117.990 39.233 26.586 1.00 28.88 33991133 0 G GLLYY 414 119.186 39.362 26.340 1.00 34.59

3914 H GLY 414 115.698 39.833 28.496 1.00 25.00

3915 N MET 415 117.353 38.079 26.436 1.00 29.79

3916 CA MET 415 118.043 36.909 25.906 1.00 29.75

3917 C MET 415 117.861 36.868 24.393 1.00 35.70

3918 O MET 415 116.795 36.522 23.893 1.00 39.21

3919 CB MET 415 117.515 35.630 26.554 1.00 22.67

3920 CG MET 415 117.728 35.581 28.050 1.00 23.60

3921 SD MET 415 117.062 34.095 28.794 1.00 32.91

3922 CE MET 415 118.255 32.896 28.242 1.00 24.83

3923 H MET 415 116.398 38.012 26.652 1.00 25.00

3924 N LYS 416 118.933 37.181 23.677 1.00 40.25

3925 CA LYS 416 118.942 37.233 22.218 1.00 43.20

3926 C LYS 416 118.370 36.031 21.466 1.00 42.08

3927 O LYS 416 118.037 36.143 20.289 1.00 44.24

3928 CB LYS 416 120.362 37.539 21.735 1.00 48.69

3929 CG LYS 416 120.916 38.828 22.333 1.00 60.37

3930 CD LYS 416 122.427 38.949 22.191 1.00 70.42

3931 CE LYS 416 122.936 40.173 22.949 1.00 72.06

3932 NZ LYS 416 124.412 40.319 22.863 1.00 78.00

3933 H LYS 416 119.749 37.416 24.164 1.00 25.00

3934 1HZ LYS 416 124.870 39.475 23.262 1.00 25.00

3935 2HZ LYS 416 124.687 40.423 21.865 1.00 25.00

3936 3HZ LYS 416 124.709 41.163 23.393 1.00 25.00

3937 N SER 417 118.239 34.893 22.138 1.00 39.46

3938 CA SER 417 117.706 33.698 21.491 1.00 36.96

3939 C SER 417 116.247 33.395 21.833 1.00 34.08

3940 O SER 417 115.637 32.518 21.226 1.00 35.80

3941 CB SER 417 118.580 32.488 21.823 1.00 39.51

3942 OG SER 417 119.907 32.675 21.358 1.00 45.86

3943 H SER 417 118.485 34.856 23.077 1.00 25.00 3944 HG SER 417 120.288 33.461 21.743 1.00 25.00

3945 N ALA 418 115.688 34.106 22.806 1.00 30.28

3946 CA ALA 418 114.303 33.879 23.208 1.00 38.39

3947 C ALA 418 113.331 34.250 22.087 1.00 40.58

3948 0 ALA 418 113.145 35.427 21.779 1.00 42.57

3949 CB ALA 418 113.981 34.659 24.484 1.00 32.32

3950 H ALA 418 116.190 34.823 23.238 1.00 25.00

3951 N THR 419 112.750 33.232 21.457 1.00 41.43

3952 CA THR 419 111.799 33.420 220.362 1.00 41.21

3953 C THR 419 110.357 33.504 20.865 1.00 40.11

3954 0 THR 419 110.077 33.235 22.036 1.00 39.88

3955 CB THR 419 111.892 32.264 19.338 1.00 39.89

3956 OG1 THR 419 111.666 31.016 20.005 1.00 50.18

3957 CG2 THR 419 113.261 32.238 18.672 1.00 37.82

3958 H THR 419 112.987 32.335 21.728 1.00 25.00

3959 HG1 T THHRR 419 112.370 30.881 20.644 1.00 25.00

3960 N GGLLUU 420 109.443 33.848 19.963 1.00 39.64

3961 CA GGLLUU 420 108.027 33.958 20.292 1.00 39.75

3962 C GGLLUU 420 107.496 32.650 20.871 1.00 35.49

3963 0 GGLLUU 420 106.718 32.652 21.828 1.00 35.76

3964 CB GGLLUU 420 107.222 34.321 19.041 1.00 46.65

3965 CG GGLLUU 420 106.741 35.765 18.980 1.00 56.30

3966 CD GGLLUU 420 105.668 36.081 20.015 1.00 65.12

3967 OE1 GGLLUU 420 104.685 35.311 20.130 1.00 62.03

3968 OE2 GGLLUU 420 105.804 37.112 20.707 1.00 72.02

3969 H GGLLUU 420 109.732 34.021 19.047 1.00 25.00

3970 N GGLLNN 421 107.938 31.537 20.291 1.00 32.71

3971 CA GGLLNN 421 107.520 30.206 20.722 1.00 36.14

3972 C GGLLNN 421 107.883 29.959 22.184 1.00 36.63

3973 0 GGLLNN 421 107.105 29.365 22.936 1.00 37.57

3974 CB GGLLNN 421 108.155 29.133 19.830 1.00 40.03

3975 CG GGLLNN 421 107.622 29.086 18.398 1.00 53.07

3976 CD GGLLNN 421 107.819 30.390 17.636 1.00 62.17

3977 OE1 GGLLNN 421 108.877 31.017 17.711 1.00 65.66

3978 NE2 GGLLNN 421 106.788 30.815 16.917 1.00 68.97

3979 H GGLLNN 421 108.580 31.620 19.555 1.00 25.00

3980 1 HE2 GLN 421 106.906 31.650 16.419 1.00 25.00

3981 2HE2 GLN 421 105.963 30.289 16.903 1.00 25.00

3982 N ASP 422 109.052 30.448 22.589 1.00 34.98

3983 CA A ASSPP 422 109.521 30.292 23.960 1.00 32.53

3984 C AASSPP 422 108.607 31.039 24.924 1.00 30.54

3985 0 AASSPP 422 108.272 30.525 25.992 1.00 33.81

3986 CB AASSPP 422 110.972 30.767 24.085 1.00 28.20

3987 CG AASSPP 422 111.929 29.945 23.233 1.00 28.18

3988 OD1 AASSPP 422 111.755 28.710 23.148 1.00 33.24

3989 OD2 ASP 422 112.855 30.529 22.638 1.00 33.81

3990 H ASP 422 109.610 30.933 21.946 1.00 25.00

3991 N P PHHEE 423 108.166 32.229 24.523 1.00 29.33

3992 CA PPHHEE 423 107.261 33.022 25.348 1.00 28.15

3993 C PPHHEE 423 105.877 32.373 25.407 1.00 29.51

3994 0 PPHHEE 423 105.205 32.424 26.441 1.00 30.32

3995 CB PPHHEE 423 107.143 34.448 24.808 1.00 31.32 4.

O OOOOO > xxoOoCDooo>zx OOOOOOOZXXOOOO ZO OZ oα oooooooozx to ooco > r x NNmm ron oooo o co > to co ro m m o o cn > oNomoooo ro- rom-koroσ—o rrwM otflcowwoirrr r-r-r-r-r-r-HHHHHHHHHHHHHHHH OO TJTJTJTJTJTJT) mmmmmmmmrn™™™mmmmm 377373737773737373773 c cΛ j^^^^^^3jccccccc τJTTTJTJT Tjτjττjτjτjττjτjccccccccccmmmmmmm

k 4k 4 4k k 4k k k 4 4k 4 4 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k 4k 4k 4 4k 4k 4 4 4 4k 4k 4 4k 4k 4k 4k 4k 4k 4 4k 4 4 4 4k 4k k

M M M rO I M N M M M M N M rO M M r M M M r M rsl N M N M M M M W M M M

∞Cvivlv|v4v|v!v|v|CncncncncncncncncnCΛCΛCΛCΛCΛCΛCΛCΛCΛCΛCΛCΛCΛCn(ΛCn4k4k4k 4k4k4-4k4k

oooooe -ooio -ro)enoooo4_ooroococoencooiootooovicn4kcovi_koicovi_cooioo 4kcooιcoroeovirocco4kvi -k4k

4048 C LYS 428 101.124 27.817 30.964 1.00 33.22

4049 0 LYS 428 100.505 26.845 31.410 1.00 34.36

4050 CB LYS 428 101.166 27.070 28.601 1.00 33.08

4051 CG LYS 428 100.690 27.213 27.166 1.00 40.80

4052 CD LYS 428 100.885 25.888 26.433 1.00 48.04

4053 CE LYS 428 100.314 25.910 25.002 1.00 54.20

4054 NZ LYS 428 100.438 24.571 24.377 1.00 59.29

4055 H LYS 428 102.587 29.209 28.628 1.00 25.00

4056 1 HZ LYS 428 99.919 23.866 24.937 1.00 25.00

4057 2HZ LYS 428 100.037 24.613 23.418 1.00 25.00

4058 3HZ LYS 428 101.440 24.300 24.323 1.00 25.00

4059 N ASN 429 101.992 28.518 31.693 1.00 36.19

4060 CA ASN 429 102.313 28.172 33.081 1.00 31.97

4061 C ASN 429 102.855 26.740 33.172 1.00 29.89

4062 0 ASN 429 102.272 25.882 33.839 1.00 25.78

4063 CB ASN 429 101.092 28.334 33.995 1.00 32.22

4064 CG ASN 429 100.814 29.782 34.358 1.00 36.78

4065 OD1 ASN 429 101.488 30.699 33.894 1.00 40.44

4066 ND2 ASN 429 99.826 29.991 35.215 1.00 41.36

4067 H ASN 429 102.436 29.294 31.299 1.00 25.00

4068 1HD2 ASN 429 99.643 30.918 35.449 1.00 25.00

4069 2HD2 ASN 429 99.331 29.226 35.566 1.00 25.00

4070 N PRO 430 103.997 26.472 32.508 1.00 29.30

4071 CA PRO 430 104.649 25.157 32.492 1.00 25.30

4072 C PRO 430 104.897 24.669 33.913 1.00 27.01

4073 0 PRO 430 105.218 25.463 34.801 1.00 27.38

4074 CB PRO 430 105.975 25.447 31.799 1.00 24.23

4075 CG PRO 430 105.664 26.610 30.932 1.00 30.06

4076 CD PRO 430 104.835 27.468 31.820 1.00 30.25

4077 N LYS 431 104.824 23.358 34.108 1.00 25.65

4078 CA LYS 431 105.020 22.774 35.426 1.00 25.93

4079 C LYS 431 106.308 23.248 36.107 1.00 24.81

4080 0 LYS 431 106.297 23.570 37.292 1.00 24.36

4081 CB LYS 431 105.000 21.252 35.325 1.00 26.70

4082 CG LYS 431 104.584 20.547 36.604 1.0040.34

4083 CD LYS 431 104.361 19.068 36.330 1.00 52.65

4084 CE LYS 431 103.775 18.345 37.531 1.00 60.92

4085 NZ LYS 431 103.587 16.892 37.247 1.00 58.59

4086 H LYS 431 104.610 22.777 33.352 1.00 25.00

4087 1HZ LYS 431 102.939 16.775 36.442 1.00 25.00

4088 2HZ LYS 431 104.506 16.462 37.018 1.00 25.00

4089 3HZ LYS 431 103.189 16.424 38.086 1.00 25.00

4090 N ILE 432 107.401 23.338 35.353 1.00 25.03

4091 CA ILE 432 108.667 23.774 35.934 1.00 21.64

4092 C ILE 432 108.561 25.188 36.505 1.00 24.42

4093 0 ILE 432 109.058 25.459 37.602 1.00 25.07

4094 CB ILE 432 109.847 23.646 34.928 1.00 22.09

4095 CG1 ILE 432 111.179 23.898 35.647 1.00 20.75

4096 CG2 ILE 432 109.662 24.587 33.739 1.00 20.53

4097 CD1 ILE 432 112.403 23.511 34.838 1.00 17.10

4098 H ILE 432 107.354 23.103 34.410 1.00 25.00

4099 N LEU 433 107.868 26.070 35.788 1.00 25.32 4100 CA LEU 433 107.674 27.448 36.240 1.0023.97

4101 C LEU 433 106.758 27.446 37.464 1.0027.11

4102 O LEU 433 107.051 28.078 38.483 1.0028.11

4103 CB LEU 433 107.057 28.298 35.126 1.0024.53

4104 CG LEU 433 106.721 29.754 35.473 1.0028.30

4105 CD1 LEU 433 107.968 30.488 35.945 1.0023.75

4106 CD2 LEU 433 106.108 30.456 34.265 1.0027.09

4107 H LEU 433 107.456 25.788 34.948 1.0025.00

4108 N GLU 434 105.667 26.698 37.360 1.0026.39

4109 CA GLU 434 104.690 26.566 38.429 1.0028.21

41 10 C GLU 434 105.393 26.139 39.723 1.0025.73

4111 O GLU 434 105.159 26.711 40.790 1.0025.92

4112 CB GLU 434 103.656 25.510 38.027 1.0040.62

4113 CG GLU 434 102.371 25.510 38.835 1.0059.16

4114 CD GLU 434 101.447 26.650 38.457 1.0069.11

4115 OE1 GLU 434 101.135 26.803 37.255 1.0076.28

4116 OE2 GLU 434 101.026 27.391 39.366 1.0078..90

4117 H GLU 434 105.516 26.206 36.531 1.0025.00

4118 N ALA 435 106.272 25.147 39.614 1.0023.71

4119 CA ALA 435 107.015 24.632 40.764 1.0021.25

4120 C ALA 435 107.915 25.704 41.377 1.0021.57

4121 O ALA 435 107.973 25.864 42.599 1.0021.94

4122 CB ALA 435 107.838 23.424 40.353 1.0017.11

4123 H ALA 435 106.427 24.748 38.737 1.0025.00

4124 N SER 436 108.603 26.448 40.519 1.0020.07

4125 CA SER 436 109.486 27.510 40.969 1.0021.72

4126 C SER 436 108.676 28.531 41.759 1.0023.51

4127 O SER 436 109.095 28.979 42.832 1.0025.11

4128 CB SER 436 110.147 28.179 39.765 1.0021.38

4129 OG SER 436 111.040 29.196 40.173 1.0036.67

4130 H SER 436 108.521 26.272 39.556 1.0025.00

4131 HG SER 436 110.568 29.867 40.669 1.0025.00

4132 N VAL 437 107.501 28.876 41.235 1.0023.94

4133 CA VAL 437 106.622 29.846 41.880 1.0018.07

4134 C VAL 437 106.134 29.330 43.226 1.0019.00

4135 O VAL 437 106.179 30.048 44.227 1.0024.40

4136 CB VAL 437 105.410 30.192 40.990 1.0022.63

4137 CG1 VAL 437 104.498 31.163 41.709 1.0024.13

4138 CG2 VAL 437 105.879 30.794 39.677 1.0013.85

4139 H VAL 437 107.218 28.463 40.391 1.0025.00

4140 N ILE 438 105.693 28.076 43.249 1.0022.97

4141 CA ILE 438 105.204 27.443 44.472 1.0025.17

4142 C ILE 438 106.279 27.478 45.566 1.0027.56

4143 O ILE 438 105.996 27.831 46.718 1.0025.37

4144 CB ILE 438 104.776 25.975 44.200 1.0028.36

4145 CG1 ILE 438 103.565 25.952 43.262 1.0033.63

4146 CG2 ILE 438 104.457 25.255 45.505 1.0031.72

4147 CD1 ILE 438 103.130 24.569 42.836 1.0033.54

4148 H ILE 438 105.697 27.559 42.417 1.0025.00

4149 N ILE 439 107.512 27.134 45.196 1.0027.24

4150 CA ILE 439 108.635 27.130 46.135 1.0024.88

4151 C ILE 439 108.769 28.502 46.787 1.0020.20 4152 0 ILE 439 108.842 28.610 48.007 1.00 20.39

4153 CB ILE 439 109.961 26.739 45.429 1.00 23.09

4154 CG1 ILE 439 109.915 25.264 45.023 1.00 21.73

4155 CG2 ILE 439 1 11.154 26.989 46.345 1.00 17.14

4156 CD1 ILE 439 110.984 24.859 44.043 1.00 22.40

4157 H ILE 439 107.670 26.870 44.265 1.00 25.00

4158 N CYS 440 108.763 29.552 45.974 1.00 21.23

4159 CA CYS 440 108.873 30.901 46.508 1.00 23.58

4160 C CYS 440 107.718 31.209 47.458 1.00 27.42

4161 0 CYS 440 107.933 31.707 48.563 1.00 29.41

4162 CB CYS 440 108.897 31.928 45.376 1.00 26.26

4163 SG CYS 440 109.015 33.625 45.934 1.00 17.39

4164 H CYS 440 108.685 29.406 45.006 1.00 25.00

4165 N ARG 441 106.502 30.869 47.038 1.00 30.12

4166 CA ARG 441 105.295 31.118 47.825 1.00 28.33

4167 C ARG 4441 105.280 30.448 49.197 1.00 28.78

4168 O ARG 441 105.225 31.125 50.223 1.00 28.38

4169 CB ARG 441 104.056 30.693 47.031 1.00 26.28

4170 CG ARG 441 102.722 30.927 47.734 1.00 26.09

4171 CD ARG 441 102.312 32.391 47.725 1.00 32.68

4172 NE ARG 441 103.001 33.195 48.731 1.00 35.67

4173 CZ ARG 441 103.243 34.499 48.611 1.00 31.42

4174 NH1 ARG 441 102.861 35.159 47.526 1.00 25.83

4175 NH2 ARG 441 103.851 35.153 49.591 1.00 32.87

4176 H ARG 441 106.413 30.429 46.165 1.00 25.00

4177 HE ARG 441 103.307 32.748 49.547 1.00 25.00

4178 1HH1 ARG 441 102.391 34.678 46.792 1.00 25.00

4179 2HH1 ARG 441 103.043 36.138 47.443 1.00 25.00

4180 1HH2 ARG 441 104.133 34.668 50.417 1.00 25.00

4181 2HH2 ARG 441 104.032 36.133 49.498 1.00 25.00

4182 N VAL 442 105.329 29.120 49.220 1.00 28.03

4183 CA VAL 442 105.289 28.392 50.484 1.00 29.35

4184 C VAL 442 106.443 28.708 51.430 1.00 29.48

4185 O VAL 442 106.248 28.754 52.644 1.00 30.67

4186 CB VAL 442 105.171 26.864 50.272 1.00 28.34

4187 CG1 VAL 442 103.906 26.546 49.489 1.00 20.42

4188 CG2 VAL 442 106.394 26.322 49.562 1.00 28.17

4189 H VAL 442 105.405 28.625 48.376 1.00 25.00

4190 N ILE 443 107.635 28.941 50.885 1.00 32.67

4191 CA ILE 443 108.788 29.266 51.722 1.00 32.60

4192 C ILE 443 108.619 30.6722 52.283 1.00 34.90

4193 O ILE 443 108.866 30.908 53.469 1.00 33.18

4194 CB ILE 443 110.134 29.150 50.955 1.00 34.36

4195 CG1 ILE 443 110.394 27.689 50.574 1.00 27.67

4196 CG2 ILE 443 111.290 29.649 51.822 1.00 28.68

4197 CD1 ILE 443 110.456 26.745 51.765 1.00 31.24

4198 H ILE 443 107.746 28.891 49.910 1.00 25.00

4199 N ASP 444 108.170 31.599 51.441 1.00 33.84

4200 CA ASP 444 107.954 32.968 51.889 1.00 35.72

4201 C ASP 444 106.935 32.959 53.023 1.00 38.14

4202 0 ASP 444 107.184 33.520 54.091 1.00 37.60

4203 CB ASP 444 107.450 33.848 50.744 1.00 39.61 4204 CG ASP 444 107.110 35.260 51.199 1.0048.15

4205 0D11 ASP 444 105.972 35.485 51.667 1.0051.59

4206 0D2 ASP 444 107.980 36.147 51.091 1.0051.59

4207 H A ASSPP 444 107.985 31.364 50.507 1.0025.00

4208 N AASSPP 445 105.812 32.279 52.803 1.0040.33

4209 CA AASSPP 445 104.749 32.199 53.803 1.0039.63

4210 C AASSPP 445 105.221 31.599 55.124 1.0036.43

4211 0 AASSPP 445 104.826 32.060 56.195 1.0038.68

4212 CB AASSPP 445 103.549 31.415 53.259 1.0034.74

4213 CG AASSPP 445 102.867 32.115 52.087 1.0037.47

4214 0D1 AASSPP 445 103.173 33.301 51.818 1.0032.84

4215 OD2 ASP 445 102.022 31.474 51.429 1.0034.75

4216 H ASP 445 105.694 31.823 51.945 1.0025.00

4217 N T THHRR 446 106.061 30.574 55.047 1.0036.21

4218 CA TTHHRR 446 106.586 29.933 56.247 1.0034.20

4219 C TTHHRR 446 107.469 30.902 57.034 1.0034.56

4220 0 TTHHRR 446 107.396 30.968 58.259 1.0036.69

4221 CB TTHHRR 446 107.398 28.674 55.890 1.0029.80

4222 OG1 THR 446 106.545 27.735 55.227 1.0031.60

4223 CG2 THR 446 107.970 28.029 57.136 1.0031.33

4224 H T THHRR 446 106.322 30.221 54.170 1.0025.00

4225 HG1 TTHHRR 446 107.041 26.946 54.992 1.0025.00

4226 N AALLAA 447 108.266 31.687 56.318 1.0039.84

4227 CA AALLAA 447 109.172 32.644 56.941 1.0042.07

4228 C AALLAA 447 108.495 33.902 57.483 1.0045.04

4229 0 AALLAA 447 108.675 34.259 58.647 1.0048.71

4230 CB AALLAA 447 110.2776 33.025 55.959 1.0036.91

4231 H AALLAA 447 108.237 31.624 55.337 1.0025.00

4232 N TTHHRR 448 107.708 34.565 56.644 1.0050.59

4233 CA TTHHRR 448 107.036 35.799 57.039 1.0049.97

4234 C TTHHRR 448 105.729 35.644 57.818 1.0051.43

4235 0 TTHHRR 448 105.100 36.646 58.159 1.0056.61

4236 CB TTHHRR 448 106.790 36.715 55.811 1.0047.11

4237 OG1 TTHHRR 448 106.095 35.986 54.793 1.0050.09

4238 CG2 THR 448 108.106 37.214 55.245 1.0047.36

4239 H THR 448 107.555 34.230 55.741 1.0025.00

4240 HG1 T THHRR 448 105.951 36.556 54.034 1.0025.00

4241 N TTYYRR 449 105.352 34.415 58.157 1.0051.91

4242 CA TTYYRR 449 104.103 34.182 58.881 1.0053.63

4243 C TTYYRR 449 103.927 35.020 60.148 1.0058.13

4244 0 TTYYRR 449 102.939 35.745 60.282 1.0057.88

4245 CB TTYYRR 449 103.926 32.696 59.218 1.0050.75

4246 CG TTYYRR 449 102.674 32.406 60.025 1.0055.96

4247 CD1 TTYYRR 449 101.419 32.856 59.596 1.0060.14

4248 CD2 TYR 449 102.746 31.716 61.235 1.0056.00

4249 CE1 TYR 449 100.273 32.629 60.353 1.0055.79

4250 CE2 TYR 449 101.605 31.483 62.000 1.0057.85

4251 CZ T TYYRR 449 100.375 31.943 61.554 1.0060.06

4252 OH TTYYRR 449 99.250 31.724 62.316 1.0061.67

4253 H TTYYRR 449 105.912 33.653 57.905 1.0025.00

4254 HH TTYYRR 449 98.487 32.104 61.878 1.0025.00

4255 N GGLLUU 450 104.883 34.927 61.067 1.0064.21

4 k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4 4k 4 4 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4 k 4k 4k 4 4k 4k 4 k k k k 4k

U U U U U U U U K>rS) N) N) N) I N) N NI N) M MN M N) N) N) Uls) N)

-""poooo(θ(oωp(oφ(o_(θ(o_mocβα)CBcβωcβB i ssssN sso)θ)ffi

^ e M o θ (θ C vi ca tn ^ eo ιo o θ (θ θo vi en cn S eo ro o o (θ c vi cn cΛ 4k eo M θ (D C vi cn ( 4k co ι o co ∞ ooozxxooooozco_J^xzoooo OOOOOO

> >>WCθCΛtocoCΛωωr-r-r-r-r-r-r^ π ^^Λ^^^^ΛwwωwMωωwωwWMωCCCCCCCCCCr-r-r-r--r-ι-r-r-ccccCCCC

4k 4k 4 4 4k k 4 4— 4k 4k 4— 4 ^ k ^ 4k 4k 4 4 4 4k 4 k k 4 4k 4 4 4k 4k 4k 4 4k 4 4k 4 4k 4k 4 4k 4k 4k 4k 4k 4 4k 4 4 4 4 4k 4 en en cΛ eΛ p cn p cn e p eΛ CΛ cn cn cn oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι cn oι oι en c_n cΛ tn CΛ eΛ CΛ eΛ 4 4k 4 4k 4k 4k 4k 4k Co ω eo co eo e e e co e co co c M M M M ro ιo ro M M M o _k _k _ _ _ _ _ 00 (0 (0 (00 (0 (0 (0 (00 (0 (000 o o o O O O O O O O O o o o o o o o o o o o ou ou vi UooJ uco. o v V1l vVl| C_O_ C_O O1_1 C„O C_O O_ 2 o o co ro eo eo ro o ro co en -vi cn en co 12 — Cn CΛ CΛ 4k 4k 4k C0 Cn tO 4k 4k p co oo en ro co oi en eo eo o vi oo o o k oi O o co cn o oo 4k 4k co o eo 4k cn cn co co ro o oo cn co S eo oo eo oo oo ro oD fo p vi cn oo en to co cp , o cD o vviioorrooccoo ooooooooo rji ro oi to o oo ro cn co o -k

co όό ro o o oi co co vi co co vi o eo O v| vi to k cn vi cn ro o oi o ro eo -k v| -k O -k CO OO CO Oθ 4k O

4308 CB ARG 455 100.892 43.025 59.891 1.00 86.51

4309 CG ARG 455 102.319 43.493 60.014 1.00 89.64

4310 CD ARG 455 102.926 43.581 58.632 1.00 98.07

4311 NE ARG 455 104.296 44.078 58.647 1.00109.66

4312 CZ ARG 455 104.976 44.415 57.555 1.001 14.68

4313 NH1 ARG 455 104.411 44.309 56.357 1.001 17.44

4314 NH2 ARG 455 106.220 44.863 57.659 1.001 13.39

4315 H ARG 455 100.816 41 .007 61.542 1.00 25.00

4316 HE ARG 455 104.745 44.172 59.512 1.00 25.00

4317 1 HH1 ARG 455 103.471 43.978 56.270 1.00 25.00

4318 2HH1 ARG 455 104.920 44.568 55.536 1.00 25.00

4319 1 HH2 ARG 455 106.646 44.949 58.558 1.00 25.00

4320 2HH2 ARG 455 105.724 45.120 56.834 1.00 25.00

4321 N GLY 456 97.980 41.773 61.259 1.00 90.67

4322 CA GLY 456 96.566 41.584 60.989 1.00 90.27

4323 C GLY 456 96.256 40.876 59.681 1.00 91.84

4324 0 GLY 456 95.087 40.636 59.371 1.00 90.99

4325 H GLY 456 98.464 41.081 61.752 1.00 25.00

4326 N GLN 457 97.290 40.528 58.917 1.00 92.16

4327 CA GLN 457 97.107 39.842 57.638 1.00 90.85

4328 C GLN 457 96.662 38.395 57.846 1.00 89.74

4329 0 GLN 457 97.442 37.462 57.659 1.00 92.66

4330 CB GLN 457 98.402 39.868 56.817 1.00 89.90

4331 CG GLN 457 98.905 41.257 56.457 1.00 95.19

4332 CD GLN 457 100.145 41.221 55.576 1.00 99.21

4333 0E1 GLN 457 100.325 40.303 54.775 1.00102.27

4334 NE2 GLN 457 101.002 42.225 55.718 1.00 97.71

4335 H GLN 457 98.199 40.716 59.228 1.00 25.00

4336 1 HE2 GLN 457 101.798 42.200 55.151 1.00 25.00

4337 2HE2 GLN 457 100.809 42.931 56.364 1.00 25.00

4338 N ILE 458 95.397 38.207 58.209 1.00 88.19

4339 CA I ILLEE 458 94.859 36.867 58.439 1.00 82.29

4340 C I ILLEE 458 94.715 36.043 57.159 1.00 75.34

4341 0 I ILLEE 458 94.305 34.887 57.205 1.00 73.69

4342 CB I ILLEE 458 93.510 36.907 59.199 1.00 85.78

4343 CG1 I ILLEE 458 92.566 37.933 58.562 1.00 86.17

43444 CG2 I ILLEE 458 93.751 37.191 60.681 1.00 85.33

4345 CD1 I ILLEE 458 91.240 38.069 59.277 1.00 89.41

4346 H I ILLEE 458 94.823 38.995 58.338 1.00 25.00

4347 N A ALLAA 459 95.077 36.632 56.025 1.00 68.80

4348 CA A ALLAA 459 95.007 35.936 54.747 1.00 62.63 4349 C A ALLAA 459 96.368 35.324 54.389 1.00 62.33 4 4335500 0 A ALLAA 459 96.664 35.093 53.216 1.00 62.33

4351 CB ALA 459 94.549 36.893 53.653 1.00 62.28

4352 H ALA 459 95.387 37.554 56.036 1.00 25.00

4353 N THR 460 97.210 35.097 55.396 1.00 59.27

4354 CA THR 460 98.531 34.513 55.170 1.00 57.11

4355 C THR 460 98.424 33.034 54.826 1.00 53.62 4356 O THR 460 97.587 32.319 55.383 1.00 53.81

4357 CB THR 460 99.453 34.671 56.400 1.00 58.87

4358 OG1 THR 460 98.763 34.257 57.588 1.00 56.81

4359 CG2 THR 460 99.901 36.100 56.541 1.00 60.73 O

OO XOCOO

> mσoOcDOOO>ZX ωooDooo>zxcoooDo oo>zxomoooo tomoocσooo>zxoOoooooozxooozxx _OoOoCD > > o_k >>222222222 OO0O OOOO OOO000 Q 000FFFFFFFFF000O0HH OOO-H-HH-H- -HHH-HM ococn ωωtowco otnωωcccccccccc -<-<-<-<- TJ ;o

4 4k 4 4 4k 4k k 4k 4 4k 4k 4k 4 4k k k 4 k 4k 4 4k k 4k 4k 4k 4k 4k 4 4 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 k k 4k 4 4k 4 cococnen cncncni co en en en p i 0) 0) 0) 0) 0) Q) 0) 0) 0) en cn cnoo oo cn cn cn en en en cn cn cn en cn cn cn oo oo oo cn cn cn cn cn vivivicococnenenι s cn cn cn cn en Ol Ol 010l 4k 4k 4k 4k 4k co co coeoco eo co to eo co ro ro roro ro ro ro ro ιo o _ _k _ _ o o co co eo co co to co t0C0Cp(O(0(O(D(O(0(O(O(P(0(O(P(O(p(p(0(0(P(0 (C0θ ((0o o o CO 3) vl v| vj en co 4* en cn oo oo icΛ C c P cn - co - k CΛ θo c cn cn to bo io 4k in bo to c b c bvi co m o vic bo vi v| vi i oιc 4 too * co v| 4- o 00 v| CO o co o co ωc cn coco o 4k ro eo -vi oι -vi eo ooι eo eo o co eo co co o ro co o o oi ro 0 CΛ o v| vi C0 o 0000 o cΛ 4 eo vi ' c "n oo

cn o cn oo oo o oo ooo ro vi rocn eovi

o o

CΛ vi e

4412 0 ARG 467 90.406 24.901 58.295 1 .00 61.64

4413 CB ARG 467 91.270 28.089 58.642 1.00 69.59

4414 CG ARG 467 91.304 29.011 59.839 1.00 84.26

4415 CD ARG 467 90.397 30.202 59.616 1 .00 96.57

4416 NE ARG 467 90.163 30.938 60.853 1.00103.82

4417 CZ ARG 467 89.074 31.660 61.099 1.00107.61

4418 NH1 ARG 467 88.109 31.749 60.192 1.00108.04

4419 NH2 ARG 467 88.946 32.284 62.261 1.00109.38

4420 H ARG 467 93.769 27.556 58.623 1.00 25.00

4421 HE ARG 467 90.848 30.890 61.554 1.00 25.00

4422 1 HH1 ARG 467 88.194 31.273 59.318 1.00 25.00

4423 2HH1 ARG 467 87.293 32.293 60.390 1.00 25.00

4424 1 HH2 ARG 467 89.669 32.209 62.950 1.00 25.00

4425 2HH2 ARG 467 88.130 32.827 62.457 1.00 25.00

4426 N ASP 468 91.769 25.726 56.704 1.00 52.60

4427 CA ASP 468 91.287 24.832 55.660 1.00 51.80

4428 C ASP 468 91.404 23.354 56.032 1.00 52.54

4429 0 ASP 468 90.488 22.574 55.767 1.00 57.49

4430 CB ASP 468 92.026 25.111 54.346 1.00 49.09

4431 CG ASP 468 91.328 24.513 53.133 1.00 52.94

4432 0D1 ASP 468 90.127 24.170 53.218 1.00 55.18

4433 0D2 ASP 468 91.983 24.402 52.076 1.00 54.77

4434 H ASP 468 92.480 26.362 56.496 1.00 25.00

4435 N TYR 469 92.524 22.973 56.646 1.00 52.44

4436 CA TYR 469 92.755 21.581 57.040 1.00 49.37

4437 C TYR 469 92.458 21.283 58.511 1.00 48.25

4438 0 TYR 469 92.316 20.121 58.894 1.00 46.98

4439 CB TYR 469 94.200 21.165 56.730 1.00 46.99

4440 CG TYR 469 94.546 21.129 55.260 1.00 47.76

4441 CD1 TYR 469 94.994 22.273 54.602 1.00 51.80

4442 CD2 TYR 469 94.431 19.947 54.524 1.00 50.13

4443 CE1 TYR 469 95.317 22.246 53.248 1.00 56.40

'\ \ t\ '] CE2 TYR 469 94.753 19.908 53.167 1.00 54.09

4445 CZ TYR 469 95.195 21.063 52.537 1.00 57.04

4446 OH TYR 469 95.514 21.044 51.198 1.00 62.08

4447 H TYR 469 93.216 23.642 56.837 1.00 25.00

4448 HH TYR 469 95.802 21.916 50.922 1.00 25.00

4449 N GLY 470 92.371 22.328 59.328 1.00 49.37

4450 CA GLY 470 92.113 22.147 60.746 1.00 51.47

4451 C GLY 470 93.332 21.551 61.425 1.00 52.90

4452 0 GLY 470 93.247 20.499 62.064 1.00 54.39

4453 H GLY 470 92.471 23.228 58.968 1.00 25.00

4454 N ILE 471 94.467 22.238 61.300 1.00 53.10

4455 CA ILE 471 95.728 21.771 61.874 1.00 48.51

4456 C ILE 471 96.521 22.877 62.571 1.00 49.16

4457 0 ILE 471 96.230 24.063 62.408 1.00 48..02

4458 CB ILE 471 96.617 21.131 60.781 1.00 44.19

4459 CG1 ILE 471 96.816 22.116 59.621 1.00 43.37

4460 CG2 ILE 471 95.991 19.829 60.288 1.00 41.20

4461 CD1 ILE 471 97.608 21.558 58.449 1.00 38.24

4462 H ILE 471 94.452 23.094 60.822 1.00 25.00

4463 N SER 472 97.517 22.475 63.357 1.00 53.02 4464 CA SER 472 98.371 23.414 64.085 1.00 57.32

4465 C SER 472 99.352 24.1 17 63.146 1.00 60.76

4466 0 SER 472 99.689 23.587 62.084 1.00 61.94

4467 CB SER 472 99.148 22.672 65.180 1.00 59.87

4468 OG SER 472 99.873 21.568 64.653 1.00 59.66

4469 H SER 472 97.697 21.518 63.453 1.00 25.00

4470 HG SER 472 100.314 21.103 65.376 1.00 25.00

4471 N THR 473 99.838 25.287 63.557 1.00 61.86

4472 CA THR 473 100.794 26.053 62.755 1.00 63.28

4473 C THR 473 101.959 25.160 62.340 1.00 66.44

4474 0 THR 473 102.374 25.158 61.179 1.00 66.96

4475 CB THR 473 101.366 27.248 63.547 1.00 62.70

4476 0G1 THR 473 100.295 28.083 63.997 1.00 63.68

4477 CG2 THR 473 102.306 28.068 62.677 1.00 63.27

4478 H THR 473 99.529 25.654 64.404 1.00 25.00

4479 HG1 T THHRR 473 99.682 27.608 64.552 1.00 25.00

4480 N L LYYSS 474 102.454 24.380 63.296 1.00 65.27

4481 CA L LYYSS 474 103.568 23.470 63.065 1.00 67.87

4482 C L LYYSS 474 103.248 22.508 61.922 1.00 65.57

4483 0 L LYYSS 474 104.051 22.325 61.001 1.00 66.11

4484 CB LYS 474 103.863 22.686 64.349 1.00 71.33

4485 CG LYS 474 105.150 21.875 64.320 1.00 77.07

4486 CD LYS 474 105.422 21.234 65.673 1.00 77.42

4487 CE LYS 474 106.776 20.544 65.698 1.00 78.55

4488 NZ LYS 474 107.067 19.962 67.037 1.00 75.57

4489 H LYS 474 102.058 24.422 64.186 1.00 25.00

4490 1HZ LYS 474 106.336 19.263 67.278 1.00 25.00

4491 2HZ LYS 474 107.998 19.500 67.020 1.00 25.00

4492 3HZ LYS 474 107.070 20.720 67.750 1.00 25.00

4493 N GLU 475 102.047 21.944 61.960 1.00 61.44

4494 CA GLU 475 101.612 20.998 60.945 1.00 57.77

4495 C GLU 475 101.378 21.683 59.599 1.00 53.01

4496 0 GLU 475 101.623 21.091 58.545 1.00 55.03

4497 CB GLU 475 100.352 20.282 61.418 1.00 59.71

4498 CG GLU 475 100.104 18.950 60.737 1.00 73.81

4499 CD GLU 475 98.994 18.148 61.399 1.00 84.47

4500 OE1 GLU 475 98.562 18.513 62.518 1.00 88.32

4501 OE2 GLU 475 98.555 17.144 60.797 1.00 88.90

4502 H GLU 475 101.423 22.181 62.675 1.00 25.00

4503 N ALA 476 100.931 22.936 59.637 1.00 46.25

4504 CA ALA 476 100.681 23.703 58.420 1.00 43.91

4505 C ALA 476 102.003 23.972 57.712 1.00 44.05

4506 0 ALA 476 102.124 23.774 56.501 1.00 42.50

4507 CB ALA 476 99.984 25.018 58.749 1.00 34.16

4508 H ALA 4776 100.761 23.358 60.501 1.00 25.00

4509 N MET 477 103.000 24.402 58.480 1.00 45.42

4510 CA MET 477 104.321 24.689 57.932 1.00 46.57

4511 C MET 477 104.954 23.414 57.395 1.00 46.73

4512 0 MET 477 105.640 23.434 56.369 1.00 48.81

4513 CB MET 477 105.217 25.331 58.990 1.00 41.20

4514 CG MET 477 104.699 26.674 59.459 1.00 45.53

4515 SD MET 477 105.842 27.539 60.529 1.00 50.24 4516 CE MET 477 105.403 29.229 60.204 1.00 44.87

4517 H MET 477 102.838 24.531 59.436 1.00 25.00

4518 N ALA 478 104.689 22.301 58.071 1.00 43.88

4519 CA ALA 478 105.214 21.012 57.646 1.00 40.24

4520 C ALA 478 104.608 20.664 56.288 1.00 39.48

4521 O ALA 478 105.301 20.158 55.404 1.00 42.61

4522 CB ALA 478 104.887 19.941 58.673 1.00 38.44

4523 H ALA 478 104.140 22.350 58.883 1.00 25.00

4524 N LYS 479 103.324 20.969 56.113 1.00 37.41

4525 CA LYS 479 102.642 20.700 54.850 1.00 36.91

4526 C LYS 479 103.214 21.598 53.754 1.00 33.62

4527 O LYS 479 103.408 21.164 52.616 1.00 32.37

4528 CB LYS 479 101.136 20.931 54.986 1.00 39.38

4529 CG LYS 479 100.338 20.573 53.736 1.00 46.00

4530 CD LYS 479 98.850 20.797 53.947 1.00 51.63

4531 CE LYS 479 98.273 19.858 55.003 1.00 53.61

4532 NZ LYS 479 98.180 18.451 54.525 1.00 57.01

4533 H LYS 479 102.820 21.3777 56.852 1.00 25.00

4534 1 HZ LYS 479 99.126 18.106 54.269 1.00 25.00

4535 2HZ LYS 479 97.776 17.853 55.274 1.00 25.00

4536 3HZ LYS 479 97.561 18.416 53.688 1.00 25.00

4537 N PHE 480 103.502 22.845 54.107 1.00 30.92

4538 CA PHE 480 104.067 23.790 53.157 1.00 31.88

4539 C PHE 480 105.457 23.356 52.714 1.00 34.12

4540 O PHE 480 105.812 23.493 51.540 1.00 37.15

4541 CB PHE 480 104.107 25.198 53.749 1.00 29.35

4542 CG PHE 480 102.902 26.028 53.408 1.00 37.28

4543 CD1 PHE 480 101.662 25.427 53.190 1.00 37.60

4544 CD2 PHE 480 103.008 27.411 53.283 1.00 36.73

4545 CE1 PHE 480 100.546 26.192 52.850 1.00 36.20

4546 CE22 PHE 480 101.898 28.185 52.942 1.00 38.45

4547 CZ PHE 480 100.665 27.574 52.726 1.00 36.96

4548 H PHE 480 103.315 23.138 55.024 1.00 25.00

4549 N GLN 481 106.238 22.810 53.641 1.00 33.79

4550 CA GLN 481 107.573 22.352 53.292 1.00 35.43

4551 C GLN 481 107.453 21.180 52.323 1.00 35.55

4552 O GLN 481 108.200 21.103 51.347 1.00 35.63

4553 CB GLN 481 108.368 21.930 54.524 1.00 46.60

4554 CG GLN 481 109.844 21.688 54.210 1.00 70.92

4555 CD GLN 481 110.583 20.933 55.302 1.00 83.38

4556 OE1 GLN 481 110.036 20.658 56.371 1.00 93.92

4557 NE2 GLN 481 111.836 20.588 55.032 1.00 88.62

4558 H GLN 481 105.919 22.723 54.562 1.00 25.00

4559 1HE2 GLN 481 112.316 20.105 55.735 1.00 25.00

4560 2HE2 GLN 481 112.220 20.824 54.166 1.00 25.00

4561 N ASN 482 106.486 20.297 52.561 1.00 33.51

4562 CA ASN 482 106.272 19.146 51.682 1.00 36.28

4563 C ASN 482 105.950 19.606 50.267 1.00 36.07

4564 O ASN 482 106.380 18.989 49.288 1.00 35.83

4565 CB ASN 482 105.140 18.252 52.200 1.00 40.65

4566 CG ASN 482 105.535 17.465 53.436 1.00 54.20

4567 OD1 ASN 482 106.698 17.095 53.607 1.00 57.37 4k

4 k k 4k 4 4k k k k 4 4 4k 4 4 4k 4k 4 4k 4 4_ 4k 4k 4 4-.4k 4k 4 4 4 4 4k k 4 4 4k 4 4 4k 4 4k 4k 4k 4 k 4 4k 4 en en en en en cn enenincnen cn enencn en cnen enen eΛ cn eΛ eΛ cn en cΛ en eΛeΛ cn oi oi oioi oi oioi oi oi oi oi oi cn cΛ en cΛ CΛ c^ o o o o o o p OOOO(0(0(O e0C0(O(0(0(D(000CnCa03<pC00000000 vi vi vl vlvl viv|vl v| vl c00 Cn

CO 00 -v| O0 Ol 4k C t O (O 00 v| OO Ol 4k e r o o (θ oo vi c oι 4k co ro o eo oovi oo oι 4k eo ro o o to oo vi c en 4kco ro o co oo

IOO OZXX OOO OZXOO O OOOZXOO Z X OC O OO Z ro o ;r z

OoOoOoCDooo>; ro CD > oo Oro o m > mro mo o o co > co > mσotD > xx σ α O ro ro ro H

7373737373737373 I ζ >|HΪΪHΪHHΪΪHΪHHΪHΪ r !:!: prP Pζ>ζ>>ζ>>ζζ_m_m22mm2_m_mπ2ιm_m_>w>ω>>n TJTJTJTJTJTJTJTJ ' 7J737JΛΛ )Λ3)^CCCCCCCCC > > >HHHHHHHHH2--2Z

4k 4k 4k 4k 4k 4 4 4k 4k 4k 4 4 4k 4 4k 4k 4 k 4 4k 4 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k k 4k 4k 4k 4 4k k 4k 4 oo oo∞ co es poooco oooo co oo cn ∞ p cβ cs ∞ ca ό csόo eoo ooeoo ∞ csoo ∞oovi vi vi vi vi vico cn cn cn enσϊ cn cncn oOOOOOOOOOOOOOOOOOOOOO

4k tθ (θ (θ c oo o cooo en 4 θo ro eo cn cn 4k θι c 4k en o co e o vi c _ooo o _ r .o - c _o o -o ( _Dc -o 4.k oo ro ooo o cΛ oo co oi vl o p oo ccoo vviiιιoo ocxo) rroo vvii vvii oooo oooo oooo o 4k ooco co cn ιo o oo eo

vi 4k eo co cooo oo cn co cD cooo oo 4 -k θ — θ — to en oo en ro ro ro ro o — roro io ro ro ro ro fo ro o _ _ _ _ _ _ _ ro ro ro ro ro ro ro ιo ro ro ro ro ro to ro to o o ro o ro ιo o o coeo o ooroo __ _-. o - p _ vivi poo e oo ρ vi c ρ ro p o ^ ro ro o o o ro o _ _ o vi oo O vl cointoiΛ 4k! intov| i ocoωiobtoi roinbiovibio „toto4kio∞ 4kpinv|vi vicocoo vito to iobi virocntnbo 4k ro co o o to p Sotejno toσ CΛ o en oo o co cn . o - — - .. _ eo ' 5roien)θenoo Λ O CO v| CΛ CΛ v| 4k O vicn eo roo viωvi*jθ(θr\)(ocoω i-^scncnoi(θ-k(θ-o en co cn 8 4kiooooc ooe vϊ

(O CO C CO v| oo ro enco ro 4k en oi 4k o o cn co en vi o oo co oo en 4k 4k .t k 4 4 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k C tn cnOl k 4k k 4k 4k 4k 4k 4k 4k 4 Ol 4 4 4k 4k 4k 4 en

4- oo υi 4- o r too eeoo 44kk oi k o C CO 4k OO vi 4k vl l CO 4k cΛen coco o __ o eo oo vi oooo co co αo vi oo oo o oo(o tD co oo oo oo o k 4k ro vivi )b ) , to | j b Jk i b b bvj _ M ω ωb k) c o cc5cnv4c ooeneΛpcΛM4ke 'Λ- o —oo - ~c- p -~ o - -vi cώorroo44kkθ 4_ v| -_ccovvjicwoecoo ooccoorrooecnnoooovvji 44k_c'o- oco vi 4?o c roco4 2_ tenncncn to ro to oo o o -o ro(θ o __ ror o $k θ co vj o eo vi to co cn 4_ to vi(o cΛ co ro cooι ro oi co co ro cΛco co co vi ro oo co

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooσooooooooooooooooooooooooooooooooooooooooooo o _ ro o roto oroM o _k _k _Λ roroMtoω eoroMMrotocn vie (neocoιoMM MMM roMMroeoeo ω ∞ (θθ _ coo (D oe e en cβ(θ oCΛ eΛ vi o o 4 4k cn n en _ e (θ o orooo (Dvi tnoen vj n 4k CΛ e vi ro M vi to e oι c^ en eo vi ro 4k p oO OC04k CO COO O vi __ cn ovi oι oι o to oo ro vio cn cnro o vi-- roco io o oo 4k θo en eo co co oo o o o eoencocoviro ^o ooocncoroeooo(o-k vi - o - o -o en o cn eo vi v|o C0(0CΛ0C0 C0 t0 vl 4k 0 vi rθ CΛ OO o O o 4k θ O O 2

4620 NE1 TRP 488 1 13.723 23.801 46.376 1.00 21.34

4621 CE2 TRP 488 114.441 23.869 45.210 1 .00 17.70

4622 CE3 TRP 488 114.793 22.507 43.237 1.00 18.03

4623 CZ2 TRP 488 1 15.305 24.863 44.736 1.00 16.71

4624 CZ3 TRP 488 115.654 23.499 42.765 1.00 15.24

4625 CH2 TRP 488 115.899 24.659 43.515 1 .00 14.14

4626 H TRP 488 110.109 20.905 45.009 1.00 25.00

4627 HE1 TRP 488 113.699 24.482 47.075 1.00 25.00

4628 N LYS 489 111.136 18.399 43.138 1.00 21.51

4629 CA LYS 489 111.162 17.175 42.345 1.00 17.89

4630 C LYS 489 110.604 17.476 40.961 1.00 19.66

4631 0 LYS 489 111.091 16.947 39.960 1.00 22.89

4632 CB LYS 489 110.351 16.069 43.019 1.00 17.77

4633 CG LYS 489 110.922 15.624 44.344 1.00 15.98

4634 CD LYS 489 110.074 14.540 44.972 1.00 22.31

4635 CE LYS 489 110.525 14.254 46.392 1.00 24.45

4636 NZ LYS 489 109.694 13.199 47.029 1.00 26.46

4637 H LYS 489 110.589 18.443 43.952 1.00 25.00

4638 1 HZ LYS 489 108.703 13.510 47.052 1.00 25.00

4639 2HZ LYS 489 109.772 12.320 46.482 1.00 25.00

4640 3HZ LYS 489 110.028 13.037 47.997 1.00 25.00

4641 N ASP 490 109.590 18.338 40.906 1.00 20.77

4642 CA ASP 490 108.991 18.721 39.630 1.00 21.97

4643 C ASP 490 110.008 19.479 38.786 1.00 24.19

4644 0 ASP 490 110.098 19.264 37.575 1.00 21.17

4645 CB ASP 490 107.739 19.585 39.837 1.00 26.18

4646 CG ASP 490 106.561 18.799 40.395 1.00 29.44

4647 0D1 ASSP 490 106.524 17.562 40.236 1.00 35.64

4648 0D2 ASP 490 105.657 19.425 40.982 1.00 29.87

4649 H ASP 490 109.245 18.731 41.736 1.00 25.00

4650 N ILE 491 110.776 20.362 39.419 1.00 20.68

4651 CA ILE 491 111.789 21.120 38.692 1.00 20.37

4652 C ILE 491 112.810 20.146 38.115 1.00 19.25

4653 0 ILE 491 113.158 20.221 36.934 1.00 20.39

4654 CB ILE 491 112.508 22.153 39.595 1.00 22.00

4655 CG1 ILE 491 111.540 23.278 39.975 1.00 21.39

4656 CG2 ILE 491 113.737 22.716 38.877 1.00 21.00

4657 CD1 ILE 491 112.159 24.376 40.803 1.00 22.99

4658 H ILE 491 110.657 20.508 40.379 1.00 25.00

4659 N ASN 492 113.239 19.198 38.943 1.00 19.07

4660 CA ASN 492 114.216 18.196 38.529 1.00 18.67

4661 C ASN 492 113.700 17.404 37.332 1.00 20.34

4662 0 ASN 492 114.446 17.133 36.393 1.00 20.40

4663 CB ASN 492 114.567 17.271 39.699 1.00 16.62

4664 CG ASN 492 115.269 18.007 40.839 1.00 18.56

4665 0D1 ASN 492 115.924 19.035 40.625 1.00 15.51

4666 ND2 ASN 492 115.140 17.484 42.050 1.00 15.73

4667 H ASN 492 112.899 19.181 39.862 1.00 25.00

4668 1 HD2 ASN 492 115.583 17.939 42.793 1.00 25.00

4669 2HD2 ASN 492 114.613 16.661 42.164 1.00 25.00

4670 N GLU 493 112.412 17.073 37.341 1.00 21.12

4671 CA GLU 493 111.816 16.341 36.225 1.00 22.19 4.

4 4k 4k 4k 4k4k 4k4k 4k 4k4k 4k 4 4k4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k k k 4k 4 4k 4k 4k 4 4k 4k 4 4 4k 4 k 4k 4k 4 4 k 4 4k 4 4k k vi vi vj vi vi vi vi vivi vi vi vi vi vivi v| vi vi vi vi vi v| vi vi enen en cn (n cn en en cn en en cn en o) cn cn (n cn cn oo cn c co c ro M ro ro M o _k _ _ _ _ _k _k __ _kθ o oo o p o o o o _ _ (θ(θ (θ _ (θ (θ (θ (θ _ ca c oo oo ρ oo oo oo coo vi vi vi v^ e ιooocoeviooc 4keo Moocoe vienen 4ke ιooo(oe-o( eΛ4 eoM o ocooo vicnoo 4kCoro o _ co " oo vicnoι 4k co ro

01

OOOZro-i!^-.XXZZOZ OOOOZX OOOO X0000000

> iiiim X XN ΓΠO OCD > O O CD > x x x x ro o o _k α tO o o o > ooozxooooooo > m to m o o o cα ro to o _..

TJ TJ "D "U > > > > > > > > > > > > > > > > > ΓT Γ Γ Γ Γ Γ Γ Γ Γ Γ Γ Γ Γ Γ Γ Γ Γ (V (OVOOOOOOOOOOO 73737377373 37373 37373 37 73737377 ^^^^^^^^^^^^^^^(^^^r-r- i—r-r-r-r-r-r-r-r-r-r- oooooooooooooooooooooccc ccc c c -<-< -<-<-<cccccccc

4k 4k 4k 4k 4k 4 4k k 4 4k 4_ 4_ k 4k 4, ^ 4k k 4k 4 4k 4k 4— k 4k 4k 4 4k 4k k 4-.4 4k 4 4k 4k 4k 4 4 4k 4 4k 4k 4k 4k k 4 4k

(O (0 (O (O(0(O (O(O(OΦ(0 (0 (O(O(0 (O(O(O (O(0 (0 φCPφ(0 φ CO Φ φ φ(D (O(O (0 (0 (O(0 (OΦ C ( 00 ( v| vj v| vlv| v| vi v| v| vlvl v| v| v| vi vl vi cn _ u0 u0 0 u0u000u001010101010.

_ _ _ ro o _ _ _k _ _ ro o _ _k _k v| vlO04k O0 Ol -v| θ0 θl O0 p vl 4k en cn _-. (o oo oo (0 (o oo o(O cD co vi co 4k 4k 4k en cn vi b vib v| o _k cn o o o i g o v|4k c_o o_i e_o oo en cofo 4 o co co vii

S v| eD CDp o θO vl ft) .. ._

p oo k. c ro tn o vic CΛ o ρp 4 Co cn pι ro o co en oo cooo co co k enc 4k to eoooo cn vi 4k co o en o co o (o oo cn o 4k c co o co o o en en ro roro to ro ro ro rororo ro ro ro roro ro ro ro ro ro ro co eo ω co eo c o eo co co eo eo eo eo co eo eo eo eo co co co co co vienenenen4kviooeΛeoeΛvio)envivi viooviooeoeoeo 4-coroo _o e o_ eroo cSo co co co co co Scot)iS- ropcop foco j^ enoo oo vi vi vioo co 4k

SeΛ 00 vlCΛ v| v|O)Cp en vi b o 4k 4 vi _ cn roto entocΛ b 4kto cB 4k 4k n coc i k cn o _ vi vi vi c>3C M ω o j)ro vi enω Mcn ^ c ocen (θθ (Λ vic o o en oo o o cΛ (θ (p r o *. (o vi cn co cooo-v|o cnoocnenvi cn vJc c oc o _ co _c v4e4k _ ooe (ocoo _ coco ocDθc vi cn v| viMc 4k _ cDθcoooo cocΛ

oooooooooooooooooooooooooooooooooooooooooooooooooooo ooooooooooooooooooooooooo co coco eo Mto MroM roen 4k tn tncoco co M coeo ro roro ro to to 4k enencneΛe cno oo o o ioo ovi roo cotΛ θ o c io 4k O 4k OO OOO OCncn v| C0vlcp binb o kbe toi oi 4k cn en oo ooo o en ro ro ovi 4_ enenearo c oc oo

4.

4k 4k 4k 4k 4 4k 4 k 4k 4 4k 4k 4k 4 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4k 4k 4k 4 4k 4k 4 4k 4k 4k 4 4k 4 4k 4 4 4k 4k 4k 4 4k 4k 4k vlNvl l S vl l l i l l iN vl J l N lvl l i J l vl lvl vl l l vl l vlvl i l l l l l N v| v| vj v| vi vi en enen en cn ρco en( en eneΛ CΛ en e eΛ eΛ CΛ eΛCΛ 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k eo eo c c eo co c eo e co ro M en 4k eo ro o _ vic c -^ω t o o (o c_ vi cncΛ k ω ro o o co c vi cn cn k ω ro o co oo vi oo oι 4k oooozooo CD o D

O O H H H H -H H H H H _0 -O CΛω ωCOCO CO < < < < < < < < TJ TJ TJ TJ TJ TJ TJ H H H H H H H H H TJ TJ TJ rrrrrrrriιiιiιιιιιnnιmπιπιιτιπιm>>>)>>>>>jjojΛ?JΛΛ7iιιιιιιιιιJiΛ3

Cn CΛ CΛ CΛ CΛ CΛ CΛ CΛ CΛ CΛ Cn Cn l Ol 01 Ol Ol Ol OI Ol 1 Ol Ol Ol Ol I Ol Ol Ol Ol Ol Ol Ol Ol Ol Ol Ol O1 Ol Ol 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k 4k

Sppp ppppoooooooooooooooαooσoooo ooooooooo tocoto cDco coco co co cD co to 4k 4k 4^ 4k 4k 4k 4kCOC eo C COCθeotO CO M to ror t N3 M M o _ _ _ _ _ _ _ o θ O O O O O CO CO CO CO tO c) C^ _ _ _ _ _ _ „ _k --k _k _

ω 5tnetδc ooj_o,oiso)evion Q5o cono ecovv]iθen)θe)ωceoooMe eωΦenocno oi en ω

ro ro ro ro ro ro ro ro ro ro co roro coro ro ro 4k cncncn(θoo oo vivi cnooo oo o(-o oo vi K 2 B MviIvOjMcnMcoM4 or Mvi4kcIO NvJjcIooroor4okf4O enentoQocnvi--co4k 2 to CO v| O CO Ol in io to cococnmco vi to o ro p o vip ovjtoooencoc eocCΛncωo4k'-oeneDviroeoroooK5ω p cn o S co co vi v| o _ oo o eo oo to v| co oo co 4k e viooo vioovioencn4k4k 4_ θDθ co vi en 4k 00o ro ro vi en

ooo ooooooooooooooooooooooooooooooooooooooooooooooooo ooo ooooooooooooooooooooooooooooooooooooooooooooooooo

4k 4k 4k coMeocoroMro4keneocococoMMtoeΛeococoeocoM ioroMcotoco co ιoMM coco coeoMroto ιoM to vi 4 r eo o _ 4cneΛθ o coo roo ω cop o oi 4k ro ω pp 4k en ω ω p ro ρ (θ 4k ro o ro 4k p o o ω 4^ o CO 4k _ vi!pk ωtobbbbvi __ toro o b b in eΛ iΛ b io iΛ bto o biΛ r to vi bvi co to ω oo cn vi eoo Mcn o co o en (o o eo o eo eno oro^ vjcn o eno oeo4k oro io4k o en o _ 4_ _ cn o o co 4k CD cn o oo o en en co

.

4k 4 4 4k 4 4 4k 4k 4k 4k 4k 4 4k 4k 4k 4k 4k 4k 4 4k 4 4k 4k 4 4k 4k 4 4k 4 4 4k 4 4k 4 4k 4 4k 4k 4k 4k k 4k 4k 4k k 4 k 4 4 k ωαc-ωcoooooωcoooco coooα-oooα oo ooωmω MtO MMM Mrθo __ _k _* _k _k _k _k _k _k O θ σ θθ p θO OO (0 (O CO CO CD CO (O CO (O CD OO OO OO CO OO p OO ∞ Cn vien eΛ k e M oo(θoovi eneΛ eo to o o (θoo vientn e M o θ (o e vi cn cΛ 4 C M o o co oo vi n c 4k ooozxoooooooz OOOOZXOOOOOOO

> OOOCD > oooooo XXOO O CD > OOCD > ooocα > xo Nomomooooooocoooo >zxo o ro o o ro o ro o to r ro

cnenoioioioioioioioioioioioi k _k __ o O O OO OO O O O g eneneΛeΛcncΛeΛeΛtΛCΛeΛeΛcncneΛcnenenenencncnenenCΛCΛenenenenenoitntnenenen o _ oooooooooopooooopoσoooooooooooooooooo

O OO O t0 _ (0(0(0(D(0 (0{D0000000000 C000 v| v| v| v| vl v| vlv| vien cn cn en en en en en tn cn oι oι oι oι oι oι oι oι oι 4k 4k _k _. — _. -. _k ro u ϋi ap

totoboboiobi vicn coenooocooo vico roo4kcovitooviovi4kcnc_coocovicocooenroo(03McnoocoiovicooitoocotnvitDCoeo4 4kkoOoO vlOO O CCO O OO -k t

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

Mo._kroιoMor orooroMo_-._roo_k__rororoιoMroι rororoMo oorororjw ω oprorop ro roo^ r vi pρωroρo_k^pp vi-k po ppcβoooocaro4kcovic

So4kcooe_ en4kM4kco-oeoviroroNoc otooo4 vic vicDooor-,Mtovioocoro o en bvi k oiobιrovi eoeΛ4kθ(θvioenoeneooιoιoιcoeo_eoenooMenviviMvioSrovio4kθooo o ω o ro co cooorovi4k oroo oo coo

4828 CB LEU 510 116.693 26.064 37.454 1.00 18.99

4829 CG LEU 510 1 17.747 25.351 38.309 1.00 17.88

4830 CD1 LEU 510 117.092 24.447 39.347 1.00 13.70

4831 CD2 LEU 510 118.660 24.548 37.401 1.00 12.82

4832 H LEU 510 115.234 27.670 36.174 1.00 25.00

4833 N ASN 511 117.070 28.966 38.502 1 .00 16.84

4834 CA ASN 511 1 17.816 29.940 39.293 1.00 18.52

4835 C ASN 511 116.918 30.774 40.185 1.00 19.49

4836 O ASN 511 117.299 31.111 41.307 1 .00 21.10

4837 CB ASN 511 118.704 30.806 38.400 1.00 14.99

4838 CG ASN 511 119.926 30.046 37.903 1.00 19.61

4839 OD1 ASN 511 120.276 29.004 38.456 1.00 22.94

4840 ND2 ASN 511 120.562 30.543 36.849 1.00 17.54

4841 H ASN 511 117.040 29.059 37.540 1.00 25.00

4842 1 HD2 ASN 511 121.341 30.052 36.532 1.00 25.00

4843 2HD2 ASN 511 120.230 31.364 36.438 1.00 25.00

4844 N LEU 512 115.705 31.061 39.719 1.00 18.46

4845 CA LEU 512 114.751 31.814 40.527 1.00 15.00

4846 C LEU 512 114.415 31.007 41.778 1.00 16.15

4847 O LEU 512 114.304 31.561 42.872 1.00 24.00

4848 CB LEU 512 113.484 32.114 39.727 1.00 17.19

4849 CG LEU 5112 113.569 33.341 38.818 1.00 16.79

4850 CD1 LEU 512 112.331 33.430 37.943 1.00 22.39

4851 CD2 LEU 512 113.702 34.591 39.672 1.00 14.37

4852 H LEU 512 115.450 30.773 38.817 1.00 25.00

4853 N ALA 513 114.279 29.692 41.624 1.00 19.31

4854 CA ALA 513 113.979 28.814 42.760 1.00 18.01

4855 C ALA 513 115.178 28.789 43.710 1.00 18.19

4856 O ALA 513 115.017 28.802 44.933 1.00 16.94

4857 CB ALA 513 113.654 27.403 42.274 1.00 12.64

4858 H ALA 513 114.362 29.302 40.726 1.00 25.00

4859 N ARG 514 116.381 28.767 43.140 1.00 19.70

4860 CA ARG 514 117.609 28.763 43.934 1.00 18.80

4861 C ARG 514 117.696 30.031 44.784 1.00 17.46 4862 O ARG 514 118.041 29.978 45.967 1.00 21.48

4863 CB ARG 514 118.832 28.638 43.024 1.00 13.68

4864 CG ARG 514 118.981 27.255 42.404 1.00 14.32

4865 CD ARG 514 120.084 27.218 41.354 1.00 17.33

4866 NE ARG 514 120.490 25.848 41.066 1.00 16.97

4867 CZ ARG 514 121.107 25.453 39.958 1.00 19.03

4868 NH1 ARG 514 121.398 26.320 38.998 1.00 15.08

4869 NH2 ARG 514 121.450 24.180 39-.821 1.00 15.36

4870 H ARG 514 116.440 28.744 42.160 1.00 25.00

4871 HE ARG 514 120.282 25.180 41.738 1.00 25.00

4872 1HH1 ARG 514 121.159 27.283 39.100 1.00 25.00

4873 2HH1 ARG 514 121.862 26.006 38.170 1.00 25.00

4874 1 HH2 ARG 514 121.245 23.5244 40.547 1.00 25.00

4875 2HH2 ARG 514 121.913 23.875 38.988 1.00 25.00

4876 N ILE 515 117.330 31.164 44.196 1.00 20.52

4877 CA ILE 515 117.352 32.438 44.911 1.00 22.89

4878 C ILE 515 116.489 32.357 46.169 1.00 25.55

4879 O ILE 515 116.851 32.914 47.206 1.00 28.26 4880 CB ILE 515 116.863 33.591 44.018 1.00 18.86

4881 CG1 ILE 515 1 17.857 33.824 42.883 1.00 18.35

4882 CG2 ILE 515 1 16.695 34.855 44.832 1.00 23.30

4883 CD1 ILE 515 1 17.408 34.863 41.885 1.00 19.17

4884 H ILE 515 117.045 31.141 43.257 1.00 25.00

4885 N VAL 516 115.372 31.637 46.082 1.00 27.24

4886 CA VAL 516 114.467 31.463 47.220 1.00 26.85

4887 C VAL 516 115.229 30.838 48.378 1.00 30.63

4888 0 VAL 516 115.219 31.354 49.496 1.00 28.87

4889 CB VAL 516 113.280 30.512 46.881 1.00 28.84

4890 CG1 VAL 516 112.433 30.248 48.122 1.00 23.42

4891 CG2 VAL 516 112.423 31.096 45.776 1.00 22.08

4892 H VAL 516 115.144 31.219 45.225 1.00 25.00

4893 N GLU 517 115.910 29.736 48.085 1.00 35.61

4894 CA GLU 517 116.680 28.997 49.081 1.00 41.24

4895 C GLU 517 117.696 29.890 49.796 1.00 42.08

4896 0 GLU 517 117.872 29.789 51.009 1.00 46.37

4897 CB GLU 517 117.385 27.802 48.424 1.00 41.58

4898 CG GLU 517 116.496 26.950 47.503 1.00 52.96

4899 CD GLU 517 115.344 26.242 48.223 1.00 59.58

4900 0E1 GLU 517 115.593 25.557 49.236 1.00 60.41

4901 0E2 GLU 517 114.187 26.352 47.762 1.00 63.04

4902 H GLU 517 115.899 29.407 47.161 1.00 25.00

4903 N VAL 518 118.314 30.799 49.050 1.00 40.18

4904 CA VAL 518 119.310 31.714 49.600 1.00 42.32

4905 C VAL 518 118.704 32.885 50.386 1.00 47.45

4906 0 VAL 518 119.269 33.326 51.389 1.00 48.49

4907 CB VAL 518 120.219 32.251 48.474 1.00 41.14

4908 CG1 VAL 518 121.133 33.350 48.986 1.00 39.83

4909 CG2 VAL 518 121.034 31.108 47.896 1.00 45.30

4910 H VAL 518 118.097 30.844 48.095 1.00 25.00

4911 N THR 519 117.563 33.387 49.923 1.00 45.49

4912 CA THR 519 116.899 34.505 50.577 1.00 44.49

4913 C THR 519 116.183 34.117 51.884 1.00 44.03

4914 0 THR 519 115.983 34.964 52.754 1.00 41.48

4915 CB THR 519 115.868 35.165 49.622 1.00 45.40

4916 0G1 THR 519 116.518 35.516 48.394 1.00 47.45

4917 CG2 THR 519 115.283 36.424 50.240 1.00 50.81

4918 H THR 519 117.161 32.996 49.123 1.00 25.00

4919 HG1 THR 519 116.872 34.719 47.980 1.00 25.00

4920 N TYR 520 115.827 32.843 52.034 1.00 49.74

4921 CA TYR 520 115.130 32.385 53.240 1.00 54.71

4922 C TYR 520 115.783 31.213 53.984 1.00 60.58

4923 0 TYR 520 115.129 30.191 54.209 1.00 65.16

4924 CB TYR 520 113.686 31.988 52.905 1.00 52.58

4925 CG TYR 520 112.886 33.018 52.142 1.00 53.27

4926 CD1 TYR 520 112.885 33.027 50.748 1.00 54.77

4927 CD2 TYR 520 112.105 33.962 52.809 1.00 50.10

4928 CE1 TYR 520 112.127 33.946 50.032 1.00 57.50

4929 CE2 TYR 520 111.340 34.889 52.102 1.00 54.19

4930 CZ TYR 520 111.357 34.873 50.713 1.00 56.86

4931 OH TYR 520 110.604 35.777 49.999 1.00 58.70 4932 H TYR 520 116.029 32.189 51.330 1.0025.00

4933 HH TYR 520 110.726 35.626 49.057 1.0025.00

4934 N ILE 521 117.056 31.340 54.350 1.0067.35

4935 CA ILE 521 117.729 30.269 55.091 1.0074.89

4936 C ILE 521 117.425 30.428 56.583 1.0075.44

4937 0 ILE 521 117.194 29.397 57.255 1.0076.20

4938 CB ILE 521 119.276 30.258 54.856 1.0075.70

4939 CG1 ILE 521 119.586 29.919 53.394 1.0076.18

4940 CG2 ILE 521 119.953 29.222 55.766 1.0077.50

4941 CD1 ILE 521 121.064 29.755 53.080 1.0071.61

4942 H ILE 521 117.546 32.156 54.145 1.0025.00

4943 N VAL 533 120.428 39.967 55.248 1.0055.02

4944 CA VAL 533 120.478 38.584 54.683 1.0057.02

4945 C VAL 533 121.277 38.505 53.373 1.0055.80

4946 O VAL 533 122.075 37.588 53.181 1.0056.73

4947 CB VAL 533 119.048 37.995 54.485 1.0056.30

4948 CG1 VAL 533 118.225 38.868 53.539 1.0056.90

4949 CG2 VAL 533 119.125 36.552 53.986 1.0050.74

4950 1 H VAL 533 119.970 40.608 54.578 1.0025.00

4951 2H VAL 533 119.880 39.938 56.132 1.0025.00

4952 3H VAL 533 121.396 40.274 55.462 1.0025.00

4953 N LEU 534 121.095 39.483 52.491 1.0049.61

4954 CA LEU 534 121.812 39.490 51.218 1.0048.50

4955 C LEU 534 123.194 40.138 51.300 1.0047.52

4956 O LEU 534 124.075 39.830 50.496 1.0044.98

4957 CB LEU 534 120.983 40.190 50.137 1.0048.86

4958 CG LEU 534 119.659 39.533 49.744 1.0050.00

4959 CD1 LEU 534 119.054 40.290 48.567 1.0046.00

4960 CD2 LEU 534 119.886 38.066 49.384 1.0042.36

4961 H LEU 534 120.456 40.200 52.652 1.0025.00

4962 N LYS 535 123.382 40.993 52.303 1.0045.93

4963 CA LYS 535 124.633 41.722 52.510 1.0045.11

4964 C LYS 535 125.921 40.923 52.284 1.0043.08

4965 O LYS 535 126.729 41.288 51.428 1.0042.36

4966 CB LYS 535 124.651 42.385 53.895 1.0046.19

4967 CG LYS 535 125.855 43.288 54.130 1.0054.44

4968 CD LYS 535 125.868 43.868 55.536 1.0057.76

4969 CE LYS 535 127.075 44.774 55.747 1.0061.61

4970 NZ LYS 535 127.099 45.378 57.111 1.0062.66

4971 H LYS 535 122.651 41.156 52.915 1.0025.00

4972 1HZ LYS 535 127.134 44.621 57.824 1.0025.00

4973 2HZ LYS 535 127.936 45.986 57.207 1.0025.00

4974 3HZ LYS 535 126.239 45.946 57.252 1.0025.00

4975 N PRO 536 126.115 39.809 53.019 1.0039.15

4976 CA PRO 536 127.337 39.020 52.829 1.0037.51

4977 C PRO 536 127.564 38.579 51.386 1.0033.92

4978 O PRO 536 128.684 38.644 50.877 1.0033.28

4979 CB PRO 536 127.128 37.827 53.770 1.0038.16

4980 CG PRO 536 125.638 37.724 53.893 1.0042.17

4981 CD PRO 536 125.233 39.164 54.008 1.0038.53

4982 N HIS 537 126.488 38.181 50.714 1.0033.98

4983 CA HIS 537 126.575 37.730 49.327 1.0034.56

eΛ CΛe en en cΛ CΛ eΛt eΛeΛ eΛ en cΛ e CΛ eΛ en en e e en cΛ e eΛ θi en en en eΛ e en en en enen 4k 4k 4k 4k 4k k 4 4k 4k 4k 4 4 4k 4 4 4

OOO O O O O OOOO OOOO O O O O OO O O O O OO O O O O OO O OO CO CO CO IO CD CD CD CO CO CO CD CO CO CO CO CO eopC eθC -O MMMMMMMrθMMo __ _k _ _ _ _ __ _ oθOOO pOO OO _ (0 (0(O COCO CO CO CO COOOC_

CΛ k w r o θ (o ∞-i cncn 4 ωro o o (o c vi oo c 4k ω ιo o o _ cvi cn cΛ 4k C M o o co m -o cn c^ oozxooooooozroo --oooooo zxo ZXOOOOOOO XXXZOOZOO OOCD > XX OOOCD > OoOooooo OO

> O OCD > O OO CD > ro o O O ro o o ro o o ro m roo— m rom oσo oocD ro ro mm mmmmm mmmwω ω| ||| mmmmmm xxxxxxxxxxx

p (Λ (Λ C CΛen cΛeneneΛ eΛ C eΛ eΛeΛ eΛ CΛ <Λ (Λ CΛ eΛ eΛ eΛ tΛθioι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι oι en en en tn en en en en en

^^ k 4k 4k 4k 4k k4k k 4- 4 4k 4k 4 4 4k 4 4 4k4k 4k C _OC _ C -OC _OC _OC _ ω _ _ _ -. - _ _ - _ - _ _ _ - CO CO CO CO CO CO CO CO CO to ro to O O O O O O O O O O O (O (O (0 (O (O (0 (O C0 (53 Cβ C Cn Cβ 00 C C C v| vi v| v| v| v| v| v| vi vl vl

4k4 4 k4 k4k CO tO tO CO tO CO CO CO C CO CO pp ω ω 4k 4k i i vi p _ _ ...-... _.c... _- . o —o co . O 4k io to bι v| vi co b vi bo vi o co o r .o- eo o ro co oo o 4k en vi — vi nooenroviooco oo o CΛ en o _- roco _orvoicooooooeΛcooooviccooococeooooocooroo enoc oovitoocoor_okooo ro oo co ro oi CD 00 CΛ CO 4 Ol O0 Cn -k 4k vi

4k 4k 0l 4k O1 O1 Ol OI 01 Ol 0l 4 _k -4_k- 4_k- 4_k- 4_k- 4_k- 4 4k 4k4 4k k 4k ienenenen k en 4

4- J4kfc* c„oc_oo- φcoooor_oo WeooJ -ι - p OO OO tO CO CO ∞ vl vl CO CO vl vl OO o O o O o cO O CO OO vI CO

CO

— torotocncoentoo — roinbb vi k-k o4 incorototoibb4k vioto4kviώ4kc eo oioenooovjcnto cocQo (0 cnvi "o "oo 'oe n 4.koocnc _oo-.o_ r.o- toooooencnoι orooo vico en co rocoenoenvJooco(oeootoo ooencn(oco keoeooien4kco cocoencnoroc 'o - c -o o ~ c —Dt -o- 4k CO CO 2 O CO VI OO CO O CO O

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO

4keocororoeococoeoeococoMtotoeo4kcococoeoeocoMeocoeocococoeocoMCococococoeocoeoMMMco4kω t (ocncn(Oooi4kocooocnoioicncn(ococo4kCococn4kioco o4kp4kpcn4kvicnppoi4kpoioi ovip — ^ 4k to"oωtoinfototob totootobtoovib^iobbcnrωω4kvitovibωv^ (ocneooeoen4kMviencocnooooovieoeneno_ oeoenvito4kOooo(ocn(ncocoo(nroenoooenccocvi--cnoi

5036 0 LEU 542 131.361 44.614 44.055 1.00 45.28

5037 CB LEU 542 128.721 43.258 43.921 1.00 37.88

5038 CG LEU 542 127.685 42.494 43.105 1.00 37.82

5039 CD1 LEU 542 126.275 42.902 43.505 1.00 37.78

5040 CD2 LEU 542 127.947 42.728 41.619 1.00 33.54

5041 H LEU 542 129.525 41.317 45.569 1.00 25.00

5042 N VAL 543 131.590 43.264 45.822 1.00 40.06

5043 CA VAL 543 132.536 44.167 46.483 1.00 39.62

5044 C VAL 543 133.960 43.601 46.457 1.00 40.35

5045 O VAL 543 134.834 44.117 45.766 1.00 36.40

5046 CB VAL 543 132.112 44.458 47.951 1.00 38.67

5047 CG1 VAL 543 133.154 45.323 48.643 1.00 41.60

5048 CG2 VAL 543 130.762 45.137 47.966 1.00 33.55

5049 H VAL 543 131.348 42.421 46.245 1.00 25.00

5050 N ASP 544 134.175 42.518 47.191 1.00 39.19

5051 CA ASP 544 135.485 41.887 47.274 1.00 37.12

5052 C ASP 544 135.802 40.970 46.112 1.00 38.65

5053 O ASP 544 134.991 40.124 45.739 1.00 42.40

5054 CB ASP 544 135.609 41.070 48.566 1.00 37.00

5055 CG ASP 544 135.384 41.894 49.812 1.00 42.35

5056 OD1 ASP 544 135.659 43.114 49.803 1.00 49.35

5057 OD2 ASP 544 134.933 41.304 50.813 1.00 50.35

5058 H ASP 544 133.427 42.119 47.665 1.00 25.00

5059 N SER 545 136.984 41.153 45.543 1.00 36.71

5060 CA SER 545 137.444 40.303 44.464 1.00 39.73

5061 C SER 545 138.200 39.158 45.142 1.00 38.96

5062 O SER 545 138.585 39.269 46.310 1.00 40.93

5063 CB SER 545 138.379 41.084 43.540 1.00 43.38

5064 OG SER 545 139.362 41.790 44.280 1.00 51.44

5065 H SER 545 137.544 41.896 45.832 1.00 25.00

5066 HG SER 545 139.870 41.166 44.808 1.00 25.00

5067 N ILE 546 138.377 38.046 44.442 1.00 36.92

5068 CA ILE 546 139.109 36.920 45.011 1.00 40.59

5069 C ILE 546 140.602 37.261 44.954 1.00 45.93

5070 O ILE 546 141.117 37.620 43.889 1.00 46.41

5071 CB ILE 546 138.839 35.612 44.226 1.00 36.34

5072 CG1 ILE 546 137.346 35.288 44.264 1.00 34.10

5073 CG2 ILE 546 139.629 34.456 44.829 1.00 31.04

5074 CD1 ILE 546 136.979 34.011 43.525 1.00 36.46

5075 H ILE 546 138.009 37.990 43.533 1.00 25.00

5076 N LYS 547 141.282 37.201 46.009 1.00 52.49

5077 CA LYS 547 142.706 37.502 46.134 1.00 58.52

5078 C LYS 547 143.483 36.450 45.353 1.00 60.95

5079 O LYS 547 143.488 35.273 45.713 1.00 60.42

5080 CB LYS 547 143.217 37.599 47.572 1.00 59.36

5081 CG LYS 547 144.684 38.023 47.659 1.00 68.28

5082 CD LYS 547 145.065 38.553 49.037 1.00 72.08

5083 CE LYS 547 146.486 39.105 49.029 1.00 74.86

5084 NZ LYS 547 146.796 39.880 50.265 1.00 78.47

5085 H LYS 547 140.806 36.948 46.910 1.00 25.00

5086 1HZ LYS 547 146.680 39.273 51.099 1.00 25.00

5087 2HZ LYS 547 147.770 40.240 50.222 1.00 25.00 5088 3 HZ LYS 547 146.139 40.685 50.334 1.00 25.00

5089 N ILE 548 144.086 36.890 44.254 1.00 67.72

5090 CA ILE 548 144.868 36.018 43.381 1.00 76.79

5091 C ILE 548 146.198 35.622 44.025 1.00 83.68

5092 0 ILE 548 146.583 34.440 43.897 1.00 86.24

5093 CB ILE 548 145.120 36.678 41.986 1.00 75.68

5094 CG1 ILE 548 145.604 38.125 42.152 1.00 78.47

5095 CG2 ILE 548 143.855 36.623 41.137 1.00 68.49

5096 CD1 ILE 548 145.930 38.827 40.831 1.00 78.93

5097 OXT ILE 548 146.823 36.492 44.672 1.00 92.78

5098 H ILE 548 144.032 37.836 44.045 1.00 25.00

5099 ILE 548

5100 MG MG 851 104.185 36.235 53.030 1.00 61.83

5101 MG MG 852 102.138 43.657 49.009 1.00 62.23

5102 O HOH 601 107.742 22.057 32.406 1.00 15.11

5103 o HOH 602 122.540 22.695 37.531 1.00 32.44

5104 o HOH 603 127.188 14.109 43.835 1.00 23.85

5105 o HOH 604 123.257 32.177 37.651 1.00 25.21

5106 o HOH 605 131.975 36.814 38.945 1.00 20.08

5107 0 HOH 606 130.320 38.579 40.729 1.00 28.69

5108 O HOH 607 124.735 33.181 39.810 1.00 19.46

5109 O HOH 608 119.958 22.714 50.725 1.00 24.82

5110 o HOH 609 125.172 22.654 40.253 1.00 21.47

5111 o HOH 610 106.047 21.994 29.826 1.00 26.03

5112 o HOH 611 123.659 29.782 47.444 1.00 22.10

5113 o HOH 612 129.924 22.165 49.955 1.00 20.33

5114 o HOH 613 117.254 16..672 36.732 1.00 18.88

5115 o HOH 614 131.911 22.935 48.204 1.00 23.59

5116 o HOH 615 123.421 30.030 35.911 1.00 23.89

5117 o HOH 616 128.952 30.316 38.829 1.00 22.41

5118 o HOH 617 98.347 33.326 40.948 1.00 28.07

5119 o HOH 618 126.062 19.250 36.922 1.00 29.11

5120 o HOH 619 133.788 33.099 36.415 1.00 20.10

5121 o HOH 620 127.252 22.013 48.848 1.00 24.10

5122 o HOH 621 123.122 19.043 45.472 1.00 19.68

5123 o HOH 622 124.636 25.767 41.845 1.00 42.37

5124 o HOH 623 138.021 26.937 54.497 1.00 33.32

5125 o HOH 624 130.604 16.213 44.273 1.00 25.46

5126 o HOH 625 119.735 17.425 55.175 1.00 23.51

5127 o HOH 626 109.560 43.332 32.386 1.00 27.79

5128 o HOH 627 104.016 36.817 39.018 1.00 24.34

5129 O HOH 628 134.051 35.256 29.604 1.00 37.22

5130 O HOH 629 107.947 18.792 36.023 1.00 35.84

5131 o HOH 630 129.821 19.576 48.096 1.00 29.63

5132 o HOH 631 104.550 21.758 41.675 1.00 38.10

5133 o HOH 632 111.970 10.709 47.161 1.00 23.86

5134 o HOH 633 125.976 29.448 50.341 1.00 26.42

5135 O HOH 634 97.143 36.787 48.102 1.00 35.12

5136 O HOH 635 121.582 36.805 25.111 1.00 35.51

5137 o HOH 636 113.756 26.801 22.571 1.00 30.58

5138 o HOH 637 124.698 19.485 28.803 1.00 29.60

5139 o HOH 638 130.563 25.567 43.476 1.00 2Θ..93 cncΛcncncncΛcncncΛcncΛCΛCΛCΛCΛCΛCΛCΛCΛCΛCΛCΛCΛcncΛcncΛcncncncncΛCΛcncΛcncΛCΛCΛcncncncnc^ too(coe_cpe)oρc_ccα)v|vivjvivivivivjv|vicnencncnenpenencnencnoιoιoιoιpϋioιoιoi4k oθ(oeβvieneΛSe ι oo(θθoviooen4kc r oo(ocβvjo cΛ^eotooococvioeΛ^eoMoococ)oviσ)C 4kco

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO

encn cncncncncncncncnenooooooσoσocncnencnencnencnencncncncncncncncnencncnoocncncnpQo cocDcooex)cβpCDC)ocDθovivjv|vivivivivivivien(n(noocnpcnenencncnenc^ oe_oovi e 4-e ιooθ(oc_ v]cooi4ke Moθ(θθovie c ^e rooθ(oe3vic cni. eo to o CO 00 2v|2oo 2 αo to2ro2oo 4k co o o CO co Oo4kCOCθ4ktOo_ ro.ro_ _ro oo_ o co co . ro_ 4.k c_o o .ro_ e_o o_ rororo o _k to ro cooc_ o mo4kcncooooocorocnocΛcnorooo o orococΛθ oo co oo 22 oco oco oto -- _k_ -- cocoro o _> 4kco(oroiooovicoenooocnvicnoo 4k

4k _)v|0000oa)C0r04kvi oo ooo(Dcooviropropovi4k ovioocn orooopvitooioooo — o O v| vl vl toco 44kkOθoθrfooccoovviirroo44kkccoc_occooaeno∞ cntooovi_-.vi__coco o*.vicoto4k * v| o "vi p4kvioιroco

oovio4kvioieoo4kroroco4k rooocΛoeo4kθo_ θ vi ro oi oo en 2 CD ρcnroooocooι4kθ o CnO00SC0OO4 tD cn c 'n co to co co " o ~o eo 2 o ro ro o__cororooco_ rocoo roeoocoroorooioro o___coeoeoroo ro ovienc_vioviM0 viv|_ _o4k kpoenpe vivirop vito pvi rorotooovi 2 o viωtotoeiΛbbvit otoi i iobctoe vitoo oωM cnoocnvioo coo O viooooovir pcΛoc_ oovi_kpe eocD(θoo_k__oe roM4 ene e

0Λ10θ0oCt0o-vvil 44kktco0 Oo0o0oO roσ eneneΛeΛe e 4 enoro(oenocΛ4koe_o MeΛMcooeΛ(oe 4keoM4k oovvjjccoooo-vviiccnoctoottooo 2 oorooco

M -viMeMCΛ4C 4MkCeΛCenΛCc0)o0o4cnk4okoe(θθ4vk|4vkjCcOnMoι4okιCOCcθβeMoC(θΛC(OθCoOCoθ4_k4okecΛθCoOCvΛi4cokevoi4cnk4vki4ρkCoΛ4kecoeonCoΛCoOCvθieMoeθocθOovi4ok4ok4cok4kCcO^C r -4kocninoviceovj irocoeΛbbo orob4krovic roto ooc otovir cΛcoo^cD4k(ooco4-eΛCΛe o ktoene o kpr c coooco(oe v|oooc ι ρ

(Dθooι ιθMt ot (θvio coeΛtoco(θoeoeoe o(nvi ocnenvitoooen(oevi4kviσvi4-eΛotDenOT

oooooooooooooooooooooo ooooooooooooooσooooooooooooooo oo oo σo oo oooooooooooooooooooooooooooooooooooooooooooo coeocoeococoeoeororo rorororocororooco4kcoeo4kco eo eo ro eo 4 ococ _o- 4 rococooicoroco cnoooopιoopvico4kco oovi4ktoeorooιoroo(θviooo cn o oo to 4kk4 o-4 okr coor rnoc to kcorocorococo ko pp ωvi ρ ro4k r incotovi-kvitoininbo penocnooeo(oroooooo(oco 4k o — 4k totovitoo oi tototoocooOT oioroto ocn

O o 4k 4k o _k CO CΛ OO IO v| Jkrooooivicoooeocooo e ~n o __ co en tovitoencoeen-vi4kco4kroroo 4ktncococo4k —

4. i

o

cncn eΛ en eΛ eΛ eΛ eΛeΛ cnoioioi oi oi oi oioi oi oi oioioi oioioi oioi oi oi oi oi oi oi oioi oi oi oi oi oi oi oi oi oi oi oi oi en en en en t -OM - t -orO - MM MrOM t OMM rot M M M M Mr IO opcOCOCO CO ro ro ro ro ro IrOo rOM .ot MM roM IO M

4k 4k 4k 4k CO CO eO tOt .o_ roro o _k o _ _ _ o _ o_ o_ o- o_ o_ o- o_ o- o- co co co co co to to (o eotoo ocDθoviooen4_coroo ocooovicnoi4kcoιo θ(θoo vicocΛ4k eoroo oeooo viencn4k coro o θ(o co-vicn cΛ 4k toro

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO

xxxxxxxxxxx OOOO

xxxxOxOxOxOxOxOxOx vl v| v| S SS v| S S SSNv|Sv| Sv| v|v|S S v| SS vl vJ v|S vl N S S O)0) CDO) 0) CDO) CI)Cr)

4k 4k 4k co eo coeoeoω coeoeoeoM ro ro ro M Mro Mro o _k __ _k _k _k _ _ _ _ o o o o o ρ o o o o _ _ co co co co ω roo o(θ eo vi cn cn S c M oθ (θoo vi c eΛ 4k e r oo (o oovi en ϋi co to o θ (oco vi cn cΛ 4k C ι en 4k eo to co ro co go o 4 4k eoco cnen eo ro eΛ o o ro o o o 4k ro oro 4k co o o ro 4k θ o ro eo co ro o ro o ro co eo o co co ro o to to in co o vi cno oocoviororo4keocneoeno ooo(oeooo oto rooo 4k coto 4k to p p oo

O o O p CO C04k 4kCO C0004k Cn o oO C v| _k co eo cn en to o op cOCΛ O ro Pbi b ro o en — oo ωω rroo 44k-. oo oo v vj| vviiocΛι pco o enen o M vi co oo oo vi r vito Pooσ) vico oι o cp ro tp 4- oι o σo (θ _ 4 ro v,i o en to o

00 O 4k oo to oo o o tD4k Oiooivioororovito4_ __ coo)Coeorooroooo 4k CΛ

4k tO Oθ4k 4k c ~n co to en e "n~ vi ' 4k en eo co k o _k co o to 4k r r c c c o ro o o n en coo o ro o n o o vi oo oo tob b i o L to o 4k e'n OOO) 4kk 44-k 0o064k- ro en ro vi vi cn p o eo 4 2k vi vico oi o ro o rooo o co So ooo o 4k

Oi ro oι to ro co oi 4k 4k 4k 4k eo en co co oo ιo cnoDcn cocoooo co co ocnoicnco o rooo ω Cθ to 4k o CO vi Cθ 4k o co o vl v| co encn cn oi (p vi 4k o cn io oo ro coro ro oo

CO o θ OO CD -P. 01 00 0001 00 0θ 4k Ol 4k i ro

oooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooo o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o o

4 4 4k 4 4 4kOl4kCO 4kCOCO4kCO 4kCO 4kC 4kCnCOCOCOC04k C 4k 4k C 4k C0 C 4k 4k CO CO 4k CO 4k C04k Cθ 4k 4k CO CO CO CO C CO cn vi ro P ooro M toc_ co5 P vi oo ro co P cn Pcco cncΛ θo c_ co co o ro o vi coco co o to oi en o CΛ vi eo o o to o oop o p p co o _i. vio 4k eoco cocnvi _-, cn o vi 4ko eo ro cn co eocn cocn en o en iorocoooen o vi 4k to b vi bo to 4k b to 4k jsj o co cn io o to cn co -k 4k to co ro(θ eo cnto oo eΛ CeoMθo o o eΛ θoro (oco to o vi rooeorooo oo 4k 4k vi k to ro o co vi rO C0 Cn -v| v|l0 O 4k 00 O 4k

oioioioioioioioioioioi oioioioioi oioi oioioioioioioioioioioioioi oi oioioioi oioioioi oioi oi oioi oioi enen oi oien r lOM MMr M rOM tO IO M M MM MM M M M Mro r M M M MM rOM M rOM ro rotO tO M cθ(θ _ coωcoco cβcco_ m cococo _ | i vi i j vi viro cΛ 4 e Mo o(ocovicoe 4kCoroo (oc vic eΛ k c roo oωoovicneΛ 4 ω ι ooeoco vicn eΛ ^c ro O CO 00 vl CO Ol 4

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOOOOOOOO OOOOOOOOO

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx OXOXOXOXOXOIOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOIOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOX

vi v| vl vl vl vl v| vl vi vl vj v| v| v| vl v| vl -vj vl v| -vl v| vl vl v| vl v| v| -vi v| v| v| v| v| v| vj vj vj vi v| v| vj vj v| v| vl vl v| v| vl v| p CO CO tD CO OO ∞ OO Qp CO p OO OO OO OO vl vl v| v| vl vj vl v| vj .cncnenencnpcncncncncΛCΛencΛtn enen cΛ en en 4k 4k 4k 4k 4k

4k Co ro o c5co oo viS)en JS co ro oo cooo cn cn 4 eo to σ (o oovioo c k c oco e_ vi θ) e 4k eo ro o o co oo i oo o o _ ro co o _ r 4 o r Q o o __ _ jk co ro 4k θ e co oro 4k ro o o co o roeo ro ro o o o o o o cp

I. ro o . 4k ro to eo

CΛ cn oo ro oo co cncn cno -k virocoe —n o o oo oo cn vi k ω en v| o 4k ioocn co oo co roo v| vi co (o o 4k o o 4k co 4k <cn 4k co to oo io cp c r _ _ oco k _) Mc 4k oo4kcnc_ eoMoooorocnviMc)i4 Cor 4kcoo ro oo o _i. c _o c _o■ ( CO vl v| CO vl v| ^ 4 4- (04k Co pvic oi c ce ( ocn o M co eo en o cn vico e ^eo cD vi 4- 4k o o M co o (0 o • r roo ccoo vvii (oo o to o o en vjooen M e o oe 4 o envi co vico oocΛ θoθ (D θo coo o 4 o vi oo ro co o oo co o 4 4kk o_ rro0 cCo0 cC0 o tΛ 04k ro ro en eo co 4k ro ro eo — ro OO 4k o o _ cn cp ... o — 4 _k- c _n. r .o- r ,o r ,o_ . ro . to- 4 ,- .o_ t „o ro 4 c , — _ co cococoocDooeneo v| vl o to o co & o C eoO CeoO Oo 0o0o vvil CcOo ^en K 13eoo cn vi co 4k cn cocn oo eo to o ro o co c -o o o o co en co o

_r^-Λ._H__S„fefe^W^_P_?0.c_5Sc'.^." ',s'o5 v| 4k O CO O CO OO CO vl CΛ 4k rO OO 4k co vi oι co b o co o ro to 4k in b cn

∞ v| v| v] looro otp co oo ro en oocή o_k ooto oen o oiic oopc coo c cooc coo c ro roco oo oo o oi 4k ro co co en o co 'tD to o4k ro o vi cn coσoco ss o c σ o __ ρ eo en oi o oo o toco I. o en coc. -- .. o vi ro en o co o 2 ωcD vi vi o ro c ooi o oo vl o CD to o co ro ro ro k co c 4k CΛ cnco enco Nj co o cΛ 4k c t r cΛ 4k cn cp ro 4k 4k eo ro cn cp to 4k 4k --. r,o_ r 1o_ r ιo_ r ιo_ o _i■ 4-k- o_i■ 4--k- o_i■ c _nι i v| to o oorocotoroooococooovicDOOcototo o r -k . p p ω k pρ to ;*4ktD oι to(θ(θtooo(D o co oo eo v| -_ 8. ro_ .ro_ 4kθo cocn o ro σ)pcn oo ro o c cnroin vil- b _i. b_ i_n. to_■ to_. v ,i f .o ∞ vi kbo vi _ cn eo 4 coo cn v| p oo p vi o Co eeo cpocoro o j co k ω 4k co vi o ro co inroeo vic ccunni pupi puu pUJ o— p uoii ouii cuo rΓoM oUiI i■•-— CO IO CO " vi ro vi o ro en o en o ooii rroo cn o eo _eo_2k o oo oo eo ro to 2 σo co oi oi co

cn s CcOoooo ooooroo cnroooeooo oi cn vi o en vi oo to j

oooooooooooooooooooooooooooooooooooo o ooooooooooooooooooooooooooooooooooo oo o ooooooooooooooooooooo o o o o o o o o

4k 4k CΛ) (n 4k 4k O04k 4k CΛ4k CΛ C 4k 4k CΛ 4k C 4k 4k CΛ 4k CΛ 4k CΛ CΛ CO 4kCn4k 4k 4k CΛ CO 4k 4k 4k 4k C04k 4k Cθ 4k CO C04k CO CO 4 4k 4k p vic M 4k o _k _vicoe ( tn o ^ vi p p r ω op ωρωro vi r k θ en p p p co p eo ∞ o pp ik p o p b4kbo ioior i-4 oro 4 e vi b o k i 4k 4 _o iΛ i 4 tovi 4^ io b vi b ioio to bo vi 4k vi b 4k vl CO CO co eo vi cΛ enM 4ktoe coro (θvi e enoo σ) o o c vi c fooo co e vioo* Coo ϋi vi 4k __o coro co vi rocΛ o coro ooooo o co ro 4

OlOioioioioi oioioiOioi OioioioiOi ϋioiOioiOioiOi OiOioi Oioi oioioi oioi oioioi oioi oioi oioioi enencjienen cΛen en tn p pp p co p ppco eo co eocoeo coeo co eo co eoco eo co eo co eo coeoeo eo eocoeo co eoco coeo co eo co co co eo eo eo co co M k ^ k k ^ ^ ^c e e cot ω co eo co eo M t tθM r M M ro N3M o -_ _ _ _ _ _ _ _ _ o o o o o o o o o o (θ (θ (o ω vicnoι k co ι o(θθovi e cn kco M -- θ (θ oovi cnen 4 eo ro -kθ co{s vi <-θ ( 4k c o o o cD (o vi cn c^

OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO OOOOOOOOOOOO

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx OIOIOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOXOX OXOXOIOXOXOXOXOXOI

S ∞ C <03 CD00 C 00 C00 C0000 CO C (_ <-O C C_ C_ ^ S ^c eo coco e p ωe eo co ro M roM M M M j ι M o _A _k _k _k _ _ _ _ _kθ o o oo o o o o to co co co o eoro o — ( —oo -ovic _n e"n" S4k eeoMrooo oθ(_θ coovviiccnneeΛn44kk cc roo θ(ooovicnoι4 totoo ocoo vi cncn 4k co ro o _ co_ o-o vi . c _n e ..n 4k co o o co co o _k _ o o ro o o fo o o o - k cn 4k θιcoooovi eoro vicneo cnen 4k 4k oιtocn ιo cn 004k ro vi en p ro vi oo p oo ro o en o ro to to tn ro en eo oi to to v| . to 4k c -o k e_o ro- o_o $. o c en o jk o co (D θ oeo oeo cθ(θ co vi co eo vi o o co vii co o - co

co 4k o _ co ro ro k c - e k to ro to ro ro 4 • - -s

_ cβe vi M io vien _ jS n 4k tn v ,i v -i α _o. c _o vi to oo oo co

4k roωio vito _ b o _ c en e oo M to e oo o o en vi co coM c cD 4 . c _ o _o c oo 4k co oo o co o _k cooo o _kcn e o

vi eo o i o oι oo ccoo vvii cco vi vi ro en k co cn 4k 4k cρ po ro ro e cn 4k co eo 4k 4k to 4k 4k co ιo co ω co ro 4k to ro 4k 4k co 4k en cn 4k en co 4k co oo σ) to 4k ro ro ro en co en co ro co to co o co 4k 4k co oi co oro to vi oo cncn coeo oo(04k o 4k < CO 4k co ro eD vi oi eo co ro ro en to oo ocn co eo vi co co o vi vi αo co v| l_ covl co to rOrO Sp C v| 4k p vlO OCO CO(OtO(OO C00100010 Cn — UI U-.UU U- o co roro eo ro cD o co oo o en ocnooocovi ^ CO M r ui k

2 — o VI ^ — .o coco rovicoeneooepo c coo eo ' — . u > — * _ ' — i rooeo-vviioooo pc _ — — — — peoo cweo ιov ' o 4kiocnro 4kcoo 4kco cooi vicocn roro vi to ro cn co eo cn CΛ (n o co M o _ c o n cn vi cn o _ oo 4k 4k θo cβ en vi _ 5. ro cD θ vi o oo o _ oo to co o 4k ro o oo co

o ooo oo o oo o o o o o o o o o o o oooooooooo o oooooooooo o ooooooooooo o o oooooooooooooooooooooooooooooooooooooo o o oo o o o o o o o tocn cn έ c cncΛ 4kcn 4 cncn4kCΛcncn 4kCΛ4k CΛC CΛ4kOl 4k 4kOl4k 4k O0CΛCOCncn CΛ 4k 4kOlplCn 4k 4k cncn 4k 4k cncn 4k cn oι o o cn o cn oo eo(θ ιcoo cn vi 4- eo $ O vi oι opoo (o eo o pro p p p p p p 4k p o 4k 4k O Ol CO v| ro p p .tk p in 4k 4k Ol (O v| CO(OO0 vl 4k ro vi co ro co o k 4k vj ι tobo bvi b bb o 4k bo bo co vi ι io : i 4k in 4k cn b b bo 4 bo O o bι to S oo eo cn(θ θvioι cooo covi 24kio o to vi oo(0 vjro vi rooi ro 4k Oi co rooo oi oen oi vi _ co en cn o ro en 4k -vi vi oo co

5348 O HOH 847 112.522 3.225 51.067 1.00 62.24

5349 O HOH 848 1 16.588 33.059 17.286 1.00 51.54

5350 O HOH 849 121.984 13.530 21.831 1.00 59.69

5351 O HOH 850 121.351 34.646 19.580 1.00 63.69

5352 O HOH 853 119.444 26.300 52.657 1.00 48.12

5353 O HOH 854 119.223 18.972 28.280 1.00 43.53

5354 O HOH 855 109.476 29.077 61.498 1.00 46.95

5355 O HOH 856 96.378 36.846 50.773 1.00 37.88

5356 O HOH 857 96.918 46.467 51.605 1.00 69.73

5357 O HOH 858 97.861 35.983 32.096 1.00 48.71

5358 O HOH 859 105.582 44.217 22.626 1.00 52.96

5359 O HOH 860 111.207 54.577 33.852 1.00 44.86

5360 O HOH 861 106.475 45.773 50.620 1.00 52.70

5361 O HOH 862 136.750 45.222 40.123 1.00 53.92

5362 O HOH 863 134.438 43.600 31.414 1.00 51.51

5363 O HOH 864 147.130 24.676 49.884 1.00 42.49

5364 O HOH 865 126.425 22.757 59.405 1.00 54.25

5365 O HOH 866 135.514 7.098 48.245 1.00 59.13

5366 O HOH 867 114.942 1.622 48.125 1.00 56.08

5367 O HOH 868 119.740 -4.108 46.312 1.00 51.35

5368 O HOH 869 134.478 8.308 29.219 1.00 53.23

5369 O HOH 870 127.297 14.232 21.009 1.00 54.19

5370 O HOH 871 134.315 17.294 22.547 1.00 59.58

5371 O HOH 872 130.159 26.543 36.441 1.00 34.46 5372 O HOH 873 136.207 18.694 43.344 1.00 35.20 5373 O HOH 874 134.779 10.368 41.428 1.00 45.81 5374 O HOH 875 137.054 3.899 33.453 1.00 51.47 5375 O HOH 876 145.762 17.318 28.638 1.00 52.42 5376 O HOH 877 146.344 20.944 29.342 1.00 47.62

TABLE 12

Score = 167 bits (419), Expect = 5e-41

Identities = 88/270 (32%), Positives = 152/270 (55%), Gaps 5/2"O (1*

Query: 1 DRVVECYF ALGVYFEPQYSQARVMLVKTISMISIVDDTFDAYGTVKELEAYTDAIQRWD 60

DR+VECYF G+ Q++ AR+M+ K ++I+++DD +D YGT++ELE +TD I+RWD Sbjct: 316 DRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEQFTD IRRWD 375

Query: 61 I EIDR PDYMKISY AILDLYKDYEKELSSAGRSHIVCHAIERMKEVVRNYNVESTWFI 120

IN ID+LPDYM++ + A+ + D ++ +++ + - - Y VE+ WF Sbjct: 376 INSIDQLPDYMQLCFLA NNFVDDTSYDVMKEKGVNVIPYLRQSWVD ADKYMVEARWFY 435

Query: 121 EGYMPPVSEYLSNALATTTYYYLATTSYLGM-KSATEQDFE LSKNPKI EASVIICRVI 179

G+ P + EY N+ + + + T + + S T++ + L K ++ S + R+ Sbjct: 436 GGH PSLEEYLENSWQSISGPCMLTHIFFRVTDSFTKETVDSLY YHDLVRWSSFVLRLA 495

Query: 180 DDTATYEVEKSRGQIATGIECCMRDYGISTKEAMAKFQNMAETAWKDIN-EG LRPTPVS 238

DD T E SRG + ++C M DY S EA + + WK +N E + + +P Sbjct: 496 DDLGTSVEEVSRGDVPKSLQCYMSDYNASEAEARKHVKWLIAEVWKKMNAERVSKDSPFG 555

Query: 239 TEFLTPILNLARIVEVTYIHN DGY---THP 266

+F+ ++L R+ ++ Y HN DG+ HP Sbjct: 556 KDFIGCAVDLGRMAQLMY-HNGDGHGTQHP 584

TABLE 13

Score = 116 bits (289), Expect = le-25

Identities = 77/270 (28%), Positives = 126/270 (46%), Gaps = 6/270 (2%)

Query: 3 VAEVYFSSATFEP-EYSATRIAFTKIGCLQVLFDDMADIFAT DE KSFTEGVKRWDTS 61

V +++ FEP ++ R I L + DD+ D++ TLDEL+ FT-"- KRWDT Sb]Ct: 318 VESFFWAVGMFEPHQHGYQRKMAATIIVLATVIDDIYDVYGTLDELELFTDTFKRWDTES 377

Query: 62 LHEIPECMQTCFKVWFKLMEEVNND VKVQGRDMLAHIRKPWELYFNCYVQEREWLEAGY 121

+ +P MQ C+ + + D++K G L ++RK Y E +W +GY Sbjct: 378 ITRLPYYMQLCYWGVHNYISDAAYDILKEHGFFCLQYLRKSVVDLVEAYFHEAKWYHSGY 437

Query: 122 IPTFEEYLKTYAISVGLGPCTLQPILLMGELVKDD—VVEKVHYPSNMFELVSLSWRLTN 179

P+ -l-EYL ISV P + P D V++ ++ ++ L + RL +

Sbjct: 438 TPSLDEYLNIAKISVA-SPAIISPTYFTFANASHDTAVIDSLYQYHDILCLAGIILRLPD 496

Query: 180 DTKTYQAEKARGQQASGIACYMKDNPGATEEDAIKHICRWDRALKEASFEYFKPSNDIP 239

D T E ARG I CYMK+ A+EE+A++H+ ++ A K+ + P

Sbjct: 497 DLGTSYFELARGDVPKTIQCYMKET-NASEEEAVEHVKFLIREAWKDMN-TAIAAGYPFP 554

Query: 240 MGCKSFIFNLRLCVQIFYKFIDGYGIANEE 269

G + N+ Q Y DG+G+ + + Sbjct: 555 DGMVAGAANIGRVAQFIYLHGDGFGVQHSK 584

TABLE 14

Score = 120 bits (299), Expect = 6e-27

Identities = 70/272 (25%), Positives = 137/272 (49%) Gaos = 3/272 (1%)

Query: 2 RVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFDAYGTVKELEAYTDAIQRWDI 61

R VE Y W + FEP+-S++R+ KT + +++DD +D + T+ E++ T+ ++RWD+ Sbjct: 296 RHVEYYSWVVMCIFEPEFSESRIAFAKTAILCTVLDDLYDTHATLHEIKIMTEGVRRWDL 355

Query: 62 NEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHAIERMKE7VRNYNVESTWFIE 121

+ D LPDY+KI+++ 1- + E+ + -^ K + +Y E+ W Sbjct: 356 SLTDDLPDYIKIAFQFFFNTVNELIVEIVKRQGRDMTTIVKDCWKRYIESYLQEAEWIAT 415

Query: 122 GYMPPVSEYLSNALATTTYYYLATTSYLGM-KSATEQDFEWLSKNPKILEASVIICRVID 180

G++P +EY+ N +A++ L L + K + E + KIL+ + R+ D Sbjct: 416 GHIPTFNEYIKNGMASSGMCILNLNPLLLLDKLLPDNILEQIHSPSKILDLLELTGRIAD 475

Query: 181 DTATYEVEKSRGQIATGIECCMRDYGISTKE-AMAKFQNMAETAWKDINEGLLRPTPVST 239

D +E EK RG++A+ ++C M++ ST E A+ + + + ++ N ++ V Sbjct: 476 DLKDFEDEKERGEMASSLQCYMKENPESTVENALNHIKGILNRSLEEFNWEFMKQDSVPM 535

Query: 240 EFLTPILNLARIVEVTYIHNLDGYTHPEKVLK 271

N+ R ++ Y + DG +K +K Sbjct: 536 CCKKFTFNIGRGLQFIYKYR-DGLYISDKEVK 566

TABLE 15

Score = 221 bits (557), Expect = 4e-57 Identities = 120/283 (42%), Positives = 178/283 (62%) G ps = 6/283 (2%)

Query: 5 EFYFWMAAAISEPEFSGSRVAFTKIAILMTMLDDLYDTHGTLDQLKIFTEGVRR DVSLV 64

E YF A+ I EPEFS R +TK + +LDDLYD HG+LD LK+FTE V+RWD+SLV Sbjct: 589 EIYFSPASFIFEPEFSKCREVYTKTSNFTVILDDLYDAHGSLDDLKLFTESVKRWDLSLV 648

Query: 65 EGLPDFMKIAFEFWLKTSNELIAEAVKAQGQDMAAYIRKNAWERYLEAYLQDAE IATGH 124

+ +P MKI F + T N++ E + QG+D+ YI +N W+ LEAY -r+AEW + Sbjct: 649 DQMPQQMKICFVGFYNTFNDIAKEGRERQGRDVLGYI-QNVWKVQLEAYTKEAEWSEAKY 707

Query: 125 VPTFDEYLNNGTPNTGMCVLNLIPLLLMGEHLPIDILEQIFLPSRFHHLIELASRLVDDA 184

VP+F+EY+ N + + + + LI L GE L ++L +1 SRF L+ L RLV+D Sbjct: 708 VPSFNEYIENASVSIALGTWLIΞALFTGEVLTDEVLSKIDRESRFLQLMGLTGRLVNDT 767

Query: 185 RDFQAEKDHGDL-SCIECYLKDHPESTVEDALNHVNGLLGNCLLEMNWKFLKKQDSVPLS 243

+ +QAE+ G++ S I+CY+KDHP+ + E+AL HV ++ N L E+N +F+ -t- +P Sbjct: 768 KTYQAERGQGEVASAIQCYMKDHPKISEEEALQHVYSVMENALEELNREFV---NNKIPDI 825

Query: 244 CKKYSFHVLARΞIQFMYNQGDGFSISNKV-IKDQVQKVLIVPV 285

K+ F AR +Q Y QGDG ++S+ + IK+ V+ L PV Sbjct: 826 YKRLVFET-ARIMQLFYMQGDGLTLSHDMEIKEHVKNCLFQPV 867

Classifications
International ClassificationC12N15/82, C12N9/10, C12N15/09, C12R1/91, C12N9/00, C12Q1/25, C12N1/21, C12N1/15, C12N5/10, C12N9/12, C12N1/19, C12N9/88, A01H5/00, G01N33/68
Cooperative ClassificationC12N15/8243, C12N9/88, C12N9/00, C12N9/1085
European ClassificationC12N9/10E, C12N9/88, C12N15/82C4B, C12N9/00
Legal Events
DateCodeEventDescription
Mar 30, 2000ALDesignated countries for regional patents
Kind code of ref document: A2
Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG
Mar 30, 2000AKDesignated states
Kind code of ref document: A2
Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW
May 24, 2000121Ep: the epo has been informed by wipo that ep was designated in this application
Nov 2, 2000DFPERequest for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
Mar 8, 2001ENPEntry into the national phase in:
Ref country code: CA
Ref document number: 2342053
Kind code of ref document: A
Format of ref document f/p: F
Ref document number: 2342053
Country of ref document: CA
Mar 12, 2001WWEWipo information: entry into national phase
Ref document number: 141948
Country of ref document: IL
Mar 14, 2001WWEWipo information: entry into national phase
Ref document number: 510531
Country of ref document: NZ
Ref document number: 60458/99
Country of ref document: AU
Mar 16, 2001WWEWipo information: entry into national phase
Ref document number: PA/a/2001/002805
Country of ref document: MX
Mar 19, 2001ENPEntry into the national phase in:
Ref country code: JP
Ref document number: 2000 574228
Kind code of ref document: A
Format of ref document f/p: F
Apr 7, 2001WWEWipo information: entry into national phase
Ref document number: 1999969434
Country of ref document: EP
May 31, 2001ALDesignated countries for regional patents
Kind code of ref document: A3
Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG
May 31, 2001AKDesignated states
Kind code of ref document: A3
Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW
Jul 19, 2001REGReference to national code
Ref country code: DE
Ref legal event code: 8642
Aug 8, 2001WWPWipo information: published in national office
Ref document number: 1999969434
Country of ref document: EP
Oct 4, 2001COPCorrected version of pamphlet
Free format text: PAGES 1/4-4/4, DRAWINGS, REPLACED BY NEW PAGES 1/4-4/4; DUE TO LATE TRANSMITTAL BY THE RECEIVING OFFICE
Oct 4, 2001ALDesignated countries for regional patents
Kind code of ref document: C2
Designated state(s): GH GM KE LS MW SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG
Oct 4, 2001AKDesignated states
Kind code of ref document: C2
Designated state(s): AE AL AM AT AU AZ BA BB BG BR BY CA CH CN CR CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW
Jan 6, 2005WWGWipo information: grant in national office
Ref document number: 60458/99
Country of ref document: AU