WO2003101485A1 - Cd16a binding proteins and use for the treatment of immune disorders - Google Patents
Cd16a binding proteins and use for the treatment of immune disorders Download PDFInfo
- Publication number
- WO2003101485A1 WO2003101485A1 PCT/US2003/017111 US0317111W WO03101485A1 WO 2003101485 A1 WO2003101485 A1 WO 2003101485A1 US 0317111 W US0317111 W US 0317111W WO 03101485 A1 WO03101485 A1 WO 03101485A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- domain
- sequence
- cdr2
- binding
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
Definitions
- the invention relates to CD 16 A binding proteins and methods for treatment of immune disorders.
- the invention finds application in the fields of biomedicine and immunology.
- Fc ⁇ receptors are cell surface receptors that bind the Fc region of immunoglobulin G (IgG) molecules. Among other functions, these receptors couple the formation of antibody-antigen complexes to effector cell responses. For example, cross-linking of activating Fc ⁇ receptors by immune complexes can result in the phagocytosis of pathogens, killing of foreign and transformed cells by direct cytotoxicity, the clearance of toxic substances, and the initiation of an inflammatory response. Notably, the Fc ⁇ receptors play a key role in autoimmunity.
- Autoantibody binding to activating Fc receptors triggers the pathogenic sequalae of autoimmune diseases such as idiopathic thrombocytopenic purpura, arthritis, systemic lupus erythrematosus, autoimmune hemolytic anemia, and others.
- Fc ⁇ RI In humans and rodents there are three classes of Fc ⁇ receptors, designated Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII (see, Ravetch and Bolland, 2001 Annual Rev. Immunol 19:275-90; and Ravetch and Kinet, 1991, Annual Rev. Immunol. 9:457-92).
- Fc ⁇ RI sites are generally occupied by monomeric IgG, while RII and RIII receptors are generally unoccupied and available to interact with immune complexes.
- Fc ⁇ RI also called CD64, binds monomeric IgG with high affinity, and is present on monocytes and macrophages.
- Fc ⁇ RII also called CD32
- Fc ⁇ RIII also called CD 16
- Fc ⁇ RIII A a transmembrane signaling form (50-65 kDa)
- NK cells a transmembrane signaling form (50-65 kDa)
- Fc ⁇ RIIIB (CD16B), a glycosyl-phosphatidyl-inositol anchored form (48 kDa) form, is expressed by human neutrophils. See, e.g., Scallon et al., 1989, Proc. Nati. Acad. Sci. U.S.A. 86:5079-83 and Ravetch et al., 1989, J Exp. Med. 170:481-97. Protein and nucleic acid sequences for CD16A are reported in Genbank as accession numbers P08637 (protein) and X52645 (nucleic acid) and in SWISS-PROT as accession number CAA36870. Protein and nucleic acid sequences for CD16B are reported in Genbank as accession numbers O75015 (protein) and X16863 (nucleic acid) and in SWISS-PROT as CAA34753.
- the invention provides a CD 16 A binding protein that may be used for treatment of an individual with an autoimmune disease.
- CD16A binding proteins of the invention are other than mouse antibodies, and include chimeric, human and humanized anti-CD 16A monoclonal antibodies, fragments thereof, single chain antibodies, and other binding proteins comprising a V H domain and/or a N domain.
- the CD16A binding protein comprises a Fc region derived from a human IgG heavy chain (e.g., a Fc region derived from human IgGi) where the Fc region lacks effector function and/or is modified to reduce binding to a Fc effector ligand.
- the CD16A binding protein is not glycosylated, for example, due to a substitution at residue 297 of the Fc region.
- the CD16 A binding protein is a humanized 3G8 antibody with a N H domain comprising three complementarity determining regions (CDRs) derived from the N H domain of mouse monoclonal antibody 3G8.
- the VH domain has the sequence of the VH domain of Hu3 G8 VH- 1.
- the CDRs of the binding protein have the sequence of the mouse CDRs.
- the VH domain CDRs differ from those of 3G8 at least by one or more of the following substitutions: Val at position 34 in CDR1, Leu at position 50 in CDR2, Phe at position 52 in CDR2, Asn at position 54 in CDR2, Ser at position 60 in CDR2, Ser at position 62 in CDR2, Tyr at position 99 in CDR3, and Asp at position 101 of CDR3.
- the V H domain has the sequence of the V H domain of Hu3G8VH- 22.
- V H domain comprises an FR3 domain having the sequence of SEQ ID NO: 51.
- the VH domain may be linked to an antibody heavy chain constant domain, for example the human C ⁇ l constant domain.
- the CD16A binding protein has a V H domain having a sequence set forth in Table 3. In some versions the CD16A binding protein has a V H domain that differs from the sequence of Hu3G8VH-l by one or more of the substitutions shown in Table 1.
- the CD16A binding protein is a humanized 3G8 antibody with a VL domain comprising three complementarity determining regions (CDRs) derived from the V L domain of mouse monoclonal antibody 3G8.
- CDRs complementarity determining regions
- the CDRs of the binding protein have the sequence of the mouse CDRs.
- the V L domain CDRs differ from those of 3G8 at least by one or more of the following substitutions: Arg at position 24 in CDR1 ; Ser at position 25 in CDR1 ; Tyr at position 32 in CDR1 ; Leu at position 33 in CDR1; Ala at position 34 in CDR1; Asp, Trp or Ser at position 50 in CDR2; Ala at position 51 in CDR2; Ser at position 53 in CDR2; Ala or Gin at position 55 in CDR2; Thr at position 56 in CDR2; Tyr at position 92 in CDR3; Ser at position 93 in CDR3; and Thr at position 94 in CDR3.
- the VL domain has the sequence of the V L domain of Hu3G8VL-l , Hu3G8VL-22 or Hu3G8VL-43.
- the VL domain may be linked to an antibody light chain constant domain, for example the human CK constant region.
- the CD 16A binding protein has a V L domain having a sequence set forth in Table 4. In some versions the CD16A binding protein has a VL domain that differs from the sequence of Hu3G8VL-l by one or more of the substitutions shown in Table 2.
- the CD 16A binding protein comprises both a VH domain and a V L domain, as described above (which may be prepared by coexpression of polynucleotides encoding heavy and light chains).
- the humanized heavy chain variable region comprises a sequence set forth in Table 3 and/or the a humanized light chain variable region comprises a sequence set forth in Table 4.
- the binding protein has a heavy chain variable region having the sequence of SEQ ID NO: 113 and a light chain variable region having the sequence of SEQ ID NO: 96, 100 or 1118.
- the binding protein has a heavy chain variable region having the sequence of SEQ ID NO: 109 and light chain variable regions having the sequence of SEQ ID NO: 96.
- the binding protein has a heavy chain variable region having the sequence of SEQ ID NO: 104 and light chain variable regions having the sequence of SEQ ID NO:96.
- the CD 16A binding protein is tetrameric antibody comprising two light chains and two heavy chains, said light chains comprising a V L domain and a light chain constant domain and said heavy chains comprising a VH domain and a heavy chain constant domain.
- the light chain constant domain is human CK and/or the heavy chain constant region is C ⁇ l.
- the CD 16A binding protein comprises an antigen binding site that binds CD16A or sCD16A with a binding constant of less than 5 nM.
- the CD16A binding protein comprises an aglycosyl Fc region that has reduced binding to at least one Fc effector ligand compared to a reference CD16A binding protein that comprises an unmodified Fc region (e.g., a human IgGj . Fc domain glycosylated at position 297).
- the Fc effector ligand can be Fc ⁇ RIII or the Clq component of complement.
- the invention provides a CD16 A binding protein that is a humanized antibody that binds to CD16A and inhibits the binding of Fc receptor to CD 16.
- the invention provides a pharmaceutical composition comprising of CD16A binding protein described herein and a pharmaceutically acceptable excipient.
- the invention provides an isolated polynucleotide, optionally an expression vector, encoding a VH domain of a CD16A binding protein described herein.
- the invention provides an isolated nucleic acid, optionally an expression vector, encoding a V L domain of a CD16A binding protein described herein.
- the invention provides a cell, optionally a mammalian cell, comprising a polynucleotide described herein.
- the invention provides a cell line, optionally a mammalian cell line, expressing a CD16A binding protein described herein.
- the invention further provides a method of reducing an deleterious immune response (or undesired immune response) in a mammal comprising administering to a mammal a CD16A binding protein described herein.
- reducing the deleterious immune response comprises protecting against antibody-mediated platelet depletion.
- the invention provides a method of treating an deleterious immune response in a mammal without inducing neutropenia in the mammal (e.g., severe neutropenia or moderate neutropenia), where the method comprises administering to the mammal a CD16A binding protein having an Fc region derived from human IgG, and where the amino acid at position 297 of the Fc region is aglycosyl.
- a mammal without inducing neutropenia in the mammal (e.g., severe neutropenia or moderate neutropenia)
- the method comprises administering to the mammal a CD16A binding protein having an Fc region derived from human IgG, and where the amino acid at position 297 of the Fc region is aglycosyl.
- the deleterious immune response is an inflammatory response, for example, an inflammatory response caused by an autoimmune disease.
- the inflammatory response is caused by idiopathic thrombocytopenic purpura (FTP), rheumatoid arthritis (RA), systemic lupus erythrematosus (SLE), autoimmune hemolytic anemia (AHA), scleroderma, autoantibody triggered urticaria, pemphigus, vasculitic syndromes, systemic vasculitis, Goodpasture's syndrome, multiple sclerosis (MS), psoriatic arthritis, ankylosing spondylitis, Sj ⁇ gren's syndrome, Reiter's syndrome, Kowasaki's disease, polymyositis and dermatomyositis.
- FTP idiopathic thrombocytopenic purpura
- RA rheumatoid arthritis
- SLE systemic lupus erythrematosus
- AHA
- diseases or conditions that can be treated according to the invention also include any diseases susceptible to treatment with intravenous immunoglobulin (IVIG) therapy (e.g., allergic asthma).
- IVIG intravenous immunoglobulin
- the invention provides CD16A binding proteins that both protect against autoimmune diseases and do not result in significant neutrophil diminution in a mammal.
- the CD16A binding proteins are anti-CD 16A antibodies. These CD16A binding proteins are particularly advantageous for use as human therapeutics.
- the invention provides a method of treating an autoimmune disease in a mammal without neutrophil diminution or neutropenia in the mammal, by administering a CD16A binding protein having an Fc region derived from human IgG and an aglycosyl amino acid at position 297 of each of the C H 2 domains of the Fc region.
- the invention provides a method of inhibiting the binding of IgG antibodies to Fc ⁇ RIII on a cell by contacting the cell with a CD16A binding protein under conditions in which the CD16A binding protein binds the Fc ⁇ RIII on the cell.
- the invention provides a method of making a CD16A binding protein with improved therapeutic efficacy in treating an deleterious immune response, comprising the following steps: i) obtaining a first CD16A binding protein, where the first CD16A binding protein comprises an Fc region derived from IgG; and ii) modifying the Fc region of the first CD16A binding protein to produce a second CD16A binding protein that is aglycosylated at position 297 of the Fc region, where the second CD16A binding protein is more effective in treating the deleterious immune response when administered to a mammal than the first CD16A binding protein.
- the invention provides a method of making a CD 16 A binding protein with improved therapeutic efficacy in treating an deleterious immune response, comprising the following steps: i) obtaining a first CD16A binding protein, wherein the first CD16A binding protein comprises an Fc region derived from IgG; and ii) modifying the Fc region of the first CD16A binding protein to produce a second CD16A binding protein that has reduced binding to an Fc effector ligand compared to the unmodified Fc region of the first CD16A binding protein, where the second CD16A binding protein is more effective in treating the deleterious immune response when administered to a mammal than the first CD16A binding protein.
- the Fc effector ligand is Fc ⁇ RIII or the Clq component of complement.
- the method involves administering a CD 16A binding protein to reduce an deleterious immune response in a subject without eliciting one or more significant deleterious effects that result from 3G8 administration, or eliciting significantly lower levels of such effects than does administration of murine 3G8.
- the improved therapeutic efficacy in treating a deleterious immune response comprises improved effectiveness at protecting against antibody-mediated platelet depletion.
- the deleterious immune response is optionally due to idiopathic thrombocytopenic purpura (ITP) or the administration of murine monoclonal antibody 6A6 to a muFc ⁇ RIII-/-, huFc ⁇ RIIIA transgenic mouse.
- the invention provides the use of a CD 16 A binding protein comprising an Fc region derived from a human IgG heavy chain, wherein the Fc region lacks effector function, for treatment of an immune disorder or for preparation of a medicament for treatment of an immune disorder.
- Figure 1 shows results from an ELIS A for binding of sCD 16A by
- Hu3G8-24.43 is an antibody with the heavy chain
- Hu3G8VH-24 Hu3G8VL-43
- Hu3G8-5.1 is an antibody with the heavy chain Hu3G8VH-5
- the light chain Hu3G8VL-l Hu3G8 is the chimeric 3G8 antibody.
- HulgGl is an irrelevant immunoglobulin.
- Figure 2 shows results of an assay for binding of humanized and chimeric antibodies to CHO-K1 cells expressing the extracellular domain of
- Hu3G8-22.1 is an antibody with the heavy chain Hu3G8VH-22, and the light chain Hu3G8VL-l .
- Hu3G8-5.1 is an antibody with the heavy chain
- Hu3G8VH-5 Hu3G8VL-l
- Hu3G8-22.43 is an antibody with the heavy chain Hu3G8VH-22, and the light chain Hu3G8VL-43.
- N297Q indicates the antibody is aglycosylated.
- Figure 3 shows results of a cell based competition assay.
- the aglycosylated humanized antibodies shown compete with aglycosylated chimeric antibody for binding to CHO-K1 cells expressing the extracellular domain of
- FIG. 4 shows inhibition of binding of sCD 16 A to immune complexes.
- Hu3G8-l.l is an antibody with the heavy chain Hu3G8VH-l, and the light chain Hu3G8VL-l.
- Figure 5 shows ITP protection in mice injected i.v. with mAb 3G8
- Figure 6 shows ITP protection in mice injected i.v. with mAb 3G8
- Figure 7 shows the absence of ITP protection in mice injected i.v. with ch3G8 (0.5 ⁇ g/g) one hour before 6A6 i.p. injection .
- Figure 8 shows protection from ITP in mice injected i.v. with ch3G8
- Figure 9 shows protection from ITP in mice injected i.v. with ch3G8
- Figure 10 shows the results of F ACS scans of neutrophils following administration of CD16A binding protein or controls.
- the x-axis shows labeling with antibody to CD 16, and the y-axis shows labeling with antibody to the Gr-1 antigen.
- the upper right quadrant shows neutrophils; the upper left quadrant shows other granulocytes and neutrophils that no longer stain with 3G8-FITC.
- Figure 11 shows prevention of AIHA with a humanized anti-CD 16 antibody.
- Figure 12 shows inhibition of ch4D5 mediated ADCC by humanized
- Figure 13 shows inhibition of ch4-4-20 mediated ADCC by mouse
- Figure 14 shows protection of Fc ⁇ RIII-/-, hCD16A, hCD32A mice against ITP by administration of hu3G8-5.1.
- Figure 15 shows protection of Fc ⁇ RIII-/-, hCD16A mice against ITP by administration of hu3G8-5.1 N297Q.
- Figure 15(A) shows data points for each dose at indicated times.
- Figure 15(B) shows dose response at the 5 hour time point.
- Figure 16 shows the therapeutic effect of administration of aglycosylated humanized antibody subsequent to mice in which thrombocytopenia has been induced.
- Figure 16(A) shows administration of Hu3G8-5.1-N297Q.
- Figure 16(B) shows administration of Hu3G8-22.1-N297Q and Hu3G8-22.43-
- Figure 17 shows the therapeutic effect of a humanized anti-CD 16A antibody in treatment of autoimmune hemolytic anemia.
- the terms "heavy chain,” “light chain,” “variable region,” “framework region,” “constant domain,” and the like, have their ordinary meaning in the immunology art and refer to domains in naturally occurring immunoglobulins and the corresponding domains of synthetic (e.g., recombinant) binding proteins (e.g., humanized antibodies).
- the basic structural unit of naturally occurring immunoglobulins e.g., IgG
- IgG immunoglobulins
- Usually naturally occurring immunoglobulin is expressed as a glycoprotein of about 150,000 daltons, although, as described below, IgG can also be produced in a nonglycosylated form.
- the amino-terminal (“N”) portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal (“c") portion of each chain defines a constant region, with light chains having a single constant domain and heavy chains usually having three constant domains and a hinge region.
- the structure of the light chains of an IgG molecule is N-V L - _-C and the structure of IgG heavy chains is N-V H -CH I -H-C H2 -C H3 -C (where H is the hinge region).
- variable regions of an IgG molecule consists of the complementarity determining regions (CDRs), which contain the residues in contact with antigen and non-CDR segments, referred to as framework segments, which maintain the structure and determine the positioning of the CDR loops.
- CDRs complementarity determining regions
- framework segments which maintain the structure and determine the positioning of the CDR loops.
- V L and V H domains have the structure N-FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4-C.
- CD16A binding protein As used herein, the terms "CD16A binding protein,” “CD16A antibody,” and “anti-CD 16A antibody,” are used interchangeably and refer to a variety of immunoglobulin-like or immunoglobulin-derived proteins.
- “CD16A binding proteins” bind CD16A via an interaction with VL and/or VH domains (as distinct from Fc-mediated binding).
- Examples of CD 16 A binding proteins includes chimeric, humanized and human antibodies (e.g., comprising 2 heavy and 2 light chains), fragments thereof (e.g., Fab, Fab', F(ab') , and Fv fragments), bifunctional or multifunctional antibodies (see, e.g., Lanzavecchia et al., 1987, Eur.
- the CD16A binding protein is a "tetrameric antibody” i.e., having generally the structure of a naturally occurring IgG and comprising both variable and constant domains, (i.e., two light chains comprising a V L domain and a light chain constant domain, such as human CK and two heavy chains comprising a VH domain and a heavy chain hinge and constant domains, such as human C ⁇ l). Except as expressly noted, the mouse antibody 3G8 is specifically excluded from the definition of CD16A binding protein.
- an amino acid at position 50 of a human antibody light chain occupies the equivalent position to an amino acid at position 50 of a mouse antibody light chain.
- a reference such as "at position 297 of the Fc region” refers to the amino acid position in an immunoglobulin chain, region of an a immunoglobulin chain, or region of a polypeptide derived from an immunoglobulin chain, that corresponds to position 297 of the corresponding human immunoglobulin.
- the "Fc region” of immunoglobulins refers to the C-terminal region of an immunoglobulin heavy chain. Although the boundaries of the Fc region may vary somewhat, usually the Fc region is from about position 226-230 extending to the carboxy terminus of the polypeptide (and encompassing the CH2 and C H 3 domains). Sequences of human Fc regions are found in Kabat, supra. In addition, a variety of allotypic variants are known to exist.
- Fc effector ligand is a ligand that binds to the Fc region of an IgG antibody, thereby activating effector mechanisms resulting in the clearance and destruction of pathogens.
- Fc effector ligands include three cellular Fc receptors types - FcR ⁇ l, FcR ⁇ ll, and FcR ⁇ lll. The multiple isoforms of each of the three Fc receptor types are also included. Accordingly, the term “Fc effector ligand” includes both FcR ⁇ lllA (CD16A) and FcR ⁇ lllB (CD16B). The term “Fc effector ligand” also includes the neonatal Fc receptor (Fc ⁇ n) and the Clq component of complement.
- Binding of IgG to the Fc receptors triggers a variety of biological processes including antibody-dependent cell-mediated cytotoxicity (ADCC), release of inflammatory mediators, control of antibody production, clearance of immune complexes and destruction of antibody-coated particles.
- ADCC antibody-dependent cell-mediated cytotoxicity
- Binding of the Clq component of complement to IgG activates the complement system. Activation of complement plays important roles in opsonization, lysis of cell pathogens, and inflammatory responses.
- an Fc region that "lacks effector function" does not bind the Fc receptor and/or does not bind the Clq component of complement and trigger the biological responses characteristic of such binding.
- glycosylation site refers to an amino acid residue that is recognized by a mammalian cell as a location for the attachment of sugar residues.
- Amino acid residues to which carbohydrates, such as oligosaccharides, are attached are usually asparagine (N-linkage), serine (O-linkage), and threonine (O- linkage) residues.
- the specific sites of attachment usually have a characteristic sequence of amino acids, referred to as a "glycosylation site sequence.”
- the glycosylation site sequence for N-linked glycosylation is : -Asn-X-Ser- or -Asn- X-Thr-, where X can be any of the conventional amino acids, other than proline.
- the Fc region of human IgG has two glycosylation sites, one in each of the CH2 domains.
- the glycosylation that occurs at the glycosylation site in the C H 2 domain of human IgG is N-linked glycosylation at the asparagine at position 297 (Asn 297).
- chimeric when referring to antibodies, has the ordinary meaning in the art and refers to an antibody in which a portion of a heavy and/or light chain is identical to or homologous with an antibody from one species (e.g., mouse) while the remaining portion is identical to or homologous with an antibody of another species (e.g., human).
- humanized has its usual meaning in the art.
- humanization of a non-human antibody involves substituting the CDR sequences from non-human immunoglobulin V L and V H regions into human framework regions.
- "humanized” antibodies may comprise additional substitutions and mutations in the CDR and/or framework regions introduced to increase affinity or for other purposes. For example, substitution of nonhuman framework residues in the human sequence can increase affinity. See, e.g., Jones et al., 1986, N ⁇ twre 321:522-25; Queen et al., 1989, Proc. Nati. Acad. Sci. U.S.A.
- variable domains have non-human CDR sequences and framework sequences derived from human antibody framework sequence(s) or a human consensus sequence (e.g., as disclosed in Kabat, supra).
- the framework sequences of a humanized antibody are "substantially human,” by which is meant that at least about 70% of the human antibody sequence, usually at least about 80% human, and most often at least about 90% of the framework sequence is from human antibody sequence.
- the substantially human framework comprises a serine at position 113 of the V H FR4 domain (e.g., SEQ ID NO: 64).
- a "humanized antibody” includes, in addition to tetrameric antibodies, single chain antibodies, antibody fragments and the like that comprise CDRs derived from a non-human antibody and framework sequences derived from human framework regions. '
- mammals include humans, non-human primates, rodents, such as, mice and rats, and other mammals.
- neutrenia has its ordinary meaning, and refers to a state in which the number of neutrophils circulating in the blood is abnormally low.
- the normal level of neutrophils in human blood varies slightly by age and race. The average adult level is about 1500 cells/mm of blood. Neutrophil counts less than 500 cells/mm 3 result in great risk of severe infection.
- severe neutropenia is defined by a blood neutrophil count less than about 500 cells/mm 3
- moderate neutropenia is characterized by a blood neutrophil count from about 500-1000 cells/mm .
- treatment refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology.
- Therapeutic effects of treatment include without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- an "effective amount” is an amount sufficient to effect a beneficial or desired clinical result upon treatment.
- An effective amount can be administered to a patient in one or more doses.
- a "therapeutically effective amount” is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease, or reduce the symptoms of the disease.
- the amelioration or reduction need not be, and usually is not, permanent, but may be for a period of time ranging from at least one hour, at least one day, or at least on week or more.
- the effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount.
- an "inflammation reducing amount” is an amount that reduces inflammation in a subject.
- a reduction in inflammation can be assessed by art known criteria, including decreased C-reactive protein levels, decreased consumption of complement, reduced immune complex deposition at sites of inflammation (e.g., joints in subjects with RA, kidney in subjects with lupus, myelin sheath, etc.), reduced cytokine release, migration of macrophages and neutrophils, and the like.
- Substantial sequence identity refers to two or more sequences or subsequences (e.g., domains) that have at least about 80%) amino acid residue identity, preferably at least about 90%, or at least about 95% identity when compared and aligned for maximum correspondence.
- Sequence identity between two similar sequences can be measured by (1) aligning the sequences to maximize the total number of identities across the entire length of the sequences, or across the entire length of the shorter of the two sequences, if of different lengths (and where the length of the aligned sequences or shorter of the aligned sequences is "L" residues); (2) counting the number of positions (not including the number "E” residues designated as excluded from the comparison) at which there is an amino acid identity, where the number of identities is designated "N"; (3) and dividing the N by the "L” minus "E.” For example, in a comparison of two sequences each of length 80 residues, in which 6 specific residues are excluded from the comparison and for which there are 65 identities in the remaining 74 positions, the sequence identity would be N/(L-E) or 65/(80-6) or 87.8%.
- An amino acid or nucleic acid sequence is "substantially similar to" a second sequence when the degree of sequence identity is at least about 70% identical, preferably at least about 80%, or at least about 90%, or even at least about 95%, identical. Sequences that are substantially identical are also substantially similar.
- a polypeptide, polypeptide domain or region, or amino acid sequence is "derived from” another when the two sequences are identical or substantially similar and have a similar biological function.
- the complementary determining regions are "derived from” the corresponding CDRs of the mouse monoclonal antibody, and the variable domain framework regions can be "derived from” framework sequences of the corresponding human antibody.
- one domain, etc. can be derived from a parental domain, etc., even though the two differ in sequence due to, for example, the introduction of mutations that affect, or alternatively do not change, binding affinity or other properties of the protein in which the domain, etc., is contained, such as those described herein. It will also be understood that normally a domain, etc., "derived from” a parental domain, etc., is made, produced or designed using materials (e.g. genetic material) or information (e.g., nucleotide or amino acid sequence) from the parental molecule.
- materials e.g. genetic material
- information e.g., nucleotide or amino acid sequence
- Standard abbreviations are used for amino acids: alanine, Ala (A); serine, Ser (S); threonine, Thr (T); aspartic acid, Asp (D); glutamic acid, Glu (E); asparagine, Asn (N); glutamine, Gin (Q); arginine, Arg (R); lysine, Lys (K); isoleucine, He (I); leucine, Leu (L); methionine, Met (M); valine, Val (V); phenylalanine, Phe (F); tyrosine, Tyr (Y); tryptophan, Tip (W); glycine, Gly (G); histidine, His (H): proline, Pro (P); and cysteine, Cys (C).
- the Fc ⁇ RIIIA receptor, CD 16 A plays a role in coupling cytotoxic and immune complex antibodies to effector responses. It is believed that the interaction of the Fc ⁇ RIIIA receptor and immunoglobulin aggregates (e.g. immune complexes) present in autoimmune diseases and other pathogenic conditions results in a deleterious inflammatory response in subjects. Without intending to be bound by a specific mechanism, it is believed that reducing the interaction of the Fc ⁇ RIIIA receptor (generally referred to herein as "CD 16 A" or "the CD16A receptor” and immunoglobulin aggregates will alleviate this inflammatory response. Also without intending to be bound by a specific mechanism, it is believed that one method for reducing the interaction of CD16A and immunoglobulin aggregates is by use of anti-CD 16A antibodies, or other CD16A binding proteins, to block the interaction.
- Monoclonal antibody 3G8 (“mAb 3G8”) is a mouse monoclonal antibody that binds the Fc-binding domain of human CD16A and B with a K a of lxlO 9 M “1 (Fleit et al., 1982, Proc. Nati. Acad. Sci. U A 79:3275-79). 3G8 blocks the binding of human IgGi immune complexes to isolated human NK cells, monocytes and neutrophils, as well as to CD16A-transfected 293 cells.
- the present invention provides novel CD 16A binding proteins, including humanized and/or aglycosylated monoclonal antibodies, and methods for reducing an deleterious immune response in a subject by administering the proteins.
- Administration of these binding proteins is shown to be protective in well established models for two distinct autoimmune diseases: autoimmune hemolytic anemia (AHA) and idiopathic thrombocytopenic purpura. These results are indicative of efficacy of this treatment for other autoimmune diseases as well.
- AHA autoimmune hemolytic anemia
- idiopathic thrombocytopenic purpura e.g., aglycosylated antibodies
- the invention provides new reagents and methods for antibody-mediated effected treatment of autoimmune conditions without pronounced side-effects observed using alternative treatments.
- CD 16 A binding proteins may be used in the methods of the invention.
- Suitable CD16A binding proteins include human or humanized monoclonal antibodies as well as CD16A binding antibody fragments (e.g., scFv or single chain antibodies, Fab fragments, minibodies) and another antibody-like proteins that bind to CD16A via an interaction with a light chain variable region domain, a heavy chain variable region domain, or both.
- the CD 16 A binding protein for use according to the invention comprises a N L and/or V H domain that has one or more CDRs with sequences derived from a non-human anti-CD 16A antibody, such as a mouse anti- CD16A antibody, and one or more framework regions with derived from framework sequences of one or more human immunoglobulins.
- a non-human anti-CD 16A antibody such as a mouse anti- CD16A antibody
- framework regions with derived from framework sequences of one or more human immunoglobulins are known (see, e.g., Tamm and Schmidt, 1996, J Imm.
- LEUKOCYTE TYPING II HUMAN MY ⁇ LOID AND HEMATOPOIETIC CELLS, Reinherz et al, eds. New York: Springer- Verlag; 1986; LEUCOCYTE TYPING III: WHITE CELL DIFFERENTIATION ANTIGENS McMichael AJ, ed., Oxford: Oxford University Press, 1986); LEUKOCYTE TYPING IV: WHITE CELL DIFFERENTIATION ANTIGENS, Kapp et al., eds. Oxford Univ.
- new CD16A binding proteins that recognize human CD16A expressed on cells can be obtained using well known methods for production and selection of monoclonal antibodies or related binding proteins (e.g., hybridoma technology, phage display, and the like). See, for example, O'Connel et al., 2002, J. Mol. Biol.
- Monoclonal antibodies from a non-human species can be chimerized or humanized using techniques using techniques of antibody humanization known in the art.
- Fully human antibodies against CD16A can be produced using transgenic animals having elements of a human immune system (see, e.g., U.S. Patent Nos. 5,569,825 and 5,545,806), using human peripheral blood cells (Casali et al., 1986, Science 234:476), by screening a DNA library from human B cells according to the general protocol outlined by Huse et al., 1989, Science 246:1275, and by other methods.
- CD16A binding proteins that bind the CD16A receptor at the same epitope bound by 3G8, or at least sufficiently close to this epitope to block binding by 3G8.
- Methods for epitope mapping and competitive binding experiments to identify binding proteins with the desired binding properties are well known to those skilled in the art of experimental immunology. See, for example, Harlow and Lane, cited supra; Stahl et al., 1983, Methods in Enzymology 9:242-53; Kirkland et al, 1986, J Immunol. 137:3614-19; Morel et al., 1988, Molec. Immunol.
- Epitope comparison can also be achieved by labeling a first antibody, directly or indirectly, with an enzyme, radionuclide or fluorophore, and measuring the ability of an unlabeled second antibody to inhibit the binding of the first antibody to the antigen on cells, in solution, or on a solid phase.
- immune complexes formed on ELISA plates.
- Such immune complexes are formed by first coating the plate with an antigen such as fluorescein, then applying a specific anti-fluorescein antibody to the plate.
- This immune complex serves as the ligand for soluble Fc receptors such as sFcRIIIa.
- a soluble immune complex may be formed and labeled, directly or indirectly, with an enzyme radionuclide or fluorophore.
- the ability of antibodies to inhibit the binding of these labeled immune complexes to Fc receptors on cells, in solution or on a solid phase can then be measured.
- CD16A binding proteins of the invention may or may not comprise a human immunoglobulin Fc region. Fc regions are not present, for example, in scFv binding proteins. Fc regions are present, for example, in human or humanized tetrameric monoclonal IgG antibodies. As described in detail below, in some embodiments of the present invention, the CD16A binding protein includes an Fc region that has an altered effector function, e.g., reduced affinity for an effector ligand such as an Fc receptor or Cl component of complement compared to the unaltered Fc region (e.g., Fc of naturally occurring IgG * ⁇ proteins). In one embodiment the Fc region is not glycosylated at the Fc region amino acid corresponding to position 297. Such antibodies lack Fc effector function.
- the CD16A binding protein does not exhibit Fc-mediated binding to an effector ligand such as an Fc receptor or the Cl component of complement due to the absence of the Fc domain in the binding protein while, in other cases, the lack of binding or effector function is due to an alteration in the constant region of the antibody.
- CD16A Binding Proteins Comprising CDR Sequences Similar to A mAb 3G8 CDR Sequences.
- CD16A binding proteins that can be used in the practice of the invention include proteins comprising a CDR sequence derived from (i.e., having a sequence the same as or similar to) the CDRs of the mouse monoclonal antibody 3G8.
- the nucleic acid and protein sequences of 3G8 are provided below and are designated SEQ ID NO:l and 2 (V L ) and SEQ ID NO:3 and 4 (V H ).
- a large number of chimeric and humanized monoclonal antibodies comprising complementary determining regions derived from 3G8 CDRs were produced and their properties analyzed.
- antibody heavy chains comprising a N H region with CDRs derived from 3G8 were produced and combined (by coexpression) with antibody light chains comprising a VL region with CDRs derived from 3G8 to produce a tetrameric antibody for analysis. Properties of the resulting tetrameric antibodies were determined as described below.
- CD16A binding proteins comprising 3G8 CDRs such as the humanized antibody proteins described hereinbelow, may be used according to the invention to reduce an deleterious immune response.
- the CD 16A binding protein of the invention may comprise a heavy chain variable domain in which at least one CDR (and usually three CDRs) have the sequence of a CDR (and more typically all three CDRs) of the mouse monoclonal antibody 3G8 heavy chain and for which the remaining portions of the binding protein are substantially human (derived from and substantially similar to, the heavy chain variable region of a human antibody or antibodies).
- the invention provides a humanized 3G8 antibody or antibody fragment containing CDRs derived from the 3G8 antibody in a substantially human framework, but in which at least one of the CDRs of the heavy chain variable domain differs in sequence from the corresponding mouse antibody 3G8 heavy chain CDR.
- the CDR(s) differs from the 3G8 CDR sequence at least by having one or more CDR substitutions shown in Table 1 (e.g., valine at position 34 in CDR1, leucine at position 50 in CDR2, phenylalanine at position 52 in CDR2, tyrosine at position 52 in CDR2, aspartic acid at position 52 in CDR2, asparagine at position 54 in CDR2, serine at position 60 in CDR2, serine at position 62 in CDR2, tyrosine at position 99 in CDR3, and/or aspartic acid at position 101 of CDR3).
- Suitable CD 16 binding proteins may comprise 0, 1, 2, 3, or 4, or more of these substitutions (and often have from 1 to 4 of these substitutions) and optionally can have additional substitutions as well.
- a CD16A binding protein may comprise a heavy chain variable domain sequence that is the same as, or similar to, the VH domain of the Hu3G8VH-l construct, the sequence of which is provided in Table 3.
- the invention provides a CD16A binding protein comprising a V H domain with a sequence that (1) differs from the V H domain of Hu3G8VH-l by zero, one, or more than one of the CDR substitutions set forth in Table 1; (2) differs from the VH domain of Hu3G8VH-l by zero, one or more than one of the framework substitutions set forth in Table 1; and (3) is at least about 80%> identical, often at least about 90%, and sometimes at least about 95% identical, or even at least about 98% identical to the Hu3G8VH-l VH sequence at the remaining positions.
- Exemplary VH domains of CD 16 binding proteins of the invention have the sequence of Hu3G8VH-5 and Hu3G8VH-22, as shown in Tables 3 and 6.
- the VH domain may have a sequence that differs from that of Hu3G8VH-l (Table 3) by at least one, at least two, at least three, at least four 4, at least five, or at least six of the substitutions shown in Table 1. These substitutions are believed to result in increased affinity for CD16A and/or reduce the immunogenicity of a CD16A binding protein when administered to humans.
- the degree of sequence identity with the Hu3G8VH-l V H domain at the remaining positions is at least about 80%, at least about 90%, at least about 95% or at least about 98%.
- CD16A binding protein VH domains For illustration and not limitation, the sequences of a number of CD16A binding protein VH domains is shown in Table 3. As described in the Examples, infra, heavy chains comprising these sequences fused to a human C ⁇ l constant region were coexpressed with the hu3G8VL-l light chain (described below) to form tetrameric antibodies, and binding of the antibodies to CD16A was measured to assess the effect of amino acid substitutions compared to the hu3G8VH-l VH domain.
- VH domain has a sequence of hu3G8VH-l, 2, 3, 4, 5, 8, 12, 14, 16, 17, 18, 19, 20, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 42, 43, 44, and 45 showed high affinity binding, with hu3G8VH- 6 and -40 VH domains showing intermediate binding.
- CD16A binding proteins comprising the VH domains of hu3G8VH-5 and hu3G8VH-22 are considered to have particularly favorable binding properties.
- the invention provides a CD16A binding protein containing a light chain variable domain in which at least one CDR (and usually three CDRs) has the sequence of a CDR (and more typically all three CDRs) of the mouse monoclonal antibody 3G8 light chain and for which the remaining portions of the binding protein are substantially human (derived from and substantially similar to, the heavy chain variable region of a human antibody or antibodies).
- the invention provides a humanized 3G8 antibody or antibody fragment containing CDRs derived from the 3G8 antibody in a substantially human framework, but in which at least one of the CDRs of the light chain variable domain differs in sequence from the mouse monoclonal antibody 3G8 light chain CDR.
- the CDR(s) differs from the 3G8 sequence at least by having one or more amino acid substitutions in a CDR, such as, one or more substitutions shown in Table 2 (e.g., arginine at position 24 in CDR1; serine at position 25 in CDR1; tyrosine at position 32 in CDR1; leucine at position 33 in CDR1; aspartic acid, tryptophan or serine at position 50 in CDR2; serine at position 53 in CDR2; alanine or glutamine at position 55 in CDR2; threonine at position 56 in CDR2; serine at position 93 in CDR3; and/or threonine at position 94 in CDR3).
- Table 2 e.g., arginine at position 24 in CDR1; serine at position 25 in CDR1; tyrosine at position 32 in CDR1; leucine at position 33 in CDR1; aspartic acid, tryptophan or serine at position 50 in C
- variable domain can have 0, 1, 2, 3, 4, 5, or more of these substitutions (and often have from 1 to 4 of these substitutions) and optionally, can have additional substitutions as well.
- a suitable CD16A binding protein may comprise a light chain variable domain sequence that is the same as, or similar to, the V L domain of the Hu3G8VL-l construct, the sequence of which is provided in Table 4.
- the invention provides a CD16A binding protein comprising a VL domain with a sequence that (1) differs from the VL domain of Hu3G8VL-l by zero, one, or more of the CDR substitutions set forth in Table 2; (2) differs from the V L domain of Hu3G8VL-l by zero, one or more of the framework substitutions set forth in Table 2; and (3) is at least about 80% identical, often at least about 90%, and sometimes at least about 95% identical, or even at least about 98%o identical to the Hu3G8VL-l V L sequence at the remaining positions.
- V domains of CD 16 binding proteins of the invention have the sequence of Hu3G8VL-l or Hu3G8VL-43, as shown in Tables 4 and 6.
- the VL domain may have a sequence that differs from that of Hu3G8VL-l (Table 4) by zero, one, at least two, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, or at least 9 of the substitutions shown in Table 2. These substitutions are believed to result in increased affinity for CD16A and/or reduce the immunogenicity of a CD16A binding protein when administered to humans.
- the degree of sequence identity at the remaining positions is at least about 80%, at least about 90%, at least about 95%> or at least about 98%.
- CD16A binding protein V L domains For illustration and not limitation, the sequences of a number of CD16A binding protein V L domains is shown in Table 4. As described in the Examples, infra, light chains comprising these sequences fused to a human CK constant domain were coexpressed with the Hu3G8VH-l heavy chain (described above) to form tetrameric antibodies, and the binding of the antibodies to CD16A was measured to assess the effect of amino acid substitutions compared to the Hu3G8VL-l V domain.
- V L domain has a sequence of hu3G8VL-l, 2, 3, 4, 5, 10, 16, 18, 19, 21, 22, 24, 27, 28, 32, 33, 34, 35, 36, 37, and 42 showed high affinity binding and hu3G8VL-15, 17, 20, 23, 25, 26, 29, 30, 31, 38, 39, 40 and 41 showed intermediate binding.
- CD16A binding proteins comprising the V L domains of hu3G8VL-l, hu3G8VL-22, and hu3G8VL-43 are considered to have particularly favorable binding properties.
- Vi and/or VH domains [0083] As is known in the art and described elsewhere herein, immunoglobulin light and heavy chains can be recombinantly expressed under conditions in which they associate to produce a tetrameric antibody, or can be so combined in vitro. Similarly, combinations of V L and/or V H domains can be expressed in the form of single chain antibodies, and still other CD16A binding proteins that comprise a VL and/or VH domain can be expressed by known methods. It will thus be appreciated that a 3 G8 -derived VL-domain described herein can be combined with a 3 G8 -derived V ⁇ -domam described herein to produce a CD16A binding protein, and all such combinations are contemplated.
- examples of useful CD16A binding proteins are those comprising at least one VH domain and at least one V L domain, where the V H domain is from hu3G8VH-l, hu3G8VH-22 or hu3G8VH-5 and the V L domain is from hu3G8VL-l, hu3G8VL-22 or hu3G8VL-43.
- humanized antibodies that comprise hu3G8VH-22 and either hu3G8VL-l, hu3G8VL-22 or hu3G8VL-43, or hu3G8VH-5 and hu3G8VL-l have favorable properties.
- V L a nd V H domains described here can be further modified by art-known methods such as affinity maturation (see Schier et al., 1996, J Mol. Biol. 263:551-67; Daugherty et al., 1998, Protein Eng. l l:825-32; Boder et al., 1997, Nat. Biotechnol. 15:553-57; Boder et al., 2000, Proc. Nati. Acad. Sci. USA 97:10701-705; Hudson and Souriau, 2003, Nature Medicine 9:129-39).
- affinity maturation see Schier et al., 1996, J Mol. Biol. 263:551-67; Daugherty et al., 1998, Protein Eng. l l:825-32; Boder et al., 1997, Nat. Biotechnol. 15:553-57; Boder et al., 2000, Proc. Nati. Acad. Sci. USA 97:107
- the CD 16 A binding protein of the invention may contain light chain and/or heavy chain constant regions (including the hinge region connecting the C HI and CH 2 domains in IgG molecules). It is contemplated that a constant domain from any type (e.g., IgM, IgG, IgD, IgA and IgE) of immunoglobulin may be used.
- the constant domain for the light chain can be lambda or kappa.
- the constant domain for the heavy chain can be any isotype (e.g., IgG] . , IgG 2 , IgG 3 and IgG ).
- Chimeric constant domains, portions of constant domains, and variants of naturally occurring human antibody constant domains may be used.
- a change in the amino acid sequence of a constant domain can be modified to provide additional or different properties, such as altered immunogenicity or half-life of the resultant polypeptide.
- the changes range from insertion, deletion or substitution of a small number (e.g., , less than ten, e.g., one, two, three or more) amino acid residues to substantial modifications of the constant region domain. Changes contemplated include those that affect the interaction with membrane receptors, complement fixation, persistence in circulation, and other effector functions.
- the hinge or other regions can be modified as described in U.S.
- the Fc region can be modified to reduce or eliminate binding to Fc effector ligands such as Fc ⁇ RIII and the Clq component of complement, such that the antibodies lack (or have substantially reduced) effector function.
- Antibodies having such modified Fc regions induce little or no antibody dependent cellular cytotoxicity (ADCC) and/or complement mediated lysis when administered to a mammal, compared to unmodified antibodies.
- ADCC antibody dependent cellular cytotoxicity
- Assays to identify antibodies lacking effector function are known in the art. See, e.g., U.S. Pat. Nos. 6,194,551; 6,528,624; and 5,624,821, European Pat. No. EP 0 753 065 Bl, and PCT publication WO 00/42072.
- the CD16A binding protein of the invention may include a human IgGj .
- Fc domain comprising one or more amino acid substitutions or deletions (relative to the parental naturally occurring lgG ) that result in a reduced interaction between the Fc domain of the binding protein and Fc ⁇ RIIA and/or Fc ⁇ RIIIA (e.g., to minimize potential activation of macrophages and/or minimize neutrophil diminution) and/or increased binding of the Fc region to Fc ⁇ RIIB (e.g., to increase Fc ⁇ RIIB-mediated inhibition of effector cell activation; see Bolland and Ravetch, 1999, Adv. in Immunol. 72:149).
- Fc ⁇ RIII complexed with human IgGl Fc revealed potential contacts between the receptor and its ligand and also revealed that a single Fc ⁇ RIII monomer binds to both subunits of the Fc homodimer in an asymmetric fashion.
- Alanine-scanning mutagenesis of the Fc region confirmed the importance of most of the predicted contact residues (Shields et al., 2001, J Biol. Chem. 276:6591-6604).
- Exemplary Fc region mutations include, for example, L235E, L234A, L235A, and D265A, which have been shown to have low affinity for all FcR, into C ⁇ -1 (Clynes et al, 2000, Nat. Med.
- Fc binding to Fc ⁇ RIIA and Fc ⁇ lllA or other proteins can be measured by any of a number of methods, including ELISA to measure binding to isolated recombinant Fc ⁇ R and RIA or FACS to measure binding to cells.
- Immune complexes and heat aggregated or chemically crosslinked Fc or IgG can be used to test affinity for FcRs in such assays.
- immune complexes are produced by expressing an Fc in the context of an Fab with affinity for an antigen (such as fluorescein) and mixing the antibody and antigen to form an immune complex.
- the Fc domain can be modified to achieve desired properties.
- the invention provides a CD16A binding protein, such as a human or humanized anti-CD 16A monoclonal antibody, comprising an Fc region that is not glycosylated.
- a CD16A binding protein such as a human or humanized anti-CD 16A monoclonal antibody, comprising an Fc region that is not glycosylated.
- the inventors have discovered that, unexpectedly, administration of anti-CD 16A antibodies with altered effector function (aglycosylated antibodies) protects against autoimmune disorders without inducing acute severe neutropenia.
- therapeutic anti-CD 16A antibodies can be designed to protect against autoimmune diseases without inducing dangerous side effects.
- the invention provides a CD16A binding protein comprising an Fc region derived from human IgGi, where the amino acids corresponding to position 297 of the CH2 domains of the Fc region are aglycosyl.
- the residue at position 297 of the Fc domains of CD16A binding proteins described herein results in reduced binding to CD16A and the Clq component of complement.
- Such aglycosylated antibodies lack effector function.
- the residue at position 297 is asparagine.
- the residue at, or corresponding to, position 297 of the Fc region of the CD16A binding protein is other than asparagine. Substitution of another amino acid residue in the place of asparagine eliminates the N-glycosylation site at position 297.
- the amino acid residue at position 297 is glutamine or alanine.
- the amino acid residue at position 297 is cysteine, which is optionally linked to PEG.
- the residue at position 297 may or may not be asparagine, but is not glycosylated. This can be accomplished in a variety of ways.
- amino acid residues other than the asparagine at position 297 are known to be important for N-linked glycosylation at position 297 (see Jefferis and Lund, 1997, Chem.
- CD16 A binding proteins Modification of the amino acid residues of CD16 A binding proteins is well within the ability of the ordinarily skilled practitioner, and can be achieved by mutation of a polynucleotide encoding the binding protein or portion thereof.
- the CD16A binding protein comprising an IgG-derived Fc region need not necessarily be mutated at the amino acid level to be aglycosylated.
- Binding proteins aglycosylated at position 297 of the IgG-derived Fc region can be produced by expressing the CD16A binding protein in certain cells (e.g., E. coli; see PCT publication WO 02061090 A2), cell lines or under certain cell culture growth conditions where glycosylation at Asn 297 does not take place.
- carbohydrate groups may be removed from a CD16A binding protein following expression of the protein, e.g., enzymatically.
- Methods for removing or modifying carbohydrate groups on proteins are known and include use of endoglycosidases and peptide:N-glycosidases.
- modifying in the context of modifying the Fc region of a CD16A binding protein includes modifying the protein itself directly, modifying the polynucleotide that encodes the protein and/or modifying or selecting a suitable expression system production of the protein.
- variants with reduced binding to Fc effector ligands due to only partial removal, or modification, of the carbohydrate at that position may be used in the present invention.
- the Fc region can be modified to include a non-naturally occurring carbohydrate that does not bestow binding protein with effector function.
- a "modified Fc region" is an Fc region that has been derived from a parent Fc region, but which differs in glycosylation pattern from the parent Fc region.
- CD 16 A binding proteins of the invention can be produced using a variety of methods well known in the art, including de novo protein synthesis and recombinant expression of nucleic acids encoding the binding proteins.
- the desired nucleic acid sequences can be produced by recombinant methods (e.g., PCR mutagenesis of an earlier prepared variant of the desired polynucleotide) or by solid-phase DNA synthesis. Usually recombinant expression methods are used.
- the invention provides a polynucleotide that comprises a sequence encoding a CD16A binding protein disclosed herein or a CD16A binding fragment thereof, for example a sequence encoding a N L or N ⁇ described herein, or antibody heavy chain or light chain described herein. Because of the degeneracy of the genetic code, a variety of nucleic acid sequences encode each immunoglobulin amino acid sequence, and the present invention includes all nucleic acids encoding the binding proteins described herein. [0099] Recombinant expression of antibodies is well known in the art and can be carried out, for example, by inserting nucleic acids encoding light and heavy chain variable regions, optionally linked to constant regions, into expression vectors.
- Expression vectors typically include control sequences such as a promoter, an enhancer, and a transcription termination sequence to which D ⁇ A segments encoding polypeptides (e.g., immunoglobulin chains) are operably linked to ensure the expression of immunoglobulin polypeptides.
- Expression vectors are typically replicable in the host organisms either as episomes or as an integral part of the host chromosomal D ⁇ A. The light and heavy chains can be cloned in the same or different expression vectors.
- Immunoglobulin light and heavy chains are expressed using standard methods.
- a multiple polypeptide chain antibody or antibody fragment species can be made in a single host cell expression system wherein the host cell produces each chain of the antibody or antibody fragment and assembles the polypeptide chains into a multimeric structure to form the antibody or antibody fragment in vivo. See e.g., Lucas et al., 1996, Nucleic Acids Res., 24: 1774-79.
- heavy and light chains are cloned on separate expression vectors, the vectors are co- transfected to obtain expression and assembly of intact immunoglobulins.
- recombinant production of antibody heavy and light chains in separate expression hosts followed by assembly of antibody from separate heavy and light chains in vitro is known.
- the CD16A binding proteins are conveniently expressed in procaryotic or eukaryotic cells.
- Useful hosts for antibody expression include bacteria (see, e.g., PCT publication WO 02/061090), yeast (e.g., Saccharomyces), insect cell culture (Putlitz et al., 1990, Bio/Technology 8:651-54), plants and plant cell cultures (Larrick and Fry, 1991, Hum. Antibodies Hybridomas 2:172-89), and mammalian cells. Methods for expression are well known in the art. For example, in E.
- Mammalian cells are especially useful for producing CD 16A binding proteins, including tetrameric antibodies or fragments thereof.
- suitable host cell lines capable of secreting intact heterologous proteins include CHO cell lines, COS cell lines, HeLa cells, L cells and myeloma cell lines.
- Expression vectors for mammalian cells can include expression control sequences, such as an origin of replication, a promoter, an enhancer, ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences. Examples of expression control sequences are promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papillomavirus, and the like.
- binding proteins are expressed using the CMV immediate early enhancer/promoter in the vector pCDNA3.1 or a similar vector.
- the genes can be fused to a gene cassette containing the signal sequence of a mouse VH gene described by Orlandi et al., 1989, Proc. Nati. Acad. Sci. U.S.A 86:3833-37, which has been widely used for high-level secretion of immunoglobulins.
- the vectors containing the DNA segments encoding the polypeptides of interest can be transferred into the host cell using routine, depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment, electroporation, lipofection, biolistics or viral-based transfection may be used for other cellular hosts.
- cells e.g., HEK293
- a cationic lipid e.g., Lipofectamine 2000, Invitrogen. This method can achieve expression levels of 10-20 mg/1 of IgG in conditioned medium after 3 days. The cells can then be re-fed and similar quantities harvested after 3 more days.
- the cells expressing CD16A binding proteins can be maintained in medium containing FBS screened for very low levels of bovine IgG, or, alternatively, in serum-free medium.
- single chain antibodies, antibody fragments, and other CD16A binding proteins can be prepared.
- immunoglobulin fragments can be prepared by proteolytic digestion of tetrameric antibodies, or more often, by recombinant expression of truncated antibody constructs.
- single chain V region constructs are made by linking VL and/or V H domain using a short linking peptide (see, e.g., Bird et al., 1988, Science 242:423-26; Pat. Nos. 4,946,778; 5,455,030; 6,103,889; and 6,207,804).
- the binding proteins can be purified using procedures well known in the art, including ammonium sulfate precipitation, affinity chromatography, gel electrophoresis and the like (see, generally, Harris and Angal, 1990, PROTEIN PURIFICATION APPLICATIONS, A PRACTICAL APPROACH Oxford University Press, Oxford, UK; and Coligan et al., supra).
- purification is accomplished by capturing the antibody using a high flow rate protein A resin such as Poros A (Perseptive Biosystems, Inc), and elution at low pH, followed by size exclusion chromatography to remove any traces of aggregate present.
- the binding proteins can be purified to substantial purity if desired, e.g., at least about 80% pure, often at least about 90% pure, more often least about 95%, or at least about 98% pure. In this context, the percent purity is calculated as a weight percent of the total protein content of the preparation, and does not include constituents which are deliberately added to the composition after the binding protein is purified.
- CD16A binding proteins can be modified after expression. For example, derivation of antibodies with polyethylene glycol ("pegylation") is reported to increase residence time (half-life and stability) and reduce immunogenicity in vivo without alteration of biological activity.
- CD16A binding proteins can be conjugated to a detectable label or ligand (e.g., a radioisotope or biotin). Other modifications are well known in the art and are also contemplated.
- CD16 A binding proteins having properties as described below are used in the methods of the invention.
- CD 16A binding proteins can be described by reference to their binding properties and biological activity.
- the binding constant for the interaction of a CD16A binding protein of the invention and CD16A is between 0.1 and 5 nM, less than about 2.5 nM, less than about 1 nM, or less than about 0.5 nM.
- the binding protein binds GDI 6 A with an affinity that is within 4-fold, optionally within 2-fold, of the binding affinity exhibited under similar conditions by 3G8 or the chimeric antibody comprising the heavy chain Ch3G8VH and the light chain Ch3G8VL as described herein below.
- the binding affinity for CD16 A is greater than that of 3G8.
- the binding affinity for CD16B is no greater than, and preferably less than, 3G8 or the chimeric antibody Ch3G8.
- Binding can be measured using a variety of methods, including ELISA, biosensor (kinetic analysis), and radioimmunoassay (RIA). ELISA is well known (see, Harlow and Lane, supra, and Ausubel et al., supra) and can be carried out using conditioned medium containing binding proteins or, alternatively, with purified antibodies. The concentration of antibody that results in 50% apparent maximal binding provides an estimate of antibody Kd. [0110] Binding can also be detected using a biosensor assay, which also provides information on the kinetic and equilibrium properties of antibody binding to Fc ⁇ RIIIA.
- An exemplary biosensor assay uses the BIAcore system (Malmqvist et al, 1997, Curr. Opin. Chem. Biol. 1:378-83).
- the BIAcore system relies on passing analyte over a sensor chip onto which the ligand (e.g., CD16A) is immobilized.
- the binding of the analyte can be measured by following surface plasmon resonance (SPR) signal, which changes in direct proportion to the mass bound to the chip.
- SPR surface plasmon resonance
- a fixed concentration of analyte is passed over the chip for a specific amount of time, allowing for the measurement of the association rate, k(on).
- a radioimmunoassay can be used to measure the affinity of antibodies for Fc ⁇ RIII-bearing cells, and to measure inhibition of IgG complexes to cells by these antibodies.
- I labeled binding protein is prepared and specific radioactivity of the protein determined. Labeled binding protein and cells are mixed for several hours, the cells and bound material are separated from the unbound material by centrifugation, and the radioactivity in both compartments is determined.
- a direct binding format is used to determine the Kd of, and the number of binding sites for, iodinated binding protein using Scatchard analysis of the binding data. Controls containing an excess of cold (unlabeled) binding protein competitor can be included to ensure the results reflect specific interactions.
- Suitable cells include (1) NK cells or macrophages derived from normal human peripheral blood lymphocytes; (2) Cells obtained from huCD16A transgenic mice (Li, 1996 J. Exp. Med. 183:1259-63); (3) mammalian cell lines expressing the extracellular portion of CD16A fused to the transmembrane and intracellular domain of RII or another receptor (such as CD8 or LFA-3); (4) mammalian cell lines (e.g., CHO, HEK-293, COS) transfected transiently or stably with CD16A expression vectors (and optionally coexpressing gamma chain for optimal expression receptor expression).
- NK cells or macrophages derived from normal human peripheral blood lymphocytes
- Cells obtained from huCD16A transgenic mice Li, 1996 J. Exp. Med. 183:1259-63
- mammalian cell lines expressing the extracellular portion of CD16A fused to the transmembrane and intracellular domain of RII or another
- Examples of expression vectors useful for expression of CD 16A and other polypeptides for use in binding assays include mammalian expression vectors (e.g., pCDNA 3.1 or pCI-neo) that contain a strong promoter/enhancer sequence (e.g., CMV immediate early) and a polyadenylation/transcription termination site flanking apolylinker region into which the CD16A gene is introduced.
- mammalian expression vectors e.g., pCDNA 3.1 or pCI-neo
- a strong promoter/enhancer sequence e.g., CMV immediate early
- a polyadenylation/transcription termination site flanking apolylinker region flanking apolylinker region into which the CD16A gene is introduced.
- the vector includes a selectable marker such as a neomycin resistance gene.
- the CD16A expressed for use in assays has the sequence: WQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQ YRVLEKDSVTLKCQGAYSPED NSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLL LQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLK DSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFA VDTGLYFSVKTNIRSSTRDWKDHKFK RKDPQDK (SEQ ID NO:116).
- Blocking Immune Complex Binding to Fc ⁇ RIIIA Another characteristic of the CD16A binding proteins of the invention is the ability to inhibit binding of immune complexes to CD16A ("IC Blocking Activity"). Usually the binding protein has IC Blocking Activity that is within 4- fold, preferably within 2-fold, of the activity exhibited under similar conditions by 3G8 or the chimeric antibody, Ch3G8, described herein. [0116] Assays for measuring ability of an antibody to block binding of complexed IgG to CD16 are known.
- One suitable assay is an RIA assay with the format described above for the competitive assay, but substituting 125 I- labeled aggregated irrelevant human IgGi for the I-labeled 3G8 used in the competitive assay described above.
- the invention provides a method of inhibiting the binding of IgG antibodies to CD 16 on a cell by contacting the cell with a CD16A binding protein under conditions in which the CD16A binding protein binds the Fc ⁇ RIII on the cell.
- the contacting can be in vivo (e.g., by administering the binding protein in a mammal) or in vitro (e.g., by addition of antibodies to cultured cells expressing the Fc ⁇ RIII ).
- IgG antibodies that are inhibited from binding the Fc ⁇ RIII can be administered to the animal or added to a culture medium before or after addition or administration of the binding protein, or may be present in an animal normally or in response to a disease state.
- the CD 16 on the surface of the cell is CD16A.
- the ability of the CD16A binding proteins of the invention to reduce deleterious immune responses can be assessed in a variety of animal models.
- An exemplary model system is a mouse model for idiopathic thrombocytopenic purpura (ITP) (see, Oyaizu et al., 1988, JExp.Med. 167:2017-22; Mizutani et al, 1993, Blood 82:837-44). See Example 9, infra.
- Other suitable models are known in the art.
- Other animal models include rodent models of inflammatory diseases described in, for example, Current Protocols in Immunology (in some cases modified by using animals transgenic for human CD16A). Transgenic mice can be made using routine methods or can be purchased from commercial sources (e.g., Taconic Inc., German Town New York).
- CD16A binding proteins can be administered to muFc ⁇ RIII-/-, huFc ⁇ RIIIA transgenic mice at a variety of concentrations, and ITP subsequently induced in the mice (e.g., by administering the 6A6 or chimeric 6A6 antibody) to the mice.
- ITP subsequently induced in the mice
- the mice are bled and the platelet counts are determined.
- the ICso for each molecule is then determined at the time point where maximal platelet depletion is observed in the negative control group.
- IC 50 S are determined graphically, using a curve-fitting program such as the four-parameter fit provided in the SigmaPlot program. Statistically significant inhibition of depletion of platelets after administration of 6A6 in the treatment group compared to the untreated group and a group administered an identical formulation of an irrelevant, isotype matched mAb is indicative of the desired biological activity.
- Murine 3G8 produced from the hybridoma, and a chimeric version of 3G8 containing an aglycosylated human Gl constant region (Ch3G8-Gl N297Q), produced in HEK-293 cells, were able to protect animals from platelet depletion in the mouse model.
- Ch3G8-Gl N297Q an aglycosylated human Gl constant region
- anti-CD 16A antibodies without effector function have advantages compared to some glycosylated (e.g., glycosylated recombinant) antibodies.
- administration of aglycosylated anti-CD 16A antibody to muFcgRIII-/-, huFcRIIIB transgenic mice did not result in neutrophil depletion in the blood, spleen, and bone marrow. Without intending to be bound by a particular theory, there are several possible explanations for these unexpected results. Protein glycosylation is known to vary in different cell lines, especially those from different species.
- a difference in the nature of the carbohydrate attached to the antibody constant region as a consequence of expression in different cell types may be responsible for the difference in activity, i.e., if the lack of activity results in part from effector cell activation caused by ch3G8 binding to Fc receptors (or complement) via the antibody Fc region in a gly cosy lation-dependent manner.
- recombinant murine and ch3G8 may contain other post-translational modifications that affect activity and which can be eliminated by using different cell lines to express the CD16A binding proteins. It is possible that a combination of isotype and/or isotype containing mutations to eliminate effector function may provide similar protective effects as elimination of the carbohydrate on the Fc.
- a number of diseases and conditions characterized by an deleterious immune response can be treated using the binding proteins of the invention a CD16A binding protein as described herein (e.g., comprising a V L and/or VH sequence as disclosed herein and, optionally, a Fc region modified as disclosed herein to have a reduced effector function).
- the binding protein is administered to a subject with an autoimmune disease (i.e., a disease characterized by the production of autoantibodies). It is believed that pathogenic IgG antibodies observed in autoimmune diseases are either the pathogenic triggers for these diseases or contribute to disease progression and mediate disease through the inappropriate activation of cellular Fc receptors.
- Aggregated autoantibodies and/or autoantibodies complexed with self antigens bind to activating FcRs, thereby triggering the pathogenic sequelae of numerous autoimmune diseases (which occur in part because of immunologically mediated inflammation against self tissues).
- the CD16A binding proteins described herein interfere with and reduce the interaction of the autoimmune antibodies and Fc ⁇ RIII receptors.
- autoimmune diseases examples include, without limitation, idiopathic thrombocytopenic purpura (ITP), rheumatoid arthritis (RA), systemic lupus erythrematosus (SLE), autoimmune hemolytic anemia (AHA), scleroderma, autoantibody triggered urticaria, pemphigus, vasculitic syndromes, systemic vasculitis, Goodpasture's syndrome, multiple sclerosis (MS), psoriatic arthritis, ankylosing spondylitis, Sj ⁇ gren's syndrome, Reiter's syndrome, Kowasaki's disease, polymyositis and dermatomyositis.
- ITP idiopathic thrombocytopenic purpura
- RA rheumatoid arthritis
- SLE systemic lupus erythrematosus
- AHA autoimmune hemolytic anemia
- scleroderma autoantibody triggered urticaria
- diseases or conditions that can be treated according to the invention also include any diseases susceptible to treatment with intravenous immunoglobulin (IVIG) therapy (e.g., allergic asthma).
- IVIG intravenous immunoglobulin
- the treatment of autoimmune diseases heretofore treated by IVIG therapy is contemplated.
- modulating the activity of cellular Fc ⁇ Rs plays a role in its in vivo efficacy.
- the protective activity of IVIG may rely on the small percentage of dimeric or polymeric IgG present in the preparation.
- the specificity of the Fc ⁇ RIII pathway in coupling cytotoxic and immune complex antibodies to effector responses and the ability to directly block this pathway with a mAb strongly suggests that an anti-Fc ⁇ RIII antibody will have enhanced activity relative to IVIG.
- a reduction in a deleterious immune response can be detected as a reduction in inflammation.
- a reduction in a deleterious immune response can be detected as a reduction in symptoms characteristic of the condition being treated (e.g., a reduction in symptoms exhibited by a subject suffering from an autoimmune condition), or by other criteria that will be easily recognized by physicians and experimentalists in the field of automimmunity. It will be apparent that, in many cases, specific indicia of reduction will depend on the specific condition being treated. For example, for illustration and not limitation, a reduction in a deleterious immune response in a subject with ITP can be detected as a rise in platelet levels in the subject.
- the deleterious immune response is optionally due to idiopathic thrombocytopenic purpura resulting from the administration of an antiplatelet antibody, optionally murine monoclonal antibody 6A6, to a muFc ⁇ RIII-/-, huFc ⁇ RIIIA transgenic mouse.
- the invention provides a method for treating an autoimmune disease, such as ITP, by administering a CD16A binding protein that is largely devoid of effector function.
- the CD16A binding protein comprises Fc regions derived from human IgG.
- the Fc regions are aglycosyl.
- the position 297 of each of the C H 2 domains is a residue of than asparagine or proline.
- the binding protein comprises a variable region sequence as described elsewhere herein.
- the compositions and treatment methods of the invention are not limited to specific CD16A binding proteins derived from murine mAb 3G8, but are applicable to CD16A binding proteins in general.
- the CD16A binding protein is a tetrameric antibody protein having two light chains and two heavy chains.
- the invention provides methods of reducing an deleterious immune response in a mammal without significantly reducing neutrophil levels or inducing neutropenia (e.g., severe neutropenia or moderate neutropenia) by administering to the mammal a therapeutically effective amount of a pharmaceutical composition comprising a CD16A binding protein described herein.
- the mammal is human.
- the mammal is a nonhuman mammal (e.g., mouse) comprising one or more human transgenes.
- the binding proteins of the invention are formulated with a pharmaceutically acceptable excipient or carrier, e.g., an aqueous carrier such as water, buffered water, 0.4% saline, 0.3% glycine and the like, optionally including other substances to increase stability, shelf-life or to approximate physiological conditions (sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate, histidine and arginine).
- a pharmaceutically acceptable excipient or carrier e.g., an aqueous carrier such as water, buffered water, 0.4% saline, 0.3% glycine and the like, optionally including other substances to increase stability, shelf-life or to approximate physiological conditions (sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate, histidine and arginine).
- the composition is preferably sterile, and free of pyrogens and other contaminants.
- the concentration of binding protein can vary widely, e.g., from less than about 0.0
- compositions of the invention are typically administered by a parenteral route, most typically intravenous, subcutaneous, intramuscular, but other routes of administration can be used (e.g., mucosal, epidermal, intraperitoneal, oral, intranasal, and intrapulmonary).
- parenteral route most typically intravenous, subcutaneous, intramuscular, but other routes of administration can be used (e.g., mucosal, epidermal, intraperitoneal, oral, intranasal, and intrapulmonary).
- routes of administration e.g., mucosal, epidermal, intraperitoneal, oral, intranasal, and intrapulmonary.
- pharmaceutical compositions are preferably supplied in unit dosage form suitable for administration of a precise amount.
- CD16A binding proteins can be administered in a form, formulation or apparatus for sustained release (e.g., release over a period of several weeks or months).
- polynucleotides encoding CD16A binding proteins e.g., CD16A binding protein expression vectors
- CD16A binding protein expression vectors are administered to a patient. Following administration, the CD16A binding protein is expressed in the patient.
- Vectors useful in administration of CD16A binding proteins can be viral (e.g., derived from adenovirus) or nonviral. Usually the vector will comprise a promoter and, optionally, an enhancer that serve to drive transcription of a protein or proteins.
- Such therapeutic vectors can be introduced into cells or tissues in vivo, in vitro or ex vivo.
- vectors may be introduced into cells, e.g., stem cells, taken from the patient and clonally propagated for autologous transplant back into the same patient (see, e.g., U.S. Patent Nos. 5,399,493 and 5,437,994).
- compositions can be administered for prophylactic and/or therapeutic treatments.
- compositions are administered to a patient prior to an expected or potential deleterious immune response.
- idiopathic thrombocytopenic purpura and systemic lupus erythrematosus are conditions in which an deleterious immune response can be exacerbated by administration of certain medications.
- the CD 16 A binding compositions of the invention can be administered in anticipation of such medication-induced responses to reduce the magnitude of the response.
- compositions are administered to a patient already suffering from an deleterious immune response in an amount sufficient to at least partially ameliorate the condition and its complications.
- An amount adequate to accomplish this may be a "therapeutically effective amount” or “therapeutically effective dose.” Amounts effective for these uses depend upon the severity of the condition and the general state of the patient's own immune system, but generally range from about 0.01 to about 100 mg of antibody per dose, with dosages of from 0.1 to 50 mg and 1 to 10 mg per patient being more commonly used.
- An "inflammation reducing amount" of the binding protein can also be administered to a mammal to reduce a deleterious immune response.
- the administration of the CD 16A binding proteins can be administered according to the judgement of the treating physician, e.g., daily, weekly, biweekly or at any other suitable interval, depending upon such factors, for example, as the nature of the ailment, the condition of the patient and half-life of the binding protein.
- CD 16A binding proteins can be administered in combination other treatments directed to alleviation of the deleterious immune response or its symptoms or sequalae.
- the binding proteins can be administered as part of a therapeutic regimen that includes co-administration of another agent or agents, e.g., a chemotherapeutic agent such as a non-steroidal anti-inflammatory drug (e.g., aspirin, ibuprofen), steroids (e.g., a corticosteroid, prednisone), immunosuppressants (e.g., cyclosporin A, methotrexate cytoxan), and antibodies (e.g., in conjunction with IVIG).
- a chemotherapeutic agent such as a non-steroidal anti-inflammatory drug (e.g., aspirin, ibuprofen), steroids (e.g., a corticosteroid, prednisone), immunosuppressants (e.g., cyclosporin A, methotrexate cytoxan), and
- the invention provides a method for increasing the therapeutic efficacy of a CD16A binding protein comprising one or more Fc domains (e.g., anti-CD16A antibodies comprising two Fc domains) by modifying the protein so that it has Fc region(s) with reduced binding to at least one Fc effector ligand compared to the original (i.e., unmodified) Fc region.
- the Fc region can be modified so that the Fc region is not glycosylated.
- modification of the Fc region can be accomplished in several ways (e.g., by genetic mutation, by choice of expression system to change the Fc glycosylation pattern, and the like).
- the Fc effector ligand is Fc ⁇ RIII.
- the Fc effector ligand is the Clq component of complement.
- a subject CD16A binding protein has increased "therapeutic efficacy" compared to a reference binding protein that induces neutropenia when administered if the subject CD16A binding protein does not induce neutropenia (or results in less severe neutropenia).
- a CD16A binding protein that reduces the severity of an deleterious immune response e.g., ITP or experimentally induced ITP in a mammal
- reduces neutrophil levels in the animal by x% has greater "therapeutic efficacy" than a CD16A binding protein that reduces the severity of an deleterious immune response and reduces neutrophil levels in the animal by y%, if y is greater than x, e.g. two-fold greater.
- the protein is modified by mutation such that the modified protein is aglycosylated.
- the invention provides methods for producing a modified CD 16 binding protein comprising a modified immunoglobulin heavy chain, the modified CD 16 binding protein having greater therapeutic efficacy than a parent CD 16 binding protein comprising a parent immunoglobulin heavy chain, by (i) introducing at least one mutation into a parent polynucleotide that encodes the parent immunoglobulin heavy chain to produce a modified polynucleotide that encodes the modified immunoglobulin heavy chain, the mutation introducing into the modified immunoglobulin heavy chain an amino acid substitution that changes, reduces or eliminates glycosylation in the CH2 domain of the parent immunoglobulin heavy chain; and (ii) expressing the modified polynucleotide in a cell as the modified immunoglobulin heavy chain so as to produce the modified CD 16 binding protein heavy chain.
- the heavy chain is produced under conditions of co-expression with a light chain to produce a tetrameric antibody.
- Example 1 Mouse 3G8 VH and VL and Chimeric Molecules Generated Therefrom A) Mouse 3G8 VH and VL [0134] The cDNA encoding the mouse 3G8 antibody light chain was cloned. The sequence of the 3G8 antibody heavy chain was provided by Dr. Jeffry Ravetch. The amino acid sequences of the 3G8 V H and V L are provided in Tables 1 and 3, infra. Nucleic acid sequences encoding the variable regions are:
- This construct was inserted into the pCI-Neo (Promega Biotech) at the Nhel-EcoRI sites of the polylinker for use for expression of the chimeric heavy chain in cells.
- this 3G8 V L segment was fused to a signal sequence (as for the V H above; (lower case underlined) and a human CK constant region (lower case) cDNA using standard techniques, resulting in a nucleic acid with the sequence shown below:
- This construct was inserted into pCI-Neo (Promega Biotech) at the Nhel-Eco ⁇ sites of the polylinker for use for expression of the chimeric light chain in cells.
- the ch3G8VH and ch3G8VL chimeric proteins described above can be co-expressed to form a chimeric antibody, referred to as ch3G8.
- the chimeric antibody ch3G8 can be expressed either in a myeloma or in other mammalian cells (e.g., CHO, HEK-293).
- An example of a procedure for expression of CD16A binding proteins such as ch3G8 and variants is provided in Example 4, infra.
- A) Humanized Heavy Chain [0140] CDR encoding sequences from the mouse 3G8 V H clone were fused to framework sequences derived from the human germline VH sequence VH2-70 to create a polynucleotide encoding a V H designated Hu3G8VH. The polynucleotide was generated by an overlapping PCR procedure. In a first step, using the primers and strategy shown below and the mouse 3G8 V H polynucleotide (SEQ ID NO: 1) as template.
- the resulting fragment was digested with EcoRI and S ⁇ cl and cloned into pUCl 8. After sequencing, one plasmid was selected for a final round of overlapping PCR to correct a deletion which occurred during the second PCR step.
- the resulting polynucleotide had the sequence: SEQ ID NO:16 ⁇ hu3G8VH ⁇
- the Hu3G8VH sequence was then combined with segments coding for a secretion signal sequence (as described above; lower case underline) and cDNA for the human C ⁇ l constant region (lower case).
- the resulting polynucleotide had the sequence:
- CDR encoding sequences from the mouse 3G8 V L clone were fused to framework sequences derived from the human B3 germline V- ⁇ gene.
- the polynucleotide was generated by an overlapping PCR procedure using the primers and strategy shown below and the mouse 3G8 V L polynucleotide (S ⁇ Q ID NO: 2) as template.
- Hu3G8 VL gene segment was combined with a signal sequence (as described above, lower case, underline) and a human C- ⁇ constant region (lower case) cDNA using standard techniques resulting in a product with the sequence below:
- This construct was inserted into pCI-Neo for expression in mammalian cells.
- Example 3 Variant CD16A binding proteins [0148] Additional expression constructs were made in which sequence changes were introduced in the VL or V H domains by site directed mutagenesis.
- a typical mutagenesis reaction contained 10 ng plasmid DNA (isolated from a methylation competent strain of E. coli), 125 ng each of a forward and reverse primer, each containing the mutation of interest, reaction buffer, and dNTPs in 0.05 ml volume. 2.5 units of PfuTurbo DNA polymerase (Stratagene) was added and the reaction was subjected to 15 cycles of 95°, 30 sec; 55°, 1 min; 68°, 12 min.
- the product of the PCR was then digested with Dpnl endonuclease and the restricted DNA was used to transform E. coli strain XL- 10 gold. Because Dpnl only digests methylated DNA it will digest the parental, non-mutated, plasmid leaving the newly synthesized non-methylated product, containing the mutation of interest, as the predominant species.
- the sequences of the variant V H domains are shown in Table 3.
- the sequences of the variant V L domains are shown in Table 4.
- Example 4 Expression in Mammalian cells
- Various combinations of heavy and light chain expression plasmids e.g., comprising the chimeric, humanized and variant VL and VH domains fused to human C ⁇ l and CK constant domains as described above
- recombinant tetrameric antibodies i.e., comprising 2 heavy chains and 2 light chains
- Transfection was carried out using Lipofectamine- 2000 (Invitrogen) in 6 well plates according to the manufacturer's instructions.
- Recombinant antibodies were prepared by cotransfection of a heavy chain expression plasmid (i.e., encoding a heavy chain comprising a V H and constant domains) and light chain expression plasmids (i.e., encoding a light chain comprising a V L and constant domains) together into HEK-293 cells for transient expression of recombinant antibodies.
- a heavy chain expression plasmid i.e., encoding a heavy chain comprising a V H and constant domains
- light chain expression plasmids i.e., encoding a light chain comprising a V L and constant domains
- Hu3G8VH variants listed in Table 3 were coexpressed with the hu3G8VL-l light chain.
- most assays included (i) recombinant antibodies produced by coexpression of ch3G8VH and ch3G8VL ("ch3G8VH/ch3G8VL") and (ii) recombinant antibodies produced by coexpression of hu3G8VH-l and hu3G8VL-l ("hu3G8VH-l/hu3G8VL-l").
- Hu3G8VL variants listed in Table 4 were coexpressed with the ch3G8VH heavy chain.
- Example 5 ELISA Determination of Binding to CD16A [0155] Sandwich ELISA was performed to detect binding of antibodies to a soluble form of CD 16 A.
- a soluble form of human CD16A was expressed from HEK-293 cells using a pcDNA3.1 -derived expression vector containing the CD16A gene truncated just prior to the transmembrane region. To create the vector, cDNA encoding CD16A was amplified using the primers 3A left
- the secreted product was purified from conditioned medium using affinity chromatography on a human IgG Sepharose column.
- the amount of sCD16A in conditioned medium was quantitated and unpurified sCD16A was used. Purification was not required since the ELISA capture antibody (LNK16 mAb) specifically bound the antigen, allowing removal of contaminants in washing steps.
- CD16A gene CD16A gene
- ELISA format Plates were first coated with 100 ng/well of the anti-CD 16 mAb LNK- 16 (Advanced ImmunoChemical, Long Beach CA; see 5th Human Lymphocyte Differentiation Antigens Workshop) in carbonate buffer at room temperature for 2 hrs. Any anti-sCD16A antibody that does not block binding by 3G8 can be used. After blocking for 30 minutes with PBS-T-BSA, sCD16A conditioned medium was added at a dilution of 1/10 and incubated at room temperature for 16 hrs. Alternatively, when purified sCD16 was used, it was diluted to a concentration of 50 ng/ml in PBS-T-BSA. 0.05 ml was added to each well and incubated for at least 2 hrs at room temperature.
- the plate was washed and dilutions of recombinant antibodies starting at 0.5 ⁇ g/ml in PBS-T-BSA were then added and incubated for 1 hr at room temp. Binding of recombinant antibodies to the captured sCD16A was then measured using an anti-human IgG-HRP conjugate and TMB substrate. After stopping color development using dilute sulfuric acid, the plate was read at 450 nM.
- the recombinant antibodies were classified as binding with high, intermediate, or low affinity. Antibodies with high and intermediate binding affinity are discussed above in section 4.
- the recombinant antibodies with a N H domain of hu3G8VH- 9, 10, 11, 13, 15, 21, 38, 39, or 41 showed little or no binding to sCD16A. From these data it appears certain substitutions (or combinations of substitutions) are generally detrimental to binding. For example, substitution of tyrosine or aspartic acid at V H position 52 (i.e., 52Y and 52D) or threonine at position 94 (94T) are detrimental to binding.
- the combination leucine at position 50 with aspartic acid at position 54 is detrimental to binding, as is the combination arginine at 94 and aspartic acid at 101 (94R+101D).
- aspartic acid at 101 is tolerated when position 94 is glutamine, lysine, histidine or alanine (but not arginine).
- 34V+94R+101D has intermediate activity. This indicates a relationship between positions 34, 94 and 101 in maintaining high affinity binding, and suggests that 34V may be an especially important residue.
- recombinant antibodies with a V L domain of hu3G8VL-6, 7, 8, 9, 11, 12, 13, and 14 showed little or no binding to sCD16A.
- ch4-4-20 or ch4-4-20 (D265 A) was assessed by ELISA.
- Ch4-4-20 is identical to Ch3G8 except that it contains the respective VH and VL regions of 4-4-20 instead of those of 3G8. Thus it retains high affinity and specificity for the hapten fluorescein. 4-4-20 is described in Bedzyk et al., 1989, JBiol Chem 264: 1565-9.
- FITC-BSA (1 ug/ml - 50 ng/well) was coated onto Nunc maxisorb immunoplates in carbonate buffer and allowed to bind for approximately 16 hr.
- ch4-4-20 Following blocking with BSA, dilutions of ch4-4-20 were added to the wells and allowed to bind for 1 hr at RT. After washing out unbound Mab, HRP-conjugated goat anti-human Ig secondary was added. One hour later the secondary antibody was removed, washed and developed with TMB substrate. Following addition of an acidic stop solution the plate was read at 450nm. Both ch4-4-20 and ch4-4-20(D265A) bound to the FITC-BSA with high affinity (data not shown).
- Example 8 Analysis of anti-CD 16A Monoclonal Antibody Panel
- a panel of hybridomas was generated following immunizing and boosting mice with sCD16A using standard methods. Eight 96-well plates were screened by ELISA for binding activity on plates coated directly with sCD16A. Ninety-three of these gave a positive signal and were expanded further. Of these, 37 were positive for binding to human blood cells by FACS. These supernatants were then analyzed for their ability to block the interaction of CD16A with immune complexes and for the similarity of the binding site (epitope) to that of 3G8. Assays included capture ELISA using chimeric 3G8 down and inhibition of immune complex binding to sRIIIa-Ig.
- DJ130c (DAKO) and 3G8 were used as controls in the assays.
- Mab DJ130c is a commercially available Mab which binds CD 16 at an epitope distinct from 3G8 (Tamm and Schmidt). This Mab does not block FcRIIIa-immune complex binding (Tamm and Schmidt).
- ELISA-based inhibition assay In an ELISA-based inhibition assay,
- the data indicate that the panel contains antibodies which bind to the same epitope as Ch3G8 and block sCD16A binding to immune complexes.
- the panel of Mabs also contains antibodies which do not bind to the same epitope as Ch3G8. Most of these latter antibodies do not block the interaction of sCD16a with IgG in immune complexes.
- Example 9 Induction of Platelet Depletion In Vivo [0174]
- the in vivo activity of a CD 16A binding protein for blocking human Fc-Fc ⁇ RIII interactions induced by autoantibodies can be evaluated using animal models of autoimmune diseases.
- One suitable model is the "passive mouse model" of ITP and the anti-platelet mAb 6A6 (see, Oyaizu et al., 1988, J Exp.Med. 167:2017-22; Mizutani et al, 1993, Blood 82:837-44).
- 6A6 is an IgG2a isotype mAb derived from a NZW x BSXB FI individual.
- 6A6 depletes platelets in muFc ⁇ RIII -/-, huFc ⁇ RIIIA transgenic mice but not in muFc ⁇ RIII -/- mice without the human transgene. See Samuelsson et al., 2001, Science 291 :484-86.
- Other anti-platelet monoclonal antibodies can be used in place of 6A6 in the model.
- a polyclonal anti-platelet antibody can be used.
- CD16A binding proteins that confer the greatest degree of protection from platelet depletion can be identified by administrating CD16A binding proteins to a muFc ⁇ RIII -/-, huFc ⁇ RIIIA transgenic mouse and measuring any reduction in mAb 6A6 induced platelet depletion.
- a related assay can be carried out using a chimeric human IgGiK chimeric derivative of 6A6 in place of the mouse mAb in the protocol provided above, so that the depleting mAb had a human isotype.
- a chimeric 6A6 monoclonal antibody (ch6A6) was prepared by fusing the cDNA segments encoding the murine anti-platelet monoclonal antibody 6A6 V H and VL regions to the human C ⁇ l and CK CD A segments, respectively.
- the resulting genes were co-expressed in 293 cells and chimeric 6A6 was purified by protein A affinity chromatography followed by size exclusion chromatography.
- ch6A6 was administered to muFc ⁇ RIII 7" , huFc ⁇ RIIIA transgenic mice.
- the ch6A6 was administered to each animal either i.v. or intraperitoneally (i.p.) (O.l ⁇ g/g). Animals were bled 2 hrs, 5 hrs, 24 hrs and 48 hrs after administration of ch6A6, and plasma platelet counts were determined using a Coulter Z2 particle counter and size analyzer equipped with a 70 ⁇ m aperture.
- Particles between 1.5 and 4 ⁇ m in size were counted and the data were analyzed by plotting the platelet count versus time for each concentration.
- CD16A binding proteins were administered intravenously (i.v.) to groups of muFc ⁇ RIir " , huFc ⁇ RIIIA transgenic mice at concentrations of 0.5, 1, 2 or 5 ⁇ g/g in phosphate buffered saline (PBS). Controls were PBS alone or an irrelevant human IgGl (negative control) or human intravenous immunoglobulin (IVIG; positive control).
- PBS phosphate buffered saline
- ITP insulin receptor tetrachloride
- Plasma platelet counts were determined using the Coulter Z2 particle counter and size analyzer as described above and the data were analyzed by plotting the platelet count versus time for each concentration of administered binding protein.
- Example 11 Ch3G8 N297O Protects Mice from ch6A6-Mediated Platelet
- ch3G8- ⁇ l An aglycosylated version of ch3G8- ⁇ l was prepared by mutating the expression polynucleotide encoding ch3G8- ⁇ l so that residue 297 was changed from asparagine (N) to glutamine acid (Q), and expressing the encoded antibody. Residue 297 lies in an N-linked glycosylation site, and this mutation prevents glycosylation of the Fc domain at this site.
- This aglycosylated antibody, ch3G8 N297Q was produced in HEK-293 cells as described for ch3G8- ⁇ l (see Example 4, supra).
- ch3G8-N297Q was consistently able to significantly improve platelet counts. Binding of 3G8 to human CD 16 on effector cells blocks the ability of CD 16 to interact with immune complexes and trigger effector functions such as ADCC or phagocytosis. Chimeric and mouse 3G8 molecules have similar ability to bind CD 16 and are similar in their ability to inhibit the binding of sCD16 to immune complexes in vitro. Without intending to be bound by a particular mechanism, the binding (and thus) the blocking activity of the mAb is thought to be confined to the Fab portion of the antibody and blocking of huCD16 is believed to be the mechanism of protection in the transgenic mouse ITP model.
- CD16A binding proteins or the controls such as irrelevant human IgGl (negative control) or murine RB6-8C5 (positive control), were administered to groups of muFc ⁇ RIIF " , huFc ⁇ RIIIB transgenic mice at a concentration of 5 ⁇ g/g in phosphate buffered saline (PBS). Another negative control was administered PBS alone. Twenty four hours later, mice were euthanized and blood, spleen and bone marrow are collected. Neutrophils were analyzed by FACS.
- Example 13 Autoimmune Hemolytic Anemia Model
- Hu3G8-5.1-N297Q is an aglycosy antibody with the heavy chain Hu3G8VH-5 and the light chain Hu3G8VH-l and the indicated substitution of asparagine 297.
- Mice were bled on day 0 and RBC levels were determined using a Coulter Z2 particle analyzer. The next day groups of 3 animals each were then injected intravenously with either 0.5 mg/kg Hu3G8-5.1-N297Q or PBS. One group of mice did not receive any compound.
- RBC depletion was induced in the first two groups by administering mouse anti-RBC IgG2a Mab 34- 3C to each animal intraperitoneally (i.p.) (2.5 mg/kg). Animals were bled 2 hrs, 5 hrs, 24 hrs and 48 hrs after administration of 34-3C and RBC counts were determined. Data was analyzed by plotting RBC count versus. The data, depicted in Figure 11, demonstrate the ability of Hu3G8-5.1-N297Q to prevent RBC depletion in this model.
- Example 14 Inhibition of Antibody-Dependent Cellular Cytotoxicity (ADCC) [0194] This example demonstrates that humanized 3G8 variants inhibit ADCC in vitro and with an activity similar to that of mouse 3G8. [0195] Methods: The protocol for assessment of antibody dependent cellular cytotoxicity (ADCC) is similar to that previously described in (Ding et al., 1998, Immunity 8:403-11).
- target cells from the HER2-overexpressing breast cancer cell line SK-BR-3 were labeled with the europium chelate bis(acetoxymethyl) 2,2':6',2"-te yridine-6,6"-dicarboxylate (DELFIA BATDA Reagent, Perkin Elmer/Wallac).
- the labeled target cells were then opsonized (coated) with either chimeric anti-HER2 (ch4D5, lOOng/ml) or chimeric anti- fluorescein (ch4-4-20, lug/ml) antibodies.
- chimeric anti-HER2 ch4D5, lOOng/ml
- chimeric anti- fluorescein ch4-4-20, lug/ml
- PBMC Peripheral blood mononuclear cells
- Ficoll- Paque Amersham Pharmacia gradient centrifugation
- cell supernatants were harvested and added to an acidic europium solution (DELFIA Europium Solution, Perkin Elmer/Wallac).
- DELFIA Europium Solution Perkin Elmer/Wallac
- the fluorescence of the Europium-TDA chelates formed was quantitated in a time-resolved fluorometer (Victor2 1420, Perkin Elmer/Wallac).
- Inhibition of the ch4D5 mediated ADCC was greater than 50% at 300ng/ml for all 3G8 variants tested while isotype control antibodies had no effect in the assay.
- In the case of the anti-fluorescein antibody inhibition was approximately 50% at concentrations above lug/ml for murine 3G8 ( Figure 13A) and humanized 3G8 variants ( Figure 13B), while isotype control antibodies and chimeric 3G8 had little effect.
- Example 15 Administration of Hu3G8-5.1-N297Q Prevents Immune Thrombocvtopenia (ITP) in huFcRIIa+. huFcRIIIa+ mice [0197]
- This example shows that that administration of anti-CD 16 A antibodies protects against ITP mediated by CD32A.
- administration of the ch6A6 antibody induces ITP in Fc ⁇ RIII-/-, hCD32A transgenic mice. Five hours after injection of 0.1 ⁇ g/g ch6A6 i.p., approximately 80%) of the platelets are depleted (not shown).
- ch6A6 induces ITP in Fc ⁇ RIII-/-, hCD16A, hCD32A double transgenic mice. Five hours after injection of 0.1 ⁇ g/g ch6A6 i.p., approximately 80% of the platelets were depleted ( Figure 14). The number of platelets remained low for 24 hours after ch6A6 injection, and then progressively increased to return to normal 48 hours after ch6A6 injection. [0199] In contrast to Fc ⁇ RIII-/-, hCD32A mice, Fc ⁇ RIII-/-, hCD 16A, hCD32A mice were protected against ITP by administration of hu3G8-5.1.
- Hu3G8-5.1-N297Q was produced in a CHO-S cell line.
- the ability of this antibody to protect against ITP in Fc ⁇ RIII-/-, hCD16A single fransgenic mice was determined using the procedure described in Example 13. As is shown in Figure 15, administration of 0.5mg/kg or more Hu3G8-5.1-N297Q produced in CHO-S cells one hour prior to ch6A6 i.p.injection completely protects mice against ITP.
- Example 17 Therapeutic Effect of Aglycosylated Humanized Antibodies
- ITP was induced in mice as described above, by i.p. injection of O.lug/g ch6A6 at time 0. Two hours later, the number of platelets in the plasma was determined to confirm the presence of ITP. Three hours after i.p. injection of ch6A6, mice were injected i.v. with hu3G8-5.1-N297Q at different concentration (arrow). The results ( Figure 16 A) indicate that the number of platelets rapidly returns to normal after Hu3G8-5.1-N297Q injection whereas the number of platelets remains low in non-treated mice. These results demonstrate that administration of the hu3G8-5.1-N297Q antibody can be used to cure ITP in the mouse model.
- mice were injected i.v. with hu3G8-22.1-N297Q or hu3G8-22.43-N297Q at 0.5ug/g (arrow).
- the results indicate that the number of platelets rapidly returns to normal after Hu3G8-22.1-N297Q injection whereas the number of platelets remains low in non-treated mice and in mice treated with Hu3G8-22.43-N297Q ( Figure 16B).
- Example 18 Therapeutic Effect of Hu3G8-22.1-N297O in AHA in muFc ⁇ RIII-/-.
- huFc ⁇ RIIIA transgenic mice [0203] In this experiment, AHA was induced by i.p. injection of 50 ug mouse anti-RBC IgG2a Mab 34-3C at day 0. On day 1, the number of RBC in the blood was determined to confirm the presence of AHA. Two hours later, mice were injected i.v. with Hu3G8-22.1-N297Q at various concentrations (arrow).
- Hu3G8VL-43 (SEQ IDNO:100)
- Hu3G8VH-5 (SEQ IDNO:108)
- Hu3G8VH-5 (SEQ IDNO:109)
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Diabetes (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (8)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AT03756297T ATE483472T1 (en) | 2002-05-30 | 2003-05-29 | CD16A BINDING PROTEINS AND USE IN THE TREATMENT OF IMMUNE DISEASES |
BRPI0311471-6A BR0311471A (en) | 2002-05-30 | 2003-05-29 | anti-cd16a antibody, and methods for reducing a deleterious immune response in a mammal and treating a deleterious immune response in a mammal |
EP03756297A EP1513554B9 (en) | 2002-05-30 | 2003-05-29 | Cd16a binding proteins and use for the treatment of immune disorders |
AU2003232456A AU2003232456B2 (en) | 2002-05-30 | 2003-05-29 | CD16A binding proteins and use for the treatment of immune disorders |
CA002487932A CA2487932A1 (en) | 2002-05-30 | 2003-05-29 | Cd16a binding proteins and use for the treatment of immune disorders |
JP2004508840A JP4524181B2 (en) | 2002-05-30 | 2003-05-29 | CD16A binding protein and use for treatment of immune disorders |
DE60334453T DE60334453D1 (en) | 2002-05-30 | 2003-05-29 | CD16A BINDING PROTEINS AND USE FOR THE TREATMENT OF IMMUNE DISEASES |
HK05107100.7A HK1074991A1 (en) | 2002-05-30 | 2005-08-16 | Cd16a binding proteins and use for the treatment of immune disorders cd16a |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US38468902P | 2002-05-30 | 2002-05-30 | |
US60/384,689 | 2002-05-30 | ||
US43932003P | 2003-01-10 | 2003-01-10 | |
US60/439,320 | 2003-01-10 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2003101485A1 true WO2003101485A1 (en) | 2003-12-11 |
Family
ID=29715346
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2003/017111 WO2003101485A1 (en) | 2002-05-30 | 2003-05-29 | Cd16a binding proteins and use for the treatment of immune disorders |
Country Status (10)
Country | Link |
---|---|
US (4) | US7351803B2 (en) |
EP (1) | EP1513554B9 (en) |
JP (1) | JP4524181B2 (en) |
AT (1) | ATE483472T1 (en) |
AU (1) | AU2003232456B2 (en) |
BR (1) | BR0311471A (en) |
CA (1) | CA2487932A1 (en) |
DE (1) | DE60334453D1 (en) |
HK (1) | HK1074991A1 (en) |
WO (1) | WO2003101485A1 (en) |
Cited By (64)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005003175A3 (en) * | 2003-06-13 | 2005-03-17 | Biogen Idec Inc | Aglycosyl anti-cd154 (cd40 ligand) antibodies and uses thereof |
EP1532250A1 (en) * | 2002-06-07 | 2005-05-25 | Arthron Limited | Fcyriia transgenic animal model for autoimmune disease |
JP2005278633A (en) * | 2004-03-04 | 2005-10-13 | Hiroshima Univ | Method for producing chicken type monoclonal antibody, and chicken type monoclonal antibody produced by the production method |
JP2006025695A (en) * | 2004-07-15 | 2006-02-02 | Wako Pure Chem Ind Ltd | ANTIBODY SPECIFIC TO Fcgamma RECEPTOR IIIa AND METHOD FOR MEASURING Fcgamma RECEPTOR IIIa BY USING THE SAME |
WO2006125668A3 (en) * | 2005-05-26 | 2007-03-22 | Syngenta Crop Protection Ag | Anti-cd16 binding molecules |
EP1766396A2 (en) * | 2004-06-07 | 2007-03-28 | Ramot at Tel-Aviv University Ltd. | Method of passive immunization against disease or disorder characterized by amyloid aggregation with diminished risk of neuroinflammation |
EP1868650A2 (en) * | 2005-04-15 | 2007-12-26 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US7863419B2 (en) | 2003-08-22 | 2011-01-04 | Biogen Idec Ma Inc. | Antibodies having altered effector function and methods for making the same |
EP2272533A1 (en) | 2003-01-13 | 2011-01-12 | MacroGenics, Inc. | Soluble FcyR fusion proteins and methods of use thereof |
EP2426150A1 (en) | 2006-06-30 | 2012-03-07 | Novo Nordisk A/S | Anti-NKG2A antibodies and uses thereof |
EP2476705A1 (en) | 2004-12-28 | 2012-07-18 | Innate Pharma | Monoclonal antibodies against NKG2A |
AU2011224032B2 (en) * | 2003-06-13 | 2013-01-31 | Biogen Ma Inc. | Aglycosyl Anti-CD154 (CD40 Ligand) Antibodies and Uses Thereof |
EP2628753A1 (en) | 2008-01-24 | 2013-08-21 | Novo Nordisk A/S | Humanized anti-human NKG2A monoclonal antibody |
US8647625B2 (en) | 2004-07-26 | 2014-02-11 | Biogen Idec Ma Inc. | Anti-CD154 antibodies |
EP2769993A1 (en) | 2007-12-14 | 2014-08-27 | Novo Nordisk A/S | Antibodies against human NKG2D and uses thereof |
US8993730B2 (en) | 2008-04-02 | 2015-03-31 | Macrogenics, Inc. | BCR-complex-specific antibodies and methods of using same |
US9096877B2 (en) | 2009-10-07 | 2015-08-04 | Macrogenics, Inc. | Fc region-containing polypeptides that exhibit improved effector function due to alterations of the extent of fucosylation, and methods for their use |
US9150656B2 (en) | 2010-03-04 | 2015-10-06 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
US9284375B2 (en) | 2005-04-15 | 2016-03-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
WO2016062851A1 (en) | 2014-10-23 | 2016-04-28 | Innate Pharma | Treatment of cancers using anti-nkg2a agents |
US9376495B2 (en) | 2011-05-21 | 2016-06-28 | Macrogenics, Inc. | Deimmunized serum-binding domains and their use in extending serum half-life |
US9441049B2 (en) | 2010-03-04 | 2016-09-13 | Macrogenics, Inc. | Antibodies reactive with B7-H3 and uses thereof |
US9487587B2 (en) | 2013-03-05 | 2016-11-08 | Macrogenics, Inc. | Bispecific molecules that are immunoreactive with immune effector cells of a companion animal that express an activating receptor and cells that express B7-H3 and uses thereof |
WO2017064043A1 (en) | 2015-10-12 | 2017-04-20 | Innate Pharma | Cd73 blocking agents |
WO2017125532A1 (en) | 2016-01-21 | 2017-07-27 | Innate Pharma | Neutralization of inhibitory pathways in lymphocytes |
WO2017142928A1 (en) | 2016-02-17 | 2017-08-24 | Macrogenics, Inc. | Ror1-binding molecules, and methods of use thereof |
WO2017153433A1 (en) | 2016-03-08 | 2017-09-14 | Innate Pharma | Siglec neutralizing antibodies |
WO2017157948A1 (en) | 2016-03-14 | 2017-09-21 | Innate Pharma | Anti-cd39 antibodies |
WO2017180813A1 (en) | 2016-04-15 | 2017-10-19 | Macrogenics, Inc. | Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
US9822181B2 (en) | 2013-08-23 | 2017-11-21 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding CD123 and CD3, and uses thereof |
WO2017214092A1 (en) | 2016-06-07 | 2017-12-14 | Macrogenics, Inc. | Combination therapy |
US9889197B2 (en) | 2005-04-15 | 2018-02-13 | Macrogenics, Inc. | Covalently-associated diabody complexes that possess charged coil domains and that are capable of enhanced binding to serum albumin |
US9908938B2 (en) | 2013-03-14 | 2018-03-06 | Macrogenics, Inc. | Bispecific molecules that are immunoreactive with immune effector cells that express an activating receptor and an antigen expressed by a cell infected by a virus and uses thereof |
US9932400B2 (en) | 2013-08-23 | 2018-04-03 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding to gpA33 and CD3, and uses thereof |
WO2018065552A1 (en) | 2016-10-06 | 2018-04-12 | Innate Pharma | Anti-cd39 antibodies |
US9963510B2 (en) | 2005-04-15 | 2018-05-08 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
WO2018083080A2 (en) | 2016-11-04 | 2018-05-11 | Innate Pharma | Nkp46 ligand |
WO2018141959A1 (en) | 2017-02-06 | 2018-08-09 | Innate Pharma | Immunomodulatory antibody drug conjugates binding to a human mica polypeptide |
WO2018167267A1 (en) | 2017-03-16 | 2018-09-20 | Innate Pharma | Compositions and methods for treating cancer |
WO2019011855A1 (en) | 2017-07-10 | 2019-01-17 | Innate Pharma | Siglec-9-neutralizing antibodies |
WO2019011852A1 (en) | 2017-07-10 | 2019-01-17 | Innate Pharma | Combination therapy using antibody to human siglec-9 and antibody to human nkg2a for treating cancer |
US10344092B2 (en) | 2013-08-09 | 2019-07-09 | Macrogenics, Inc. | Bi-specific monovalent Fc diabodies that are capable of binding CD32B and CD79b and uses thereof |
WO2019175182A1 (en) | 2018-03-13 | 2019-09-19 | Innate Pharma | Treatment of head and neck cancer |
WO2019206974A1 (en) | 2018-04-24 | 2019-10-31 | Innate Pharma | Methods for treating cancer by targeting nidogen-1 |
WO2019219658A1 (en) | 2018-05-15 | 2019-11-21 | Medimmune Limited | Treatment of cancer |
WO2019243252A1 (en) | 2018-06-18 | 2019-12-26 | Innate Pharma | Compositions and methods for treating cancer |
WO2020028656A1 (en) * | 2018-08-01 | 2020-02-06 | Nantkwest, Inc. | A quadricistronic system comprising a homing receptor or a cytokine, and chimeric antigen receptor for genetic modification of immunotherapies |
WO2020035345A1 (en) | 2018-08-14 | 2020-02-20 | Innate Pharma | Treatment of colorectal cancer by a combination of an anti-mica antibody and an anti-nkg2a antibody |
US10662253B2 (en) | 2008-01-31 | 2020-05-26 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Antibodies against human CD39 and use thereof for inhibiting T regulatory cells activity |
WO2020136145A2 (en) | 2018-12-26 | 2020-07-02 | Innate Pharma | Leucocyte immunoglobulin-like receptor neutralizing antibodies |
US10717778B2 (en) | 2014-09-29 | 2020-07-21 | Duke University | Bispecific molecules comprising an HIV-1 envelope targeting arm |
WO2020216697A1 (en) | 2019-04-23 | 2020-10-29 | Innate Pharma | Cd73 blocking antibodies |
EP3736294A2 (en) | 2014-10-10 | 2020-11-11 | Innate Pharma | Cd73 blockade |
WO2020225552A1 (en) | 2019-05-06 | 2020-11-12 | Medimmune Limited | Combination of monalizumab, durvalumab, chemotherapy and bevacizumab or cetuximab for the treatment of colorectal cancer |
US10954301B2 (en) | 2015-12-14 | 2021-03-23 | Macrogenics, Inc. | Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof |
EP3799885A1 (en) | 2014-09-16 | 2021-04-07 | Innate Pharma | Neutralization of inhibitory pathways in lymphocytes |
WO2021116277A1 (en) * | 2019-12-10 | 2021-06-17 | Institut Pasteur | New antibody blocking human fcgriiia and fcgriiib |
US11230699B2 (en) | 2020-01-28 | 2022-01-25 | Immunitybio, Inc. | Chimeric antigen receptor-modified NK-92 cells targeting EGFR super-family receptors |
US11242402B2 (en) | 2016-12-23 | 2022-02-08 | Macrogenics, Inc. | ADAM9-binding molecules, and methods of use thereof |
WO2022033978A2 (en) | 2020-08-13 | 2022-02-17 | Innate Pharma | Cancer treatment methods using anti-cd73 antibodies |
US11254748B2 (en) | 2005-04-15 | 2022-02-22 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US11384149B2 (en) | 2013-08-09 | 2022-07-12 | Macrogenics, Inc. | Bi-specific monovalent Fc diabodies that are capable of binding CD32B and CD79b and uses thereof |
WO2023118241A1 (en) | 2021-12-20 | 2023-06-29 | Vetoquinol Sa | Anti-canine interleukine-31-receptor a (il-31ra) antibodies and the uses thereof |
WO2023227660A1 (en) | 2022-05-25 | 2023-11-30 | Innate Pharma | Nectin-4 binding agents |
Families Citing this family (41)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU2003232456B2 (en) * | 2002-05-30 | 2009-06-04 | Macrogenics, Inc. | CD16A binding proteins and use for the treatment of immune disorders |
WO2006081171A1 (en) * | 2005-01-24 | 2006-08-03 | Amgen Inc. | Humanized anti-amyloid antibody |
WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
EP1907002A2 (en) * | 2005-07-11 | 2008-04-09 | Macrogenics, Inc. | Methods of treating autoimmune disease using humanized anti-cd16a antibodies |
JP2009529331A (en) * | 2006-03-10 | 2009-08-20 | マクロジェニクス,インコーポレーテッド | Identification and engineering modification of antibodies having mutated heavy chains and methods of use thereof |
JP5620106B2 (en) * | 2007-10-24 | 2014-11-05 | 株式会社糖鎖工学研究所 | Polypeptide having enhanced effector function |
US8795667B2 (en) * | 2007-12-19 | 2014-08-05 | Macrogenics, Inc. | Compositions for the prevention and treatment of smallpox |
US8414893B2 (en) | 2007-12-21 | 2013-04-09 | Amgen Inc. | Anti-amyloid antibodies and uses thereof |
WO2009123894A2 (en) | 2008-04-02 | 2009-10-08 | Macrogenics, Inc. | Her2/neu-specific antibodies and methods of using same |
WO2010033279A2 (en) | 2008-06-04 | 2010-03-25 | Macrogenics, Inc. | Antibodies with altered binding to fcrn and methods of using same |
WO2010048588A2 (en) * | 2008-10-23 | 2010-04-29 | Massachusetts Institute Of Technology | Directed engagement of activating fc receptors |
SI2786762T1 (en) | 2008-12-19 | 2019-07-31 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US9238878B2 (en) | 2009-02-17 | 2016-01-19 | Redwood Bioscience, Inc. | Aldehyde-tagged protein-based drug carriers and methods of use |
CN108912228B (en) | 2009-05-08 | 2022-03-15 | 瓦西尼斯公司 | anti-CD 100 antibodies and methods of use thereof |
NZ608318A (en) * | 2010-09-02 | 2015-03-27 | Vaccinex Inc | Anti-cxcl13 antibodies and methods of using the same |
RU2606016C2 (en) | 2011-01-14 | 2017-01-10 | Редвуд Байосайнс, Инк. | Aldehyde marked immunoglobulin polypeptides and methods of their application |
SG195072A1 (en) | 2011-05-21 | 2013-12-30 | Macrogenics Inc | Cd3-binding molecules capable of binding to human and non-human cd3 |
EA029023B1 (en) | 2011-10-11 | 2018-01-31 | Вэксинекс, Инк. | Use of semaphorin-4d binding molecules for modulation of blood brain barrier permeability |
CA2865928C (en) | 2012-03-02 | 2021-02-16 | Vaccinex, Inc. | Cxcl13 antagonist for the treatment of sjogren's syndrome |
US9090709B2 (en) | 2012-03-28 | 2015-07-28 | Vaccinex, Inc. | Anti-SEMA4D antibodies and epitopes |
US10494440B2 (en) | 2012-05-11 | 2019-12-03 | Vaccinex, Inc. | Use of semaphorin-4D binding molecules to promote neurogenesis following stroke |
AU2014212206B2 (en) | 2013-01-31 | 2018-10-18 | Vaccinex, Inc. | Methods for increasing immunoglobulin A levels |
MX2015017485A (en) | 2013-06-25 | 2016-03-31 | Vaccinex Inc | Use of semaphorin-4d inhibitory molecules in combination with an immune modulating therapy to inhibit tumor growth and metastases. |
NZ630881A (en) | 2013-10-10 | 2016-03-31 | Vaccinex Inc | Use of semaphorin-4d binding molecules for treatment of atherosclerosis |
EP3057986B1 (en) * | 2013-10-17 | 2017-12-27 | National University of Singapore | Chimeric receptor that triggers antibody-dependent cell cytotoxicity against multiple tumors |
NZ630892A (en) | 2013-10-21 | 2016-03-31 | Vaccinex Inc | Use of semaphorin-4d binding molecules for treating neurodegenerative disorders |
CN106103476B (en) | 2013-12-24 | 2020-11-27 | 阿尔金克斯有限公司 | FcRn antagonists and methods of use |
WO2015157629A2 (en) | 2014-04-10 | 2015-10-15 | Obi Pharma Inc. | Antibodies, pharmaceutical compositions and uses thereof |
CN113549153A (en) | 2014-05-29 | 2021-10-26 | 宏观基因有限公司 | Trispecific binding molecules and methods of use thereof |
JP2018509413A (en) | 2015-03-09 | 2018-04-05 | アルゲン−エックス ビーブイビーエー | Methods for reducing serum levels of Fc-containing agents using FcRn antagonists |
EP3273993A4 (en) * | 2015-03-27 | 2018-11-07 | Nantkwest, Inc. | Genetically modified nk-92 cells and monoclonal antibodies for the treatment of cancer |
CN114773476A (en) * | 2015-04-13 | 2022-07-22 | 辉瑞公司 | Therapeutic antibodies and their use |
TWI773646B (en) | 2015-06-08 | 2022-08-11 | 美商宏觀基因股份有限公司 | Lag-3-binding molecules and methods of use thereof |
CN113502270A (en) | 2015-06-10 | 2021-10-15 | 南克维斯特公司 | Modified NK-92cells for the treatment of cancer |
TW201709929A (en) | 2015-06-12 | 2017-03-16 | 宏觀基因股份有限公司 | Combination therapy for the treatment of cancer |
CA3019398A1 (en) | 2016-04-26 | 2017-11-02 | R.P. Scherer Technologies, Llc | Antibody conjugates and methods of making and using the same |
WO2020013170A1 (en) * | 2018-07-10 | 2020-01-16 | 国立大学法人神戸大学 | ANTI-SIRPα ANTIBODY |
GB2589049C (en) | 2019-04-11 | 2024-02-21 | argenx BV | Anti-IgE antibodies |
MA56102A (en) | 2019-06-07 | 2022-04-13 | Argenx Bvba | PHARMACEUTICAL FORMULATIONS OF FCRN INHIBITORS SUITABLE FOR SUBCUTANEOUS ADMINISTRATION |
CA3163172A1 (en) | 2020-01-08 | 2021-07-15 | Peter Verheesen | Methods for treating pemphigus disorders |
CN117858902A (en) * | 2021-08-25 | 2024-04-09 | 南京金斯瑞生物科技有限公司 | Antibodies and variants thereof against human CD16a |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5219728A (en) * | 1987-02-24 | 1993-06-15 | Universite Pierre Et Maire Curie | Soluble forms of low affinity fc gamma receptors, process for their identification and dosage, a corresponding dosage kit, and applications |
Family Cites Families (32)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) * | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US4946788A (en) * | 1985-06-11 | 1990-08-07 | Ciba-Geigy Corporation | Purified immunoglobulin-related factor, novel monoclonal antibodies, hybridoma cell lines, processes and applications |
US5225539A (en) * | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
US5985599A (en) | 1986-05-29 | 1999-11-16 | The Austin Research Institute | FC receptor for immunoglobulin |
US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
EP0307434B2 (en) * | 1987-03-18 | 1998-07-29 | Scotgen Biopharmaceuticals, Inc. | Altered antibodies |
ATE120761T1 (en) | 1987-05-21 | 1995-04-15 | Creative Biomolecules Inc | MULTIFUNCTIONAL PROTEINS WITH PREDEFINED TARGET. |
EP0343950B1 (en) | 1988-05-27 | 2000-10-18 | Applied Research Systems ARS Holding N.V. | Human receptor Fc(gamma)RIII |
IL162181A (en) * | 1988-12-28 | 2006-04-10 | Pdl Biopharma Inc | A method of producing humanized immunoglubulin, and polynucleotides encoding the same |
US5116964A (en) | 1989-02-23 | 1992-05-26 | Genentech, Inc. | Hybrid immunoglobulins |
US5225538A (en) | 1989-02-23 | 1993-07-06 | Genentech, Inc. | Lymphocyte homing receptor/immunoglobulin fusion proteins |
US5399493A (en) | 1989-06-15 | 1995-03-21 | The Regents Of The University Of Michigan | Methods and compositions for the optimization of human hematopoietic progenitor cell cultures |
US5437994A (en) | 1989-06-15 | 1995-08-01 | Regents Of The University Of Michigan | Method for the ex vivo replication of stem cells, for the optimization of hematopoietic progenitor cell cultures, and for increasing the metabolism, GM-CSF secretion and/or IL-6 secretion of human stromal cells |
US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
ES2246502T3 (en) | 1990-08-29 | 2006-02-16 | Genpharm International, Inc. | TRANSGENIC NON-HUMAN ANIMALS ABLE TO PRODUCE HETEROLOGICAL ANTIBODIES. |
US6027725A (en) | 1991-11-25 | 2000-02-22 | Enzon, Inc. | Multivalent antigen-binding proteins |
US5837821A (en) | 1992-11-04 | 1998-11-17 | City Of Hope | Antibody construct |
AU6557194A (en) * | 1993-04-08 | 1994-11-08 | Trustees Of Columbia University In The City Of New York, The | Method for the synthesis of 4- and/or 5-(di)substituted 2-aminoimidazoles from 2-aminoimidazoles and aldehydes |
US5641863A (en) | 1993-09-30 | 1997-06-24 | University Of Pennsylvania | Chimeric IgG Fc receptors |
CA2186455A1 (en) | 1994-03-29 | 1995-10-05 | Raymond John Owens | Antibodies against e-selectin |
DE19619068A1 (en) * | 1996-05-13 | 1997-11-27 | Siemens Ag | Device for monitoring the transport process of flat items |
US5834597A (en) * | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
US6025158A (en) | 1997-02-21 | 2000-02-15 | Genentech, Inc. | Nucleic acids encoding humanized anti-IL-8 monoclonal antibodies |
US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
HUP0104865A3 (en) | 1999-01-15 | 2004-07-28 | Genentech Inc | Polypeptide variants with altered effector function |
US6737056B1 (en) * | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
WO2002061090A2 (en) | 2000-12-14 | 2002-08-08 | Genentech, Inc. | Prokaryotically produced antibodies and uses thereof |
AU2003232456B2 (en) | 2002-05-30 | 2009-06-04 | Macrogenics, Inc. | CD16A binding proteins and use for the treatment of immune disorders |
EP1907002A2 (en) * | 2005-07-11 | 2008-04-09 | Macrogenics, Inc. | Methods of treating autoimmune disease using humanized anti-cd16a antibodies |
-
2003
- 2003-05-29 AU AU2003232456A patent/AU2003232456B2/en not_active Ceased
- 2003-05-29 CA CA002487932A patent/CA2487932A1/en not_active Abandoned
- 2003-05-29 US US10/449,566 patent/US7351803B2/en not_active Expired - Fee Related
- 2003-05-29 BR BRPI0311471-6A patent/BR0311471A/en not_active IP Right Cessation
- 2003-05-29 DE DE60334453T patent/DE60334453D1/en not_active Expired - Lifetime
- 2003-05-29 AT AT03756297T patent/ATE483472T1/en not_active IP Right Cessation
- 2003-05-29 WO PCT/US2003/017111 patent/WO2003101485A1/en active Application Filing
- 2003-05-29 EP EP03756297A patent/EP1513554B9/en not_active Expired - Lifetime
- 2003-05-29 JP JP2004508840A patent/JP4524181B2/en not_active Expired - Fee Related
-
2005
- 2005-08-16 HK HK05107100.7A patent/HK1074991A1/en not_active IP Right Cessation
-
2007
- 2007-06-04 US US11/757,939 patent/US7838635B2/en not_active Expired - Fee Related
- 2007-06-04 US US11/757,932 patent/US7618628B2/en not_active Expired - Fee Related
-
2010
- 2010-10-14 US US12/904,554 patent/US20110152504A1/en not_active Abandoned
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5219728A (en) * | 1987-02-24 | 1993-06-15 | Universite Pierre Et Maire Curie | Soluble forms of low affinity fc gamma receptors, process for their identification and dosage, a corresponding dosage kit, and applications |
Non-Patent Citations (2)
Title |
---|
ANU TAMM ET AL.: "The binding epitopes of human CD16 (FcgammaRIII) monoclonal antibodies", THE JOURNAL OF IMMUNOLOGY, vol. 157, pages 1576 - 1581, XP002972484 * |
XIANGDONG ZHU ET AL.: "Intracellular expression of FcgammaRIII (CD16) and its mobilization by chemoattractants in human eosinophils", THE JOURNAL OF IMMUNOLOGY, vol. 161, pages 2574 - 2579, XP002972485 * |
Cited By (108)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7351875B2 (en) | 2002-06-07 | 2008-04-01 | Trillium Therapeutics, Inc. | FcγRIIa transgenic animal model for autoimmune disease |
EP1532250A1 (en) * | 2002-06-07 | 2005-05-25 | Arthron Limited | Fcyriia transgenic animal model for autoimmune disease |
EP1532250A4 (en) * | 2002-06-07 | 2005-12-07 | Arthron Ltd | Fcyriia transgenic animal model for autoimmune disease |
EP2272533A1 (en) | 2003-01-13 | 2011-01-12 | MacroGenics, Inc. | Soluble FcyR fusion proteins and methods of use thereof |
WO2005003175A3 (en) * | 2003-06-13 | 2005-03-17 | Biogen Idec Inc | Aglycosyl anti-cd154 (cd40 ligand) antibodies and uses thereof |
AU2011224032B2 (en) * | 2003-06-13 | 2013-01-31 | Biogen Ma Inc. | Aglycosyl Anti-CD154 (CD40 Ligand) Antibodies and Uses Thereof |
AU2004253868B2 (en) * | 2003-06-13 | 2011-06-16 | Biogen Ma Inc. | Aglycosyl anti-CD154 (CD40 ligand) antibodies and uses thereof |
US8318917B2 (en) | 2003-08-22 | 2012-11-27 | Biogen Idec Ma Inc. | Nucleic acids encoding antibodies having altered effector function and methods for making the same |
US7863419B2 (en) | 2003-08-22 | 2011-01-04 | Biogen Idec Ma Inc. | Antibodies having altered effector function and methods for making the same |
JP2005278633A (en) * | 2004-03-04 | 2005-10-13 | Hiroshima Univ | Method for producing chicken type monoclonal antibody, and chicken type monoclonal antibody produced by the production method |
JP4691650B2 (en) * | 2004-03-04 | 2011-06-01 | 国立大学法人広島大学 | Method for producing chicken monoclonal antibody, and chicken monoclonal antibody produced by the production method |
EP1766396A2 (en) * | 2004-06-07 | 2007-03-28 | Ramot at Tel-Aviv University Ltd. | Method of passive immunization against disease or disorder characterized by amyloid aggregation with diminished risk of neuroinflammation |
EP1766396A4 (en) * | 2004-06-07 | 2007-06-20 | Univ Ramot | Method of passive immunization against disease or disorder characterized by amyloid aggregation with diminished risk of neuroinflammation |
JP2006025695A (en) * | 2004-07-15 | 2006-02-02 | Wako Pure Chem Ind Ltd | ANTIBODY SPECIFIC TO Fcgamma RECEPTOR IIIa AND METHOD FOR MEASURING Fcgamma RECEPTOR IIIa BY USING THE SAME |
US8647625B2 (en) | 2004-07-26 | 2014-02-11 | Biogen Idec Ma Inc. | Anti-CD154 antibodies |
US8961976B2 (en) | 2004-07-26 | 2015-02-24 | Biogen Idec Ma Inc. | Anti-CD154 antibodies |
EP3026063A1 (en) | 2004-12-28 | 2016-06-01 | Innate Pharma S.A. | Monoclonal antibodies against nkg2a |
EP2476705A1 (en) | 2004-12-28 | 2012-07-18 | Innate Pharma | Monoclonal antibodies against NKG2A |
US9889197B2 (en) | 2005-04-15 | 2018-02-13 | Macrogenics, Inc. | Covalently-associated diabody complexes that possess charged coil domains and that are capable of enhanced binding to serum albumin |
US10093738B2 (en) | 2005-04-15 | 2018-10-09 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US11254747B2 (en) | 2005-04-15 | 2022-02-22 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US11254748B2 (en) | 2005-04-15 | 2022-02-22 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US9963510B2 (en) | 2005-04-15 | 2018-05-08 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
EP1868650A4 (en) * | 2005-04-15 | 2010-12-01 | Macrogenics Inc | Covalent diabodies and uses thereof |
US10093739B2 (en) | 2005-04-15 | 2018-10-09 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
EP3479844A1 (en) * | 2005-04-15 | 2019-05-08 | MacroGenics, Inc. | Covalent diabodies and uses thereof |
EP1868650A2 (en) * | 2005-04-15 | 2007-12-26 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US9296816B2 (en) | 2005-04-15 | 2016-03-29 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
US9284375B2 (en) | 2005-04-15 | 2016-03-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
AU2006251283B2 (en) * | 2005-05-26 | 2012-08-02 | Affimed Gmbh | Anti-CD16 binding molecules |
US9701750B2 (en) | 2005-05-26 | 2017-07-11 | Affimed Gmbh | Anti-CD16 binding molecules |
US9035026B2 (en) | 2005-05-26 | 2015-05-19 | Affimed Gmbh | Anti-CD16 binding molecules |
EP2450380A1 (en) * | 2005-05-26 | 2012-05-09 | Affimed Therapeutics AG | Anti-CD16 Binding Molecules |
WO2006125668A3 (en) * | 2005-05-26 | 2007-03-22 | Syngenta Crop Protection Ag | Anti-cd16 binding molecules |
JP2008541714A (en) * | 2005-05-26 | 2008-11-27 | アフィメート テラポイティクス アーゲー | Anti-CD16 binding molecule |
CN101583625B (en) * | 2005-05-26 | 2020-03-20 | 阿菲姆德农业医药公司 | anti-CD 16 binding molecules |
EP2426150A1 (en) | 2006-06-30 | 2012-03-07 | Novo Nordisk A/S | Anti-NKG2A antibodies and uses thereof |
EP2769993A1 (en) | 2007-12-14 | 2014-08-27 | Novo Nordisk A/S | Antibodies against human NKG2D and uses thereof |
EP2628753A1 (en) | 2008-01-24 | 2013-08-21 | Novo Nordisk A/S | Humanized anti-human NKG2A monoclonal antibody |
US10662253B2 (en) | 2008-01-31 | 2020-05-26 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Antibodies against human CD39 and use thereof for inhibiting T regulatory cells activity |
US11685792B2 (en) | 2008-01-31 | 2023-06-27 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Antibodies against human CD39 and use thereof for inhibiting T regulatory cells activity |
US8993730B2 (en) | 2008-04-02 | 2015-03-31 | Macrogenics, Inc. | BCR-complex-specific antibodies and methods of using same |
US9695236B2 (en) | 2008-04-02 | 2017-07-04 | Macrogenics, Inc. | BCR-complex-specific antibodies and methods of using same |
US10479831B2 (en) | 2008-04-02 | 2019-11-19 | Macrogenics, Inc | BCR-complex-specific antibodies and methods of using same |
US9096877B2 (en) | 2009-10-07 | 2015-08-04 | Macrogenics, Inc. | Fc region-containing polypeptides that exhibit improved effector function due to alterations of the extent of fucosylation, and methods for their use |
US9714296B2 (en) | 2010-03-04 | 2017-07-25 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
US9714295B2 (en) | 2010-03-04 | 2017-07-25 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
US9150656B2 (en) | 2010-03-04 | 2015-10-06 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
US9441049B2 (en) | 2010-03-04 | 2016-09-13 | Macrogenics, Inc. | Antibodies reactive with B7-H3 and uses thereof |
US10683364B2 (en) | 2010-03-04 | 2020-06-16 | Macrogenics, Inc. | Antibodies reactive with B7-H3, immunologically active fragments thereof and uses thereof |
US9896508B2 (en) | 2010-03-04 | 2018-02-20 | Macrogenics, Inc. | Antibodies reactive with B7-H3 and uses thereof |
US10730945B2 (en) | 2010-03-04 | 2020-08-04 | Macrogenics, Inc. | Antibodies reactive with B7-H3 and users thereof |
US9376495B2 (en) | 2011-05-21 | 2016-06-28 | Macrogenics, Inc. | Deimmunized serum-binding domains and their use in extending serum half-life |
US9487587B2 (en) | 2013-03-05 | 2016-11-08 | Macrogenics, Inc. | Bispecific molecules that are immunoreactive with immune effector cells of a companion animal that express an activating receptor and cells that express B7-H3 and uses thereof |
US11421031B2 (en) | 2013-03-14 | 2022-08-23 | Macrogenics, Inc. | Bispecific molecules that are immunoreactive with immune effector cells that express an activating receptor and an antigen expressed by a cell infected by a virus and uses thereof |
US10730947B2 (en) | 2013-03-14 | 2020-08-04 | Macrogenics, Inc. | Bispecific molecules that are immunoreactive with immune effector cells that express an activating receptor and an antigen expressed by a cell infected by a virus and uses thereof |
US9908938B2 (en) | 2013-03-14 | 2018-03-06 | Macrogenics, Inc. | Bispecific molecules that are immunoreactive with immune effector cells that express an activating receptor and an antigen expressed by a cell infected by a virus and uses thereof |
US11384149B2 (en) | 2013-08-09 | 2022-07-12 | Macrogenics, Inc. | Bi-specific monovalent Fc diabodies that are capable of binding CD32B and CD79b and uses thereof |
US10344092B2 (en) | 2013-08-09 | 2019-07-09 | Macrogenics, Inc. | Bi-specific monovalent Fc diabodies that are capable of binding CD32B and CD79b and uses thereof |
US9932400B2 (en) | 2013-08-23 | 2018-04-03 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding to gpA33 and CD3, and uses thereof |
US10858430B2 (en) | 2013-08-23 | 2020-12-08 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding to gpA33 and CD3, and uses thereof |
US10787521B2 (en) | 2013-08-23 | 2020-09-29 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding CD123 and CD3, and uses thereof |
US9822181B2 (en) | 2013-08-23 | 2017-11-21 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding CD123 and CD3, and uses thereof |
EP3799885A1 (en) | 2014-09-16 | 2021-04-07 | Innate Pharma | Neutralization of inhibitory pathways in lymphocytes |
US10717778B2 (en) | 2014-09-29 | 2020-07-21 | Duke University | Bispecific molecules comprising an HIV-1 envelope targeting arm |
EP3736294A2 (en) | 2014-10-10 | 2020-11-11 | Innate Pharma | Cd73 blockade |
EP3659625A1 (en) | 2014-10-23 | 2020-06-03 | Innate Pharma | Treatment of cancers using anti-nkg2a agents |
WO2016062851A1 (en) | 2014-10-23 | 2016-04-28 | Innate Pharma | Treatment of cancers using anti-nkg2a agents |
WO2017064043A1 (en) | 2015-10-12 | 2017-04-20 | Innate Pharma | Cd73 blocking agents |
US10954301B2 (en) | 2015-12-14 | 2021-03-23 | Macrogenics, Inc. | Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof |
US11840571B2 (en) | 2015-12-14 | 2023-12-12 | Macrogenics, Inc. | Methods of using bispecific molecules having immunoreactivity with PD-1 and CTLA-4 |
EP3868787A1 (en) | 2016-01-21 | 2021-08-25 | Innate Pharma | Neutralization of inhibitory pathways in lymphocytes |
WO2017125532A1 (en) | 2016-01-21 | 2017-07-27 | Innate Pharma | Neutralization of inhibitory pathways in lymphocytes |
WO2017142928A1 (en) | 2016-02-17 | 2017-08-24 | Macrogenics, Inc. | Ror1-binding molecules, and methods of use thereof |
WO2017153433A1 (en) | 2016-03-08 | 2017-09-14 | Innate Pharma | Siglec neutralizing antibodies |
EP3912681A1 (en) | 2016-03-14 | 2021-11-24 | Orega Biotech | Anti-cd39 antibodies |
WO2017157948A1 (en) | 2016-03-14 | 2017-09-21 | Innate Pharma | Anti-cd39 antibodies |
US11591400B2 (en) | 2016-04-15 | 2023-02-28 | Macrogenics, Inc. | B7-H3 directed antibody drug conjugates |
WO2017180813A1 (en) | 2016-04-15 | 2017-10-19 | Macrogenics, Inc. | Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
US10961311B2 (en) | 2016-04-15 | 2021-03-30 | Macrogenics, Inc. | B7-H3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
WO2017214092A1 (en) | 2016-06-07 | 2017-12-14 | Macrogenics, Inc. | Combination therapy |
WO2018065552A1 (en) | 2016-10-06 | 2018-04-12 | Innate Pharma | Anti-cd39 antibodies |
WO2018083080A2 (en) | 2016-11-04 | 2018-05-11 | Innate Pharma | Nkp46 ligand |
US11242402B2 (en) | 2016-12-23 | 2022-02-08 | Macrogenics, Inc. | ADAM9-binding molecules, and methods of use thereof |
WO2018141959A1 (en) | 2017-02-06 | 2018-08-09 | Innate Pharma | Immunomodulatory antibody drug conjugates binding to a human mica polypeptide |
US11578136B2 (en) | 2017-03-16 | 2023-02-14 | Innate Pharma | Compositions and methods for treating cancer |
WO2018167267A1 (en) | 2017-03-16 | 2018-09-20 | Innate Pharma | Compositions and methods for treating cancer |
WO2019011855A1 (en) | 2017-07-10 | 2019-01-17 | Innate Pharma | Siglec-9-neutralizing antibodies |
WO2019011852A1 (en) | 2017-07-10 | 2019-01-17 | Innate Pharma | Combination therapy using antibody to human siglec-9 and antibody to human nkg2a for treating cancer |
WO2019175182A1 (en) | 2018-03-13 | 2019-09-19 | Innate Pharma | Treatment of head and neck cancer |
WO2019206974A1 (en) | 2018-04-24 | 2019-10-31 | Innate Pharma | Methods for treating cancer by targeting nidogen-1 |
WO2019219658A1 (en) | 2018-05-15 | 2019-11-21 | Medimmune Limited | Treatment of cancer |
US11377503B2 (en) | 2018-06-18 | 2022-07-05 | Innate Pharma | Antibodies that bind human CD39 and inhibit ATPase activity of a soluble extracellular domain human CD39 polypeptide |
WO2019243252A1 (en) | 2018-06-18 | 2019-12-26 | Innate Pharma | Compositions and methods for treating cancer |
US10960024B2 (en) | 2018-08-01 | 2021-03-30 | Nantkwest, Inc. | Quadricistronic system comprising a homing receptor and chimeric antigen receptor for stable genetic modification of cellular immunotherapies |
US11058723B2 (en) | 2018-08-01 | 2021-07-13 | Nantkwest, Inc. | Quadricistronic system comprising a homing receptor and chimeric antigen receptor for stable genetic modification of cellular immunotherapies |
US11129850B2 (en) | 2018-08-01 | 2021-09-28 | Immunitybio, Inc. | Quadricistronic system comprising a homing receptor and chimeric antigen receptor for stable genetic modification of cellular immunotherapies |
WO2020028656A1 (en) * | 2018-08-01 | 2020-02-06 | Nantkwest, Inc. | A quadricistronic system comprising a homing receptor or a cytokine, and chimeric antigen receptor for genetic modification of immunotherapies |
WO2020035345A1 (en) | 2018-08-14 | 2020-02-20 | Innate Pharma | Treatment of colorectal cancer by a combination of an anti-mica antibody and an anti-nkg2a antibody |
WO2020136147A1 (en) | 2018-12-26 | 2020-07-02 | Innate Pharma | Compounds and methods for treatment of head and neck cancer |
WO2020136145A2 (en) | 2018-12-26 | 2020-07-02 | Innate Pharma | Leucocyte immunoglobulin-like receptor neutralizing antibodies |
WO2020216697A1 (en) | 2019-04-23 | 2020-10-29 | Innate Pharma | Cd73 blocking antibodies |
WO2020225552A1 (en) | 2019-05-06 | 2020-11-12 | Medimmune Limited | Combination of monalizumab, durvalumab, chemotherapy and bevacizumab or cetuximab for the treatment of colorectal cancer |
WO2021116277A1 (en) * | 2019-12-10 | 2021-06-17 | Institut Pasteur | New antibody blocking human fcgriiia and fcgriiib |
US11230699B2 (en) | 2020-01-28 | 2022-01-25 | Immunitybio, Inc. | Chimeric antigen receptor-modified NK-92 cells targeting EGFR super-family receptors |
WO2022033978A2 (en) | 2020-08-13 | 2022-02-17 | Innate Pharma | Cancer treatment methods using anti-cd73 antibodies |
WO2023118241A1 (en) | 2021-12-20 | 2023-06-29 | Vetoquinol Sa | Anti-canine interleukine-31-receptor a (il-31ra) antibodies and the uses thereof |
WO2023227660A1 (en) | 2022-05-25 | 2023-11-30 | Innate Pharma | Nectin-4 binding agents |
Also Published As
Publication number | Publication date |
---|---|
AU2003232456A1 (en) | 2003-12-19 |
US7838635B2 (en) | 2010-11-23 |
DE60334453D1 (en) | 2010-11-18 |
AU2003232456B2 (en) | 2009-06-04 |
US20070244303A1 (en) | 2007-10-18 |
US20110152504A1 (en) | 2011-06-23 |
EP1513554B9 (en) | 2011-11-09 |
EP1513554A4 (en) | 2006-06-28 |
ATE483472T1 (en) | 2010-10-15 |
EP1513554A1 (en) | 2005-03-16 |
US20080050371A1 (en) | 2008-02-28 |
CA2487932A1 (en) | 2003-12-11 |
EP1513554B1 (en) | 2010-10-06 |
US20040010124A1 (en) | 2004-01-15 |
BR0311471A (en) | 2007-04-27 |
JP2005532342A (en) | 2005-10-27 |
JP4524181B2 (en) | 2010-08-11 |
HK1074991A1 (en) | 2005-12-02 |
US7351803B2 (en) | 2008-04-01 |
US7618628B2 (en) | 2009-11-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1513554B1 (en) | Cd16a binding proteins and use for the treatment of immune disorders | |
JP7410143B2 (en) | Bispecific antibodies and their uses | |
US20070036786A1 (en) | Method of treating autoimmune disease using humanized anti-CD16A antibodies | |
US20230279117A1 (en) | Anti-pd-l1 antibodies and their use as therapeutics and diagnostics | |
AU2021200946A1 (en) | Canine antibodies with modified CH2-CH3 sequences | |
DK2380910T3 (en) | Antigen binding molecules with increased Fc receptor binding affinity and effector function | |
EP2496707B1 (en) | Engineered anti-tslp antibody | |
KR101495407B1 (en) | Humanized anti-CDCP1 antibodies | |
KR20210143192A (en) | Modified Fc fragments, antibodies comprising same, and applications thereof | |
AU2006290433A1 (en) | Modified antigen binding molecules with altered cell signaling activity | |
EP3180358B1 (en) | Novel antibodies directed to fc gamma receptor iib and fc epsilon receptor | |
KR20210131336A (en) | Antibodies to IL-7R alpha subunit and uses thereof | |
RU2811912C2 (en) | Antibodies against il-7r alpha subunit and their use | |
RU2785292C2 (en) | Bispecific antibody and its use | |
KR20230015327A (en) | Anti-OX40 Antibodies and Uses Thereof | |
JP2024512035A (en) | Antibodies targeting CD22 and CD79B | |
JP2024510200A (en) | Use of CD79B antibodies for autoimmune therapeutic applications |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NI NO NZ OM PH PL PT RO RU SC SD SE SG SK SL TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LU MC NL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 165429 Country of ref document: IL |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2004508840 Country of ref document: JP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2487932 Country of ref document: CA Ref document number: 2003232456 Country of ref document: AU |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2003756297 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2956/CHENP/2004 Country of ref document: IN |
|
WWP | Wipo information: published in national office |
Ref document number: 2003756297 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: PI0311471 Country of ref document: BR |